The URL can be used to link to this page

Home My WebLink About221-116PTD: 221-116 T38534 2/28/2024Kayla Junke Kayla Junke Digitally signed by Kayla Junke Date: 2024.02.28 09:25:17 -09'00' TT RR AA NN SS MM II TT TT AA LL FROM::Sandra D. Lemke, ATO-704 TO:: Meredith Guhl ConocoPhillips Alaska, Inc. AOGCC P.O. Box 100360 333 W. 7 th Avenue, Suite 100 Anchorage AK 99510-0360 Anchorage, Alaska RE:CD2-361 DATE: 02/01/2024 Transmitted: North Slope, Colville River Unit, Alaska Via SFTP upload Schlumberger Images Transmittall instructions: please promptly sign, scan, and e-mail to Sandra.D.Lemke@conocophillips.com CC: CD2-361 e-transmittal well folder Receipt: Date: Alaska/IT Data Services-GGRE |ConocoPhillips Alaska |Office: 907.265.6947; Mobile 907.440.4512 CD2-361 PTD: 221-116 0T38469 2/5/2024 Kayla Junke Digitally signed by Kayla Junke Date: 2024.02.05 11:05:25 -09'00' DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No Well Log Information: Digital Med/Frmt ReceivedStart Stop OH / CH Comments Log Media Run No Electr Dataset Number Name Interval List of Logs Obtained:GR, RES, PWD, DIR, AZI, DEN, NEU, CALIPER, POR, SONIC NoNo YesMud Log Samples Directional Survey REQUIRED INFORMATION (from Master Well Data/Logs) DATA INFORMATION Log/ Data Type Log Scale DF 7/5/20232 34488 Electronic Data Set, Filename: CD2- 361_Recorded_Mode_Drilling_Mechanics_Depth _MD.las 37804ED Digital Data DF 7/5/202344905 44908 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD001.las 37804ED Digital Data DF 7/5/202344915 44917 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD002.las 37804ED Digital Data DF 7/5/202344917 44924 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD003.las 37804ED Digital Data DF 7/5/202344930 44937 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD004.las 37804ED Digital Data DF 7/5/202344944 44957 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD005.las 37804ED Digital Data DF 7/5/202344968 44976 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD006.las 37804ED Digital Data DF 7/5/202344982 44997 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD007.las 37804ED Digital Data DF 7/5/202322046 23875 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD008.las 37804ED Digital Data DF 7/5/202345010 45019 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD009.las 37804ED Digital Data DF 7/5/202345020 45040 Electronic Data Set, Filename: CD2- 361_Drilling_Mechanics_Time_RM_LWD010.las 37804ED Digital Data DF 7/5/202312366 18468 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD005.las 37804ED Digital Data DF 7/5/2023308 13595 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD005_BROOH.las 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 1 of 31 PB1 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/20236283 12606 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM_LWD004.las 37804ED Digital Data DF 7/5/20236300 12602 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM_LWD004_MAD_pas s.las 37804ED Digital Data DF 7/5/20232366 2483 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM__LWD002.las 37804ED Digital Data DF 7/5/20232382 6444 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM__LWD003.las 37804ED Digital Data DF 7/5/20236288 6423 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM__LWD003_MAD_P ass.las 37804ED Digital Data DF 7/5/202350 2483 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM__LWD001.las 37804ED Digital Data DF 7/5/202350 2449 Electronic Data Set, Filename: CD2- 361_VISION_Resistivity_RM__LWD001_MAD_P ass.las 37804ED Digital Data DF 7/5/202320400 22169 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD007.las 37804ED Digital Data DF 7/5/2023204 22162 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD007_MAD_Pass.l as 37804ED Digital Data DF 7/5/202322062 23874 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD008.las 37804ED Digital Data DF 7/5/202322683 22790 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD008_MAD_Pass.l as 37804ED Digital Data DF 7/5/202323845 27240 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD009.las 37804ED Digital Data DF 7/5/202327093 34487 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD010.las 37804ED Digital Data DF 7/5/202320400 34479 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_LWD010_MAD_Pass.l as 37804ED Digital Data DF 7/5/202320400 22169 Electronic Data Set, Filename: CD2- 361_VISION_Service_RT_LWD007.las 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 2 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/202318395 20447 Electronic Data Set, Filename: CD2- 361_VISION_Service_Recorded_Mode_LWD006. las 37804ED Digital Data DF 7/5/202312 34487 Electronic Data Set, Filename: CD2- 361_VISION_Service_RM_50ft-34487ft.las 37804ED Digital Data DF 7/5/20232 34487 Electronic Data Set, Filename: CD2- 361_VISION_Service_Real_Time_Composite.las 37804ED Digital Data DF 7/5/202316286 20646 Electronic Data Set, Filename: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_LAS.las 37804ED Digital Data DF 7/5/202316286 20646 Electronic Data Set, Filename: CD2- 361_6.75in_RT_RM_TOC_16286ft_20646ft_LAS. las 37804ED Digital Data DF 7/5/202320160 27241 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_20160_27241ft_MD_Logs.las 37804ED Digital Data DF 7/5/202320461 26705 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_20440_27200ft_MD_ImageInter pr_Dips.las 37804ED Digital Data DF 7/5/202327262 34431 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_27200_34440ft_MD_ImageInter pr_Dips.las 37804ED Digital Data DF 7/5/202320410 34480 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_BROOH_20410_34480ft_Logs.l as 37804ED Digital Data DF 7/5/202327200 34487 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_Drill_27200_34440ft_Logs.las 37804ED Digital Data DF 7/5/202318496 20372 Electronic Data Set, Filename: CPAI_CD2- 361_Terrasphere_EM_Dips.las 37804ED Digital Data DF 7/5/202318250 20446 Electronic Data Set, Filename: CPAI_CD2- 361_TerraSphere_EM_Logs.las 37804ED Digital Data DF 7/5/202318250 20447 Electronic Data Set, Filename: CPAI_CD2- 361_TerraSphere_US_Caliper_Logs.las 37804ED Digital Data DF 7/5/202318530 20388 Electronic Data Set, Filename: CPAI_CD2- 361_Terrasphere_US_Dips.las 37804ED Digital Data DF 7/5/202318250 20446 Electronic Data Set, Filename: CPAI_CD2- 361_TerraSphere_US_Logs.las 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 EOW Letter.doc37804EDDigital Data Wednesday, September 20, 2023AOGCC Page 3 of 31 CD2-, 361_VISION_Service_RM_50ft-34487ft.las DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Depth_RM_Compos ite.PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD001.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD002.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD003.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD004.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD005.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD006.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD007.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD008.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD009.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_Drilling_Mechanics_Time_RM_LWD010.PD F 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 005.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_MADPass_Recorded_ Mode_LWD005.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 4 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D005.PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 005.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_MADPass_Recorded_ Mode_LWD005.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D005.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_MADPass_Recorded_ Mode_LWD004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_MADPass_Recorded_ Mode_LWD004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_MADPass_Recorded_ Mode_LWD004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_MADPass_Recorded_ Mode_LWD004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D004.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_MADPass_Recorded_ Mode_LWD003.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 5 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 002.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_MADPass_Recorded_ Mode_LWD003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D002.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_MADPass_Recorded_ Mode_LWD003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 002.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_MADPass_Recorded_ Mode_LWD003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D002.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D003.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_MADPass_Recorded_ Mode_LWD001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 001.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 6 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_MADPass_Recorded_ Mode_LWD001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_MADPass_Recorded_ Mode_LWD001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_MADPass_Recorded_ Mode_LWD001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D001.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: Note for BHA8 - LWD008+LWD009.txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 007.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D007.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 007.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D007.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Services_2MD_LWD007_Drilling_P ass_RT.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Services_2MD_LWD007_MAD_Pas s_RT.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 7 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_Services_5MD_LWD007_Drilling_P ass_RT.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Services_5MD_LWD007_MAD_Pas s_RT.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_MADPass_Recorded_ Mode_LWD008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_MADPass_Recorded_ Mode_LWD008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_MADPass_Recorded_ Mode_LWD008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_MADPass_Recorded_ Mode_LWD008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D008.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 009.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D009.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 009.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 8 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D009.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_MADPass_Recorded_ Mode_LWD010.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 010.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_MADPass_Recorded_ Mode_LWD010.PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D010.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_MADPass_Recorded_ Mode_LWD010.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 010.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_MADPass_Recorded_ Mode_LWD010.PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D010.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode_LWD 006.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode_LW D006.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode_LWD 006.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode_LW D006.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 9 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Recorded_Mode.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Recorded_Mode.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Recorded_Mode.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Recorded_Mode.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_MD_Real_Time_50ft- 34487ft.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_2_Inch_TVD_Real_Time_50ft- 34487ft.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_MD_Real_Time_50ft- 34487ft.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_5_Inch_TVD_Real_Time_50ft- 34487ft.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: Note for BHA8 - LWD008+LWD009.txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD005.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD005.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD005_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD005_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD004.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD004.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD004_BROOH.dlis 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 10 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD004_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD002.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD002.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD003.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD003.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD003_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD003_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD001.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD001.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD001_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD001_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD007.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD007.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD007_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD007_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD007_ToolSpecific _MicroScope.dlis 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 11 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD007_ToolSpecific _MicroScope.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD008.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD008.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD008_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD008_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD008_ToolSpecific _MicroScope.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD008_ToolSpecific _MicroScope.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD009.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD009.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD009_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD009_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD009_ToolSpecific _MicroScope.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD009_ToolSpecific _MicroScope.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD010.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD010.html 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 12 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD010_BROOH.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD010_BROOH.ht ml 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD010_ToolSpecific _MicroScope.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD010_ToolSpecific _MicroScope.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD006.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_VISION_Service_RM_LWD006.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361_VISION Service_Memory Drilling Data_50ft-34487ft.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361_VISION Service_Memory_50ft-34487ft.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 362_VISION_Service_Real_Time.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 362_VISION_Service_Real_Time.html 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD27 EOW Compass Surveys.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD27 final survey - Signed.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD27 final survey [canvas].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD27 final survey [macro].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD27 final survey [petrel].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD27 final survey [surveys].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD83 EOW Compass Surveys.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 13 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2-361 NAD83 final survey [canvas].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD83 final survey [macro].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD83 final survey [petrel].txt 37804ED Digital Data DF 7/5/2023 Electronic File: CD2-361 NAD83 final survey [surveys].txt 37804ED Digital Data DF 7/5/2023 Electronic File: O.1007988.04_CD2- 361_Surveys.csv 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_1000MD. PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_200MD.P DF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_4000MD. PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_500MD.P DF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_6000MD. PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_DLIS.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_PDF.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_PPT.pptx 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_RT_RM_TOC_16286ft_20646ft_DLIS .dlis 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 14 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_RT_RM_TOC_Repo rt_16286ft_20646ft.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_RT_RM_TOC_Repo rt_16286ft_20646ft.pptx 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_1000MD. PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_200MD.P DF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_4000MD. PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_500MD.P DF 37804ED Digital Data DF 7/5/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_6000MD. PDF 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_20440_27200ft_MD_Images_5i n.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_20440_27200ft_MD_Images_60 in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_27200_34440ft_MD_Images_5i n.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_27200_34440ft_MD_Images_60 in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_BROOH_20410_34430ft_MD_I mages_5in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_BROOH_20410_34430ft_MD_I mages_60in.pdf 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 15 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_BROOH_20410_34430_MD_Re s_Image-60in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_BROOH_20410_34430_MD_U HRI_Image-5in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_BROOH_20410_34430_MD_U HRI_Image-60in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Microscope_BROOH__20410_34430_MD_R es_Image_5in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Sidetrack_Microscope_20440_27200ft_MD_ Images.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Sidetrack_Microscope_Drill_27200_34440ft_ MD_Images.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI-CD2- 361_Sidetrack_Microscope_BROOH_20410_344 30ft_MD_Images.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Sidetrack_BROOH_Microscope_20410_344 30_MD_Res_Image.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Sidetrack_BROOH_Microscope_20410_344 30_MD_UHRI_Image.dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Terrasphere_Processed_Images_5in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Terrasphere_Processed_Images_60in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Terrasphere_US_Calipers_5in_60in.pdf 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Terrasphere_EM_Processed_Images_DLIS. dlis 37804ED Digital Data DF 7/5/2023 Electronic File: CPAI_CD2- 361_Terrasphere_US_Processed_Images.dlis 37804ED Digital Data Wednesday, September 20, 2023AOGCC Page 16 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/202350 25966 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Depth_RM.las 37809ED Digital Data DF 7/7/202344905 44908 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD001. las 37809ED Digital Data DF 7/7/202344915 44917 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD002. las 37809ED Digital Data DF 7/7/202344917 44924 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD003. las 37809ED Digital Data DF 7/7/202344930 44937 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD004. las 37809ED Digital Data DF 7/7/202344944 44957 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD005. las 37809ED Digital Data DF 7/7/202344968 44976 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD006. las 37809ED Digital Data DF 7/7/202344982 44997 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD007. las 37809ED Digital Data DF 7/7/202344999 45010 Electronic Data Set, Filename: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD008. las 37809ED Digital Data DF 7/7/202312366 18468 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD005.las 37809ED Digital Data DF 7/7/2023960 13595 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD005_MAD_P ass.las 37809ED Digital Data DF 7/7/20236283 12606 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD004.las 37809ED Digital Data DF 7/7/20236300 12602 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD004_MAD_p ass.las 37809ED Digital Data DF 7/7/20232366 2483 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD002.las 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 17 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/20232382 6444 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD003.las 37809ED Digital Data DF 7/7/20236288 6423 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD003_MAD_P ass.las 37809ED Digital Data DF 7/7/202350 2483 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD001.las 37809ED Digital Data DF 7/7/202350 2449 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD001_MAD_P ass.las 37809ED Digital Data DF 7/7/202320400 22169 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD007.las 37809ED Digital Data DF 7/7/202320800 22162 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_MADPass_LWD0 07.las 37809ED Digital Data DF 7/7/202320400 22169 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RT_LWD007.las 37809ED Digital Data DF 7/7/202320800 22162 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RT_MADPass_LWD0 07.las 37809ED Digital Data DF 7/7/202322140 25966 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD008.las 37809ED Digital Data DF 7/7/202323608 25848 Electronic Data Set, Filename: CD2- 361PB1_VISION_Service_RM_LWD008_MAD_P ass.las 37809ED Digital Data DF 7/7/202318395 20447 Electronic Data Set, Filename: CD2- 361PB1_RM_VISION_Services_LWD006.las 37809ED Digital Data DF 7/7/202350 25966 Electronic Data Set, Filename: CD2- 361PB1_RM_VISION_Services_Composite.las 37809ED Digital Data DF 7/7/202350 25966 Electronic Data Set, Filename: CD2- 361PB1_RT_VISION_Services_Composite.las 37809ED Digital Data DF 7/7/202316286 20646 Electronic Data Set, Filename: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_LAS.las 37809ED Digital Data DF 7/7/202316286 20646 Electronic Data Set, Filename: CD2- 361_6.75in_RT_RM_TOC_16286ft_20646ft_LAS. las 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 18 of 31 CD2-, 361PB1_RM_VISION_Services_Composite.las DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/202320160 25966 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_20160_25966ft_MD_Logs.las 37809ED Digital Data DF 7/7/202320461 25909 Electronic Data Set, Filename: CPAI-CD2- 361_Microscope_20440_25920ft_MD_Image_Dip s.las 37809ED Digital Data DF 7/7/202320134 22170 Electronic Data Set, Filename: CPAI_CD2- 361_Microscope_20134_22170ft_MD_Processed _Drill_Logs.las 37809ED Digital Data DF 7/7/202320461 22045 Electronic Data Set, Filename: CPAI_CD2- 361_Microscope_20240_22120ft_MD_Image_Dip s.las 37809ED Digital Data DF 7/7/202320755 22164 Electronic Data Set, Filename: CPAI_CD2- 361_Microscope_20755_22164ft_MD_BROOH_L ogs.las 37809ED Digital Data DF 7/7/202318496 20372 Electronic Data Set, Filename: CPAI_CD2- 361_Terrasphere_EM_Dips.las 37809ED Digital Data DF 7/7/202318250 20446 Electronic Data Set, Filename: CPAI_CD2- 361_TerraSphere_EM_Logs.las 37809ED Digital Data DF 7/7/202318250 20447 Electronic Data Set, Filename: CPAI_CD2- 361_TerraSphere_US_Caliper_Logs.las 37809ED Digital Data DF 7/7/202318530 20388 Electronic Data Set, Filename: CPAI_CD2- 361_Terrasphere_US_Dips.las 37809ED Digital Data DF 7/7/202318250 20446 Electronic Data Set, Filename: CPAI_CD2- 361_TerraSphere_US_Logs.las 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 EOW Letter.doc37809EDDigital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Depth_RM.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD001. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD002. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD003. PDF 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 19 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD004. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD005. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD006. pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD007. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_Drilling_Mechanics_Time_RM_LWD008. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_2_inch_MD_Recorded_Mode_LWD005.p df 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_2_Inch_TVD_MADPass_Recorded_Mod e_LWD005.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_2_Inch_TVD_Recorded_Mode_LWD005. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_5_Inch_MD_Recorded_Mode_LWD005. pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_5_Inch_TVD_MADPass_Recorded_Mod e_LWD005.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_5_Inch_TVD_Recorded_Mode_LWD005. pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_inch_MD_MADPass _Recorded_Mode_LWD005.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_inch_MD_MADPass _Recorded_Mode_LWD005.PDF 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 20 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_MADPass_Record ed_Mode_LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_Recorded_Mode_ LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_MADPAss_Recor ded_Mode_LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_Recorded_Mode_ LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_MADPass_Record ed_Mode_LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_Recorded_Mode_ LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_MADPass_Recor ded_Mode_LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_Recorded_Mode_ LWD004.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_MADPass_Record ed_Mode_LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_Recorded_Mode_ LWD002.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_Recorded_Mode_ LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_MADPass_Recor ded_Mode_LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_Recorded_Mode_ LWD002.pdf 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 21 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_Recorded_Mode_ LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_MADPass_Record ed_Mode_LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_Recorded_Mode_ LWD002.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_Recorded_Mode_ LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_MADPass_Recor ded_Mode_LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_Recorded_Mode_ LWD002.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_Recorded_Mode_ LWD003.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_MADPass_Record ed_Mode_LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_Recorded_Mode_ LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_MADPass_Recor ded_Mode_LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_Recorded_Mode_ LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_MADPass_Record ed_Mode_LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_Recorded_Mode_ LWD001.pdf 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 22 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_MADPass_Recor ded_Mode_LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_Recorded_Mode_ LWD001.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_Inch_MD_MADPass _Real_Time_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_Inch_MD_Real- time_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_Inch_MD_Recorded _Mode_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_Inch_TVD_MADPas s_Real_Time_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_inch_TVD_Real_Ti me_LWD007.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_2_Inch_TVD_Recorde d_Mode_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_Inch_MD_MADPass _Real_Time_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_Inch_MD_Real_Tim e_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_Inch_MD_Recorded _Mode_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_Inch_TVD_MADPas s_Real_Time_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_Inch_TVD_Real_Ti me_LWD007.pdf 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 23 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_5_Inch_TVD_Recorde d_Mode_LWD007.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_MADPass_Record ed_Mode_LWD008.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_Recorded_Mode_ LWD008.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_MADPass_Recor ded_Mode_LWD008.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_Recorded_Mode_ LWD008.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_MADPass_Record ed_Mode_LWD008.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_Recorded_Mode_ LWD008.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_MADPass_Recor ded_Mode_LWD008.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_Recorded_Mode_ LWD008.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_MD_Recorded_Mode_ LWD006.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_2_Inch_TVD_Recorded_Mode_ LWD006.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_MD_Recorded_Mode_ LWD006.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_5_Inch_TVD_Recorded_Mode_ LWD006.pdf 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 24 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_2_Inch_MD_Recorded Mode.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_2_Inch_TVD_Recorded_Mode.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_5_Inch_MD_Recorded Mode.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1_VISION Service_5_Inch_TVD_Recorded_Mode.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_2TVD_50ft- 25966ft.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_5MD_50ft- 25966ft.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_5TVD_50ft- 25966ft.PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD001.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD001.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD001_BROOH .dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD001_BROOH .html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD002.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD002.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD003.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD003.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD003_BROOH .dlis 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 25 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD003_BROOH .html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD004.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD004.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD004_BROOH .dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD004_BROOH .html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD005.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD005.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD005_BROOH .dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD005_BROOH .html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD006.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD006.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD007.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD007.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD007_BROOH .dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD007_BROOH .html 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 26 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD007_ToolSp ecific_MicroScope.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD007_ToolSp ecific_MicroScope.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_LWD007.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_LWD007.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_MADPass_LWD0 07.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RT_MADPass_LWD0 07.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD008.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD008.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD008_BROOH .dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD008_BROOH .html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD008_ToolSp ecific_MicroScope.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RM_LWD008_ToolSp ecific_MicroScope.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RTRM_Composite.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_RTRM_Composite.htm l 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 27 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_Real_Time_50ft- 25966ft.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361PB1_VISION_Service_Real_Time_50ft- 25966ft.html 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD27 EOW Compass Surveys.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD27 final survey - Signed.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD27 final survey [canvas].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD27 final survey [macro].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD27 final survey [petrel].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD27 final survey [surveys].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD83 EOW Compass Surveys.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD83 final survey [canvas].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD83 final survey [macro].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD83 final survey [petrel].txt 37809ED Digital Data DF 7/7/2023 Electronic File: CD2-361PB1 NAD83 final survey [surveys].txt 37809ED Digital Data DF 7/7/2023 Electronic File: O.1007988.04_CD2- 361PB1_Surveys.csv 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_1000MD. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_200MD.P DF 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 28 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_4000MD. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_500MD.P DF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RT_6000MD. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_DLIS.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_PDF.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2_361_SonicScope475_Realtime_TOC _16286ft_20646ft_PPT.pptx 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_RT_RM_TOC_16286ft_20646ft_DLIS .dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_RT_RM_TOC_Repo rt_16286ft_20646ft.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_RT_RM_TOC_Repo rt_16286ft_20646ft.pptx 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_1000MD. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_200MD.P DF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_4000MD. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_500MD.P DF 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 29 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No DF 7/7/2023 Electronic File: CD2- 361_6.75in_SonicScope475_TOC_RM_6000MD. PDF 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI-CD2- 361_Microscope_20440_25920ft_MD_Images_5i n.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI-CD2- 361_Microscope_20440_25920ft_MD_Images_60 in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20900_22075ft_MD_Processed _BROOH_Images_5in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20900_22075ft_MD_Processed _BROOH_Images_60in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20900_22075ft_MD_Processed _Drill_Images_5in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20900_22075ft_MD_Processed _Drill_Images_60in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI-CD2- 361_Microscope_20440_25920ft_MD_Images.dli s 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20240_22120ft_MD_Processed _Drill_Images.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20900_22075ft_MD_Processed _BROOH_Images.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Microscope_20900_22075ft_MD_Processed _Drill_Images.dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Terrasphere_Processed_Images_5in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Terrasphere_Processed_Images_60in.pdf 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Terrasphere_US_Calipers_5in_60in.pdf 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 30 of 31 DATA SUBMITTAL COMPLIANCE REPORT API No.50-103-20836-00-00Well Name/No.COLVILLE RIV UNIT CD2-361 Completion Status 1-OILCompletion Date 5/7/2023 Permit to Drill 2211160 Operator ConocoPhillips Alaska, Inc. MD 34487 TVD 7184 Current Status 1-OIL 9/20/2023 UIC No Well Cores/Samples Information: ReceivedStart Stop Comments Total Boxes Sample Set NumberName Interval INFORMATION RECEIVED Completion Report Production Test Information Geologic Markers/Tops Y Y / NA Y Comments: Compliance Reviewed By:Date: Mud Logs, Image Files, Digital Data Composite Logs, Image, Data Files Cuttings Samples Y / NA Y Y / NA Directional / Inclination Data Mechanical Integrity Test Information Daily Operations Summary Y Y / NA Y Core Chips Core Photographs Laboratory Analyses Y / NA Y / NA Y / NA COMPLIANCE HISTORY Date CommentsDescription Completion Date:5/7/2023 Release Date:1/20/2022 DF 7/7/2023 Electronic File: CPAI_CD2- 361_Terrasphere_EM_Processed_Images_DLIS. dlis 37809ED Digital Data DF 7/7/2023 Electronic File: CPAI_CD2- 361_Terrasphere_US_Processed_Images.dlis 37809ED Digital Data Wednesday, September 20, 2023AOGCC Page 31 of 31 M. Guhl 9/20/2023 t>>ED W/η^Zs/KZZη&/>ED^Zs/^Z/Wd/KE >/sZ>^Z/Wd/KE ddzW d>K''K>KZWZ/Ed^ ƐCD2-361 PB1 50-103-20837-00-00 221-116 COLVILLE RIVER MWD/LWD/DD VISION SERVICES FINAL FIELD 1dƌĂŶƐŵŝƚƚĂůZĞĐĞŝƉƚͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ yͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺWƌŝŶƚEĂŵĞ ^ŝŐŶĂƚƵƌĞ ĂƚĞWůĞĂƐĞƌĞƚƵƌŶǀŝĂĐŽƵƌŝĞƌŽƌƐŝŐŶͬƐĐĂŶĂŶĚĞŵĂŝůĂĐŽƉǇƚŽ^ĐŚůƵŵďĞƌŐĞƌ͘sdƵŽŶŐΛƐůď͘ĐŽŵ^>ƵĚŝƚŽƌͲdƌĂŶƐŵŝƚƚĂůZĞĐĞŝƉƚƐŝŐŶĂƚƵƌĞĐŽŶĨŝƌŵƐƚŚĂƚĂƉĂĐŬĂŐĞ;ďŽǆ͕ĞŶǀĞůŽƉĞ͕ĞƚĐ͘ͿŚĂƐďĞĞŶƌĞĐĞŝǀĞĚĂŶĚƚŚĞĐŽŶƚĞŶƚƐŽĨƚŚĞƉĂĐŬĂŐĞŚĂǀĞďĞĞŶǀĞƌŝĨŝĞĚƚŽŵĂƚĐŚƚŚĞŵĞĚŝĂŶŽƚĞĚĂďŽǀĞ͘dŚĞƐƉĞĐŝĨŝĐĐŽŶƚĞŶƚŽĨƚŚĞƐĂŶĚͬŽƌŚĂƌĚĐŽƉǇƉƌŝŶƚƐŵĂǇŽƌŵĂǇŶŽƚŚĂǀĞďĞĞŶǀĞƌŝĨŝĞĚĨŽƌĐŽƌƌĞĐƚŶĞƐƐŽƌƋƵĂůŝƚǇůĞǀĞůĂƚƚŚŝƐƉŽŝŶƚ͘η^ĐŚůƵŵďĞƌŐĞƌͲWƌŝǀĂƚĞPTD: 221-116 T37809Kayla JunkeDigitally signed by Kayla Junke Date: 2023.07.07 08:53:20 -08'00' t>>ED W/η^Zs/KZZη&/>ED^Zs/^Z/Wd/KE >/sZ>^Z/Wd/KE ddzW d>K''K>KZWZ/Ed^ ƐCD2-361 50-103-20836-00-00 221-116 COLVILLE RIVER MWD/LWD/DD VISION SERVICES FINAL FIELD 1dƌĂŶƐŵŝƚƚĂůZĞĐĞŝƉƚͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ yͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺWƌŝŶƚEĂŵĞ ^ŝŐŶĂƚƵƌĞ ĂƚĞWůĞĂƐĞƌĞƚƵƌŶǀŝĂĐŽƵƌŝĞƌŽƌƐŝŐŶͬƐĐĂŶĂŶĚĞŵĂŝůĂĐŽƉǇƚŽ^ĐŚůƵŵďĞƌŐĞƌ͘sdƵŽŶŐΛƐůď͘ĐŽŵ^>ƵĚŝƚŽƌͲdƌĂŶƐŵŝƚƚĂůZĞĐĞŝƉƚƐŝŐŶĂƚƵƌĞĐŽŶĨŝƌŵƐƚŚĂƚĂƉĂĐŬĂŐĞ;ďŽǆ͕ĞŶǀĞůŽƉĞ͕ĞƚĐ͘ͿŚĂƐďĞĞŶƌĞĐĞŝǀĞĚĂŶĚƚŚĞĐŽŶƚĞŶƚƐŽĨƚŚĞƉĂĐŬĂŐĞŚĂǀĞďĞĞŶǀĞƌŝĨŝĞĚƚŽŵĂƚĐŚƚŚĞŵĞĚŝĂŶŽƚĞĚĂďŽǀĞ͘dŚĞƐƉĞĐŝĨŝĐĐŽŶƚĞŶƚŽĨƚŚĞƐĂŶĚͬŽƌŚĂƌĚĐŽƉǇƉƌŝŶƚƐŵĂǇŽƌŵĂǇŶŽƚŚĂǀĞďĞĞŶǀĞƌŝĨŝĞĚĨŽƌĐŽƌƌĞĐƚŶĞƐƐŽƌƋƵĂůŝƚǇůĞǀĞůĂƚƚŚŝƐƉŽŝŶƚ͘η^ĐŚůƵŵďĞƌŐĞƌͲWƌŝǀĂƚĞPTD: 221-116 T37804Kayla JunkeDigitally signed by Kayla Junke Date: 2023.07.05 10:51:33 -08'00' 1a. Well Status:Oil SPLUG Other Abandoned Suspended 1b. Well Class: 20AAC 25.105 20AAC 25.110 Development Exploratory GINJ WINJ WDSPL No. of Completions: __________________ Service Stratigraphic Test 2. Operator Name: 6. Date Comp., Susp., or 14. Permit to Drill Number / Sundry: Aband.: 3. Address: 7. Date Spudded: 15. API Number: 4a. Location of Well (Governmental Section): 8. Date TD Reached: Surface: Top of Productive Interval: 9. Ref Elevations: KB: 17. Field / Pool(s): GL: 15.5 BF: Total Depth: 2420' FNL, 264 FEL, Sec 8, T12N, R4E 10. Plug Back Depth MD/TVD: 18. Property Designation: 4b. Location of Well (State Base Plane Coordinates, NAD 27): 11. Total Depth MD/TVD: 19. DNR Approval Number: Surface: x- y- Zone- 4 TPI: x- y- Zone- 4 12. SSSV Depth MD/TVD: 20. Thickness of Permafrost MD/TVD: Total Depth: x- y- Zone- 4 5. Directional or Inclination Survey: Yes (attached) No 13. Water Depth, if Offshore: 21. Re-drill/Lateral Top Window MD/TVD: Submit electronic information per 20 AAC 25.050 N/A (ft MSL) 22. Logs Obtained: 23. BOTTOM 30" X65 137' 20" L-80 2412' 17" P110 4407' 13-5/8" L-80 5681' 9-7/8" L-80 6896' 7-5/8" L-80 20445' 7134' 4-1/2" P-110S 7121' 4-1/2" P-110S 7191' 24. Open to production or injection? Yes No 25. 26. Was hydraulic fracturing used during completion? Yes No DEPTH INTERVAL (MD) AMOUNT AND KIND OF MATERIAL USED 27. Date First Production: Method of Operation (Flowing, gas lift, etc.): Hours Tested: Production for Gas-MCF: Test Period Casing Press: Calculated Gas-MCF: Oil Gravity - API (corr): Press. 24-Hour Rate 6-3/4" Tail: 84 bbls of 15.8ppg Class G 328 ADL 390344, ADL380093. ADL388904, ADL388906, ADL387211, ADL387212, ADL025530, ADL38007, AA084140 56' 137' 56'56"10 yards 29.7 18103' 6820' 10-1/4" STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION WELL COMPLETION OR RECOMPLETION REPORT AND LOG ConocoPhillips Alaska, Inc. WAG Gas 5/7/2023 221-116/322-508/322-640/323-128 50-103-20836-00-00 LONS 97-007 12/10/2022 34,487' MD/7,184'TVD 25966'MD/7187'TVD 70 P.O. Box 100360 Anchorage, AK 99510-0360 371464 5974180 1592 FNL, 1476FEL, Sec 22, T12N, R4E 4/13/20232181' FNL, 1770' FEL, Sec 2, T11N, R4E 5990693 1309'MD/1304'TVD SETTING DEPTH TVD 6000595 TOP HOLE SIZE AMOUNT PULLED 366746 357558 TOP SETTING DEPTH MD suspension, or abandonment; or within 90 days of acquisition of the log, whichever occurs first. Types of logs to be listed include, but are not limited to: mud log, spontaneous potential, gamma ray, caliper, resistivity, porosity, magnetic resonance, dipmeter, formation tester, temperature, cement evaluation, casing collar locator, jewelry, and perforation record. Acronyms may be used. Attach a separate page only if necessary. Colville River Field/ Alpine Oil Pool 23877'MD/7181"TVD BOTTOM CASING, LINER AND CEMENTING RECORD List all logs run and, pursuant to AS 31.05.030 and 20 AAC 25.071, submit all electronic data within 90 days of completion, CASING WT. PER FT.GRADE CEMENTING RECORD 24" 20" Lead:645 bbls of 11ppg Class G Tail:155 bbls of 15.8ppg Class G 2264'Lead: 382 bbls of 11ppg Class G Tail: 98 bbls of 15.8ppg Class G 12.6 18468' 5645' 56' 20145' 6404 6-3/4" Tail: 194 bbls of 15.8ppg Class G 17-1/2" 2319' 56' 13-1/2" 12.6 20035' 88.2 34350' 53' 7119' 133 88.1 2479' 53' 12599' 20170' 7112' 12423' 5/31/2023 24 Flow Tubing 296 1937 2801937 Gas Lift Liner @ 20,145'MD/7,119'TVD to 34,350'MD/7,191'TVD 6915 Gas-Oil Ratio:Choke Size: Per 20 AAC 25.283 (i)(2) attach electronic information SIZE DEPTH SET (MD) PACKER SET (MD/TVD)If Yes, list each interval open (MD/TVD of Top and Bottom; Perforation Size and Number; Date perf'd or liner run): ACID, FRACTURE, CEMENT SQUEEZE, ETC. TUBING RECORD 20039'4.5" Tail: 147 bbls of 15.8ppg Class G Sr Res EngSr Pet GeoSr Pet Eng 128 N/A 32.5 Oil-Bbl: Water-Bbl: 6915 18060'MD/6811'TVD GR, RES, PWD, DIR, AZI, DEN, NEU, CALIPER, POR, SONIC Water-Bbl: PRODUCTION TEST 5/28/2023 Date of Test: Oil-Bbl: 2963911129 62.8 Form 10-407 Revised 10/2022 Due within 30 days of Completion, Suspension, or Abandonment 16. Well Name and Number: CD2-361 By Grace Christianson at 9:21 am, Jun 02, 2023 Completed 5/7/2023 JSB RBDMS JSB 060823 ADL025529, ADL380075 SFD DSR-6/12/23SFD 9/20/2023 GVTL 9/21/2023 Conventional Core(s): Yes No Sidewall Cores: 30. MD TVD Surface Surface 1309 1304 Schrader Bluff 1062 1061 2272 2220 3186 3031 5016 4086 11205 5391 19032 7001 K1 19298 7036 20282 7129 34487 7184 (Kuparuk C) 31. List of Attachments: 32. I hereby certify that the foregoing is true and correct to the best of my knowledge. Contact Name: Matt Nagel Digital Signature with Date:Contact Email:matt.b.nagel@conocophillips.com Contact Phone:907-263-4747 General: Item 1a: Item 1b: Item 4b: Item 9: Item 15: Item 19: Item 20: Item 22: Item 23: Item 24: Item 27: Item 28: Item 30: Item 31: Yes No Well tested? Yes No 28. CORE DATA If Yes, list intervals and formations tested, briefly summarizing test results for each. Attach separate pages if needed and submit detailed test info including reports and Excel or ASCII tables per 20 AAC 25.071. NAME Permafrost - Top Permafrost - Base If Yes, list formations and intervals cored (MD/TVD, From/To), and briefly summarize lithology and presence of oil, gas or water (submit separate pages if needed). Submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results per 20 AAC 25.071 no matter when acquired. 29. GEOLOGIC MARKERS and POOL BOUNDARIES: (list all encountered) FORMATION TESTS Well Class - Service wells: Gas Injection, Water Injection, Water-Alternating-Gas Injection, Salt Water Disposal, Water Supply for Injection, Observation, or Other. Albian 97 C-40 Kalubik Report the Division of Oil & Gas / Division of Mining Land and Water: Plan of Operations (LO/Region YY-123), Land Use Permit (LAS 12345), and/or Easement (ADL 123456) number. The Kelly Bushing, Ground Level, and Base Flange elevations in feet above Mean Sea Level. Use same as reference for depth measurements given in other spaces on this form and in any attachments. The API number reported to AOGCC must be 14 digits (ex: 50-029-20123-00-00). This form and the required attachments provide a complete and concise record for each well drilled in Alaska. Submit a current well schematic diagram with each 10-407. Submit 10-407 and attachments in PDF format to aogcc.permitting@alaska.gov. All laboratory analytical reports from a well must be submitted to the AOGCC, no matter when the analyses are conducted per 20 AAC 25.071. Information to be attached includes, but is not limited to: summary of daily operations, wellbore schematic, directional or inclination survey, as-built, core analysis, paleontological report, production or well test results, per 20 AAC 25.070. Multiple completion is defined as a well producing from more than one pool with production from each pool completely segregated. Each segregated pool is a completion. C-10 Qannik Formation Name at TD: TPI (Top of Producing Interval). Authorized Name and Pursuant to 20 AAC 25.070, attach to this form: well schematic diagram, summary of daily well operations, directional or inclination survey, and other tests as required including, but not limited to: core analysis, paleontological report, production or well test results. Report measured depth and true vertical thickness of permafrost. Provide MD and TVD for the top and base of permafrost in Box 29. Attached supplemental records should show the details of any multiple stage cementing and the location of the cementing tool. If this well is completed for separate production from more than one interval (multiple completion), so state in item 1, and in item 23 show the producing intervals for only the interval reported in item 26. (Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval). Provide a listing of intervals cored and the corresponding formations, and a brief description in this box. Pursuant to 20 AAC 25.071, submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results, including, but not limited to: porosity, permeability, fluid saturation, fluid composition, fluid fluorescence, vitrinite reflectance, geochemical, or paleontology. Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water Injection, Gas Injection, Shut-in, or Other (explain). Provide a listing of intervals tested and the corresponding formation, and a brief summary in this box. Submit detailed test and analytical laboratory information required by 20 AAC 25.071. Review the reporting requirements of 20 AAC 25.071 and, pursuant to AS 31.05.030, submit all electronic data within 90 days of completion, suspension, or abandonment; or 90 days after log acquisition, whichever occurs first. INSTRUCTIONS Top of Productive Interval (Kuparuk C) Authorized Title: Drilling Engineer Direction Survey, Operations Summary, Cementing Summary, Well Schematic Form 10-407 Revised 10/2022 Submit in PDF format to aogcc.permitting@alaska.gov Last Rev Reason Annotation Wellbore End Date Last Mod By Rev Reasons: Pull SOV, Set DMY, Post Rig CD2-361 5/16/2023 oberr Casing Strings Csg Des OD (in) ID (in) Top (ftKB) Set Depth (ftKB) Set Depth (TVD) (ftKB) Wt/Len (lb/ft) Grade Top Thread Conductor 30 28.00 56.8 136.8 136.7 328.00 X65 Welded Surface 20 18.73 56.1 2,478.5 2,411.8 133.00 L80 TER Liner 17 16.00 2,319.3 6,404.0 4,407.2 88.10 P110-IC TSH 521 Intermediate 13 5/8 12.38 52.8 12,599.0 5,681.4 88.20 L-80 IC H563 Liner 9 7/8 8.63 12,423.3 18,468.0 6,895.9 62.80 L-80 TSH 563 Liner 7 5/8 6.88 18,103.4 20,445.0 7,134.4 29.70 L-80 TSH 523 Liner 4 1/2 3.91 20,034.8 20,169.6 7,121.0 12.60 P-110S H563 Liner 4 1/2 3.91 20,145.0 34,350.0 7,190.8 12.60 P-110S H563 Tubing Strings: string max indicates LONGEST segment of string Top (ftKB) 48.9 Set Depth … 20,038.7 Set Depth … 7,112.0 String Ma… 4 1/2 Tubing Description Tubing – Completion Upper Wt (lb/ft) 12.60 Grade L-80 Top Connection H563 ID (in) 3.96 Completion Details: excludes tubing, pup, space out, thread, RKB... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 48.9 48.9 0.00 Hanger 13.625 CIW 5" Hanger HYD 563, TBG, SSMC, 13 5/8"X5", Min ID 3.9" Camero n SSMC 3.900 2,188.9 2,141.3 19.14 Nipple - DB 5.000 Nipple, Landing, 5", "DB-6", 3.813", H563 SLB DB 3.810 4,138.4 3,681.6 56.06 Mandrel – GAS LIFT 5.000 GLM #1, 5" x 1" KBG4-5, 24.1# H563 SLB KBG4-5 3.940 5,360.4 4,191.3 76.47 Nipple - X 4.500 Nipple, Landing, 4 1/2", "X", 3.813", H563 Halliburt on X3.812 5,365.8 4,192.5 76.54 Mandrel – GAS LIFT 4.500 GLM#2, Silverwell Smart w/ DHG 4- 1/2, 12.6#, L-80, Vam Top Silverwel l GLM Dial w/DHG 3.898 5,373.6 4,194.3 76.63 Nipple - Polished Receptacle 4.500 3.813" ID Polished bore Joint,Pup, 4 1/2", 12.6#, L80, H563 3.812 6,056.6 4,337.0 77.64 Mandrel – GAS LIFT 4.500 GLM #3, 4-1/2" x 1" KBG4-5 12.6# H563 SLB KBG4-5 3.865 17,914.9 6,780.9 77.93 Nipple - DB 4.500 Nipple, Landing, 4 1/2", "DB", 3.750", H563 3.747 17,920.8 6,782.1 77.92 Mandrel – GAS LIFT 4.500 GLM#4, Silverwell Smart w/ DHG 4- 1/2, 12.6#, L-80, Vam Top Silverwel l GLM Dial w/DHG 3.899 17,928.6 6,783.7 77.90 Nipple - Polished Receptacle 4.500 Joint,Pup, 3.750" ID Polished bore, 4 1/2", 12.6#, L80, H563 3.748 17,993.4 6,797.3 77.97 Sleeve - Sliding 4.500 Sliding Sleeve, CMU, 4.5" x 3.688" DB profile, H563, Up to open Baker 3.680 18,059.5 6,811.0 78.06 Packer 8.630 Baker Premier Packer w/ Striker Packer, 4.5" x 9-7/8", 12.6# L-80 TSH 563 BxP Baker 3.940 18,135.4 6,826.6 78.15 Nipple - DB 4.500 Nipple, Landing, 4.5", "DB-6", 3.563", H563 SLB 3.563 20,018.5 7,110.6 86.07 Nipple - Seating 4.500 Ball Seat Sub (3.45" Ball Seat for 3.5" Ball) Baker Baker 3.450 20,029.2 7,111.3 86.06 Locator 4.500 Knob Locator 4-1/2" 12.6# TXP BxP (6.38" OD) Baker 3.890 20,035.4 7,111.7 86.06 Shoe - Mule 4.500 HES Self orienting shoe/ Joint, Pup, 4 1/2", 12.6#, L80, H563 HES 3.930 Other In Hole (Wireline retrievable plugs, valves, pumps, fish, etc.) Top (ftKB) Top (TVD) (ftKB)Top Incl (°)Des Com Make Model SN Run Date ID (in) 20,145.0 7,119.3 86.02 FISH One friction block (0.594”H x 0.750”W x 6.000”L), and one friction block retainer (0.375”H x 0.672”W x 1.00”L), left somewhere below 4.5 TOL in liner most likely below 20,145'. 4/28/2023 0.000 20,145.0 7,119.3 86.02 FISH Three compression springs from liner hanger running tool. (0.420” OD x 1.25”L left somewhere below 4.5 TOL in liner most likely below 20,145' 4/28/2023 0.000 20,145.0 7,119.3 86.02 FISH One shoulder bolt from liner hanger running tool (0.313” max OD x 1.334”L) left somewhere below 4.5 TOL in liner most likely below 20,145' 4/28/2023 0.000 FISH 1 Cavin slip die. 3.5" wide x 6.75" long x .5" thick with radius to fit 4.5" pipe. Dropped during upper completion run at 9,556'. Decision made to continue run upper completion. Would most likey stay in the 13-5/8" x 4-1/2" section. 5/3/2023 0.000 Mandrel Inserts : excludes pulled inserts Top (ftKB) Top (TVD) (ftKB) Top Incl (°) St ati on No /S Serv Valve Type Latch Type OD (in) TRO Run (psi) Run Date Com Make Model Port Size (in) 4,138.4 3,681.6 56.06 1 GAS LIFT DMY BK 1 5/15/2023 KBG4-5 HORIZONTAL, CD2-361, 5/23/2023 2:26:22 PM Vertical schematic (actual) Liner; 20,145.0-34,350.0 Liner; 18,103.4-20,445.0 Liner; 20,034.8-20,169.6 Liner Cement; 18,790.0 ftKB Liner; 12,423.3-18,468.0 Nipple - DB; 18,135.4 Packer; 18,059.5 Sleeve - Sliding; 17,993.4 Mandrel – GAS LIFT; 17,920.8 Nipple - DB; 17,914.9 Intermediate String 3 Cement; 17,260.0 ftKB Intermediate; 52.8-12,599.0 Intermediate String 2 Cement; 11,406.0 ftKB Liner; 2,319.3-6,404.0 Mandrel – GAS LIFT; 6,056.6 Mandrel – GAS LIFT; 5,365.8 Nipple - X; 5,360.4 Intermediate String 1 Cement; 2,319.3 ftKB Mandrel – GAS LIFT; 4,138.4 Surface; 56.1-2,478.5 Nipple - DB; 2,188.9 20" Casing Cement; 56.1 ftKB Conductor; 56.7-136.7 Hanger; 48.9 WNS PROD KB-Grd (ft) 54.53 RR Date Other Elev… CD2-361 ... TD Act Btm (ftKB) 34,487.0 Well Attributes Field Name FIORD WEST KUPARUK Wellbore API/UWI 501032083600 Wellbore Status PROD Max Angle & MD Incl (°) 93.03 MD (ftKB) 34,398.45 WELLNAME WELLBORECD2-361 Annotation End DateH2S (ppm) DateComment Mandrel Inserts : excludes pulled inserts Top (ftKB) Top (TVD) (ftKB) Top Incl (°) St ati on No /S Serv Valve Type Latch Type OD (in) TRO Run (psi) Run Date Com Make Model Port Size (in) 5,365.8 4,192.5 76.54 2 GAS LIFT GAUG E 5/5/2023 Silverwe ll Dial 6,056.6 4,337.0 77.64 3 GAS LIFT DMY BK 1 5/5/2023 KBG4-5 17,920.8 6,782.1 77.92 4 GAS LIFT GAUG E 5/5/2023 Silverwe ll Dial Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 6,271.3 4,380.8 78.60 Landing Collar 17.300 Weatherford Dual Valve Non- Rotating landing collar Weatherf ord DVL 14.750 18,333.4 6,867.5 77.98 Collar - Landing 9.875 Baker HP LFC Type 1 landing Collar w/Ball Catcher Baker 8.530 18,103.4 6,820.1 78.13 Packer 7.625 TIW Expander w/4' Tie Back Extension (TOL = 18,103') DrilQuip CX 7.750 20,172.6 7,121.2 86.02 Collar - Landing 7.625 7-5/8" 29.7# L-80 IC Drill-Quip Landing Collar Hydril 523 DrilQuip PDC-II 6.860 HORIZONTAL, CD2-361, 5/23/2023 2:26:23 PM Vertical schematic (actual) Liner; 20,145.0-34,350.0 Liner; 18,103.4-20,445.0 Liner; 20,034.8-20,169.6 Liner Cement; 18,790.0 ftKB Liner; 12,423.3-18,468.0 Nipple - DB; 18,135.4 Packer; 18,059.5 Sleeve - Sliding; 17,993.4 Mandrel – GAS LIFT; 17,920.8 Nipple - DB; 17,914.9 Intermediate String 3 Cement; 17,260.0 ftKB Intermediate; 52.8-12,599.0 Intermediate String 2 Cement; 11,406.0 ftKB Liner; 2,319.3-6,404.0 Mandrel – GAS LIFT; 6,056.6 Mandrel – GAS LIFT; 5,365.8 Nipple - X; 5,360.4 Intermediate String 1 Cement; 2,319.3 ftKB Mandrel – GAS LIFT; 4,138.4 Surface; 56.1-2,478.5 Nipple - DB; 2,188.9 20" Casing Cement; 56.1 ftKB Conductor; 56.7-136.7 Hanger; 48.9 WNS PROD CD2-361 ... WELLNAME WELLBORECD2-361 Page 1/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/3/2022 00:00 5/3/2022 06:00 6.00 MIRU, MOVE PULD P L/D 5-7/8" drillpipe from derrick, clean rinse and dope box and pin ends for transport to Deadhorse. 0.0 0.0 5/3/2022 06:00 5/3/2022 12:00 6.00 MIRU, MOVE PULD P L/D 5-7/8" drillpipe from derrick, clean rinse and dope box and pin ends for transport to Deadhorse. 0.0 0.0 5/3/2022 12:00 5/3/2022 18:00 6.00 MIRU, MOVE MOB P Clean all sumps and ship out remaining fluid in pits to vac trucks. Separate electrical/hydrualic interconnects between modules. R/D Magtech and tank farm piping to the rig. R/D Magtech vac units and secure for move. Pad elevation surveyed 15.50 BPMSL 0.0 0.0 5/3/2022 18:00 5/4/2022 00:00 6.00 MIRU, MOVE MOB P Continue breaking interconnects to modules, prepare location for move. 0.0 0.0 5/4/2022 00:00 5/4/2022 06:00 6.00 MIRU, MOVE MOB P Continue breaking interconnects to modules, prepare location for move. Begin separating modules. Move Gen module to southeast corner of pad. Begin pulling drill module away from BOP module. 0.0 0.0 5/4/2022 06:00 5/4/2022 12:00 6.00 MIRU, MOVE MOB P Separate and move pump module, pit module and CPU to southeast corner of pad. Separate pipeshed and pull forward. Prepare drilling module for move. 0.0 0.0 5/4/2022 12:00 5/4/2022 18:00 6.00 MIRU, MOVE MOB P Prepare drilling module for move troubleshoot electrical drives. Skid rig floor to drill module, un pin BOP module. 0.0 0.0 5/4/2022 18:00 5/5/2022 00:00 6.00 MIRU, MOVE MOB P Continue unpin BOP module run stompers on BOP and Drill module. Replace contacts on drill module drive motors. Unpin Drill module and BOP module, Lift drill module and prepare to pull away from BOP module. Pull away from BOP module and turn south. 0.0 0.0 5/5/2022 00:00 5/5/2022 06:00 6.00 MIRU, MOVE MOB P Lift drill module and pull away from BOP module. Continue to troubleshoot drill module electrical problems with drive system. Stage drill Mod in front of pipeshed. 0.0 0.0 5/5/2022 06:00 5/5/2022 12:00 6.00 MIRU, MOVE MOB P Jack BOP MOD pin NES to BOP MPD CoMan and pad operator witness. Pull BOP MOD off of well. Break down surface bag and high speed adapter. Cut conductor and cellar to correct height. 0.0 0.0 5/5/2022 12:00 5/5/2022 18:00 6.00 MIRU, MOVE MOB P Make up surface riser and high speed adapter on stump in BOP MOD. Spot BOP MOD over wll CD2-361. Unable to level BOP MOD. 0.0 0.0 5/5/2022 18:00 5/6/2022 00:00 6.00 MIRU, MOVE MOB P Jack BOP MOD back on tires, hook up NES and pull BOP MOD away from well. Remove rig matting and use roads and pads to level out the area around the conductor. Verify level, Replace herculite and matting and spot BOP Mod over CD2-361. Center over well and level. 0.0 0.0 5/6/2022 00:00 5/6/2022 06:00 6.00 MIRU, MOVE MOB P Continue set and level BOP Mod over well, drive drilling module and line up with BOP mod. Move Pipe shed to southeast side of location. Clean up old Herculite from CD2-310 and stuff into Mud boxes for disposal. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 2/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/6/2022 06:00 5/6/2022 12:00 6.00 MIRU, MOVE MOB P Spot drilling Mod behind BOP Mod and position and Pin to BOP Mod. 0.0 0.0 5/6/2022 12:00 5/6/2022 18:00 6.00 MIRU, MOVE MOB P Shim and level BOP Mod and drill Mod.Clear 3" of gravel with Jack hammers from pad for BOP module stompers. 0.0 0.0 5/6/2022 18:00 5/7/2022 00:00 6.00 MIRU, MOVE MOB P Spot pipeshed . Continue remove frozen gravel for BOP Mod stompers. Lay rig matting out for pipeshed and CPU. 0.0 0.0 5/7/2022 00:00 5/7/2022 06:00 6.00 MIRU, MOVE MOB P Continue chipping frozen rocks for stompers. Run stompers down secure BOP module. Level and shim BOP module. Install lower braces. Stomp pipeshed module into place. 0.0 0.0 5/7/2022 06:00 5/7/2022 12:00 6.00 MIRU, MOVE MOB P Continue walking pipeshed into place. Skid rig floor over BOP Mod, un level due to pad grade, skid floor back to transition position. Stomp pipe shed back away from drill module to allow room to shim drill module. Set up transition and shoot grade from BOP mod to drill mod, 5" grade drop noted from front of drill mod to back of BOP mod. Raise front of drill mod and shim as needed. 0.0 0.0 5/7/2022 12:00 5/7/2022 18:00 6.00 MIRU, MOVE MOB P Continue shim drill mod with rig mat and plywood monitoring level and check for compression risk. PJSM skid rig floor over BOP mod lower set back stompers and apply 500 psi hyd pressure. Back pit mod into place, lay out Herculite and rig mats, walk pit mode to final position. 0.0 0.0 5/7/2022 18:00 5/8/2022 00:00 6.00 MIRU, MOVE MOB P Back CPU as close as possible with Sow, then walk into place with stompers and shim with pipeshed module. Stomp pump room module into place. Begin hooking interconnects between Drill Sub and pits. 0.0 0.0 5/8/2022 00:00 5/8/2022 06:00 6.00 MIRU, MOVE MOB P Continue stomping pump room module into place. Continue hooking interconnects between Drill Sub and pits. Stomp Gen module in place. Continued work around location to clean up and get materials stacked and stored as needed. 0.0 0.0 5/8/2022 06:00 5/8/2022 12:00 6.00 MIRU, MOVE MOB P Continue with interconnects, electricians connecting plug boards and gas lines, install steam traps and inspect all lines. Test gas alarms. Grind conductor housing level. 0.0 0.0 5/8/2022 12:00 5/8/2022 18:00 6.00 MIRU, MOVE RURD P Rig accepted at 12:00. Continue with rig up , turn on steam, air, water, swap rig power to high line. at 14:00 hrs. Install 30" sliplock connector on riser and torque up. 0.0 0.0 5/8/2022 18:00 5/9/2022 00:00 6.00 MIRU, MOVE RURD P Clean and clear rig floor. Commission PS21 slips. Install Cameron riser adapter and set 12' riser joint test seal on adapter to 500 PSI for 15 minutes. Clean under rig floor in drip pan area. Pressure wash wind walls. 0.0 0.0 5/9/2022 00:00 5/9/2022 06:00 6.00 MIRU, MOVE OTHR P Continue to pressure wash windwalls and clean rig floor. Continue cleaning rig floor and BOP deck. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 3/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/9/2022 06:00 5/9/2022 12:00 6.00 MIRU, MOVE OTHR P Continue washing wind walls, rig floor and rotary table, CPU, PITS, BOP deck. reassemble mud pumps for flushing with soap. Fuel gas online. 0.0 0.0 5/9/2022 12:00 5/9/2022 18:00 6.00 MIRU, MOVE OTHR P Continue washing wind walls, rig floor and rotary table, CPU, PITS, BOP deck. reassemble mud pumps for flushing with soap. 0.0 0.0 5/9/2022 18:00 5/10/2022 00:00 6.00 MIRU, MOVE OTHR P Continue washing wind walls, rig floor and rotary table, CPU, PITS, BOP deck. reassemble mud pumps for flushing with soap. Flush low pressure lines in pits with Deep Clean. 0.0 0.0 5/10/2022 00:00 5/10/2022 06:00 6.00 MIRU, MOVE OTHR P Continue washing wind walls, Flush low pressure lines in pits with Deep Clean. Clean pipeshed and boiler room. Pick up HDPE pipe from CD2-310 area. 0.0 0.0 5/10/2022 06:00 5/10/2022 12:00 6.00 MIRU, MOVE OTHR P Continue washing wind walls and derrick legs clean top drive. 0.0 0.0 5/10/2022 12:00 5/10/2022 18:00 6.00 MIRU, MOVE OTHR P Continue cleaning rig floor, pump room and mud pits. Wash sun deck and sub module. flush mud pumps with deep clean. Mud line bleeders and flowline. Blow down jet line mud pumps and mud line. 0.0 0.0 5/10/2022 18:00 5/11/2022 00:00 6.00 MIRU, MOVE OTHR P Continue cleaning rig floor, pump room and mud pits. Wash sun deck and sub module. Sub module roof. 0.0 0.0 5/11/2022 00:00 5/11/2022 06:00 6.00 MIRU, MOVE OTHR P Continue cleaning rig floor, pump room and mud pits. Clean top drive & blocks. 0.0 0.0 5/11/2022 06:00 5/11/2022 12:00 6.00 MIRU, MOVE OTHR P Continue cleaning the rig floor, pipe shed & BOP deck. Flush corrosion inhibitor through mud pumps & surfaces lines. 0.0 0.0 5/11/2022 12:00 5/11/2022 18:00 6.00 MIRU, MOVE OTHR P Clean pump room, pipe shed, BOP deck & cellar area. Flush corrosion inhibitor through mix, hole fill, & transfer pumps. Flush MSG & CPU with corrosion inhibitor. Blow down and drain all pumps. Off load all fluid. 0.0 0.0 5/11/2022 18:00 5/12/2022 00:00 6.00 MIRU, MOVE OTHR P Continue cleaning pump room, centrifical room, BOP deck & cellar area. Circulate & flush corrosion inhibitor through CPU. Continue off loading all fluids. 0.0 0.0 5/12/2022 00:00 5/12/2022 06:00 6.00 MIRU, MOVE OTHR P Continue cleaning pump room, centrifical room, BOP deck & cellar area. Remove shaker screens & clean shakers. Continue off loading all fluids. 0.0 0.0 5/12/2022 06:00 5/12/2022 12:00 6.00 MIRU, MOVE OTHR P Clean pump room, pit room / equipment, & pipe shed. Begin washing exterior or the rig. 0.0 0.0 5/12/2022 12:00 5/12/2022 18:00 6.00 MIRU, MOVE OTHR P Continue cleaning pit area & pipe shed. Wash the exterior of the rig. Build containment area in the court yard for washing subs & handling equipment. 0.0 0.0 5/12/2022 18:00 5/13/2022 00:00 6.00 MIRU, MOVE OTHR P Clean pipe shed & pump room. Remove floor covers in the pits and pressure wash below. 0.0 0.0 12/10/2022 12:00 12/10/2022 12:30 0.50 SURFAC, DRILL BHAH P M/U BHA AS PER SLB REP 120.0 120.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 4/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/10/2022 12:30 12/10/2022 13:00 0.50 SURFAC, DRILL DDRL P DRILL 24” SURFACE HOLE F/120' T/217‘ GPM= 600 F/O= 35%, WOB= 5K PSI ON= 950 RPM=30 120.0 217.0 12/10/2022 13:00 12/10/2022 13:15 0.25 SURFAC, DRILL TRIP P POOH F/217' T/124 217.0 124.0 12/10/2022 13:15 12/10/2022 13:45 0.50 SURFAC, DRILL BHAH P M/U BHA AS PER SLB REP 124.0 124.0 12/10/2022 13:45 12/10/2022 14:00 0.25 SURFAC, DRILL CIRC P WASH F/124' T/217' SHOOT SURVEY FOR GYRO @ 185' 124.0 217.0 12/10/2022 14:00 12/10/2022 18:00 4.00 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/217' T/420‘ RWT= 113K GPM= 790 F/O= 40%, WOB= 12K PSI ON=1300 PSI OFF=1100 TQ. ON= 11K TQ. OFF=4 K RPM=40 ECD=10.92 217.0 420.0 12/10/2022 18:00 12/10/2022 21:30 3.50 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/420' T/ 610‘ RWT= K GPM=808 F/O=41%, WOB= 10K PSI ON=1236 PSI OFF= 1107 TQ. ON= 8K TQ. OFF=3K RPM=40 ECD=10.62 420.0 610.0 12/10/2022 21:30 12/10/2022 22:30 1.00 SURFAC, DRILL BHAH P RACK BACK STD 5, P/U 8'' HYDRA- JAR AND SPLIT FLEX COLLAR AS PER SLB DD REP, M/U STD #5 610.0 610.0 12/10/2022 22:30 12/11/2022 00:00 1.50 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/610 ' T/657‘ RWT=130K, GPM=795, F/O= 40%, WOB=11K, PSI ON=1524, PSI OFF=1275, TQ. ON=6 K, TQ. OFF=3 K, RPM=40, ECD=10.40, ADT=5.36, TST=2.23, TRT=3.13, PUW=139K, SOW= 127K 610.0 657.0 12/11/2022 00:00 12/11/2022 06:00 6.00 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/657 TO 866 ‘ RWT=130K, GPM=795, F/O= 40%, WOB=11K, PSI ON=1524, PSI OFF=1275, TQ. ON=6 K, TQ. OFF=3 K, RPM=40, ECD=10.40, PUW=139K, SOW= 127K 657.0 866.0 12/11/2022 06:00 12/11/2022 11:30 5.50 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/866' T/1,438', TVD=1,369' PUW=164K SOW=167K RWT=160K GPM=1000 F/O= 42%, WOB= 10-30K PSI ON= 2175, PSI OFF= 1925, TQ. ON=8-15 K TQ. OFF= 2-4K RPM= 40 ECD= 10.65 MAX GAS OBSERVED= 0 UNITS TOUR BIT HR=2.68, TOTAL BIT HR=11.2, TOTAL JAR HR=11.2,TOUR SLIDE HR=1.22, TOTAL SLIDE HR=5.7 866.0 1,438.0 12/11/2022 11:30 12/11/2022 12:00 0.50 SURFAC, DRILL SVRG P 30 MIN RIG SERVICE 1,438.0 1,438.0 12/11/2022 12:00 12/11/2022 18:00 6.00 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/1,438' T/2,170', TVD=2,124', PUW=142K SOW=178K RWT=170K GPM=1100 F/O= 46%, WOB=30K PSI ON=2922 PSI OFF= 2400 TQ. ON=17K TQ. OFF=4K RPM=40 ECD=10.95 MAX GAS OBSERVED= 0 UNITS TOUR BIT HR=3.03, TOTAL BIT HR=15.4, TOTAL JAR HR=15.4,TOUR SLIDE HR=1.17, TOTAL SLIDE HR=6.87 1,438.0 2,170.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 5/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/11/2022 18:00 12/11/2022 22:30 4.50 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/2,170 ' T/2,373, PUW=180K SOW=192K RWT=187K GPM=1100 F/O=42% WOB=27K PSI ON=2616 PSI OFF=2331 TQ ON=15K TQ OFF=7K RPM=40 ECD=10.62 MAX GAS OBSERVED=0 UNITS 2,170.0 2,373.0 12/11/2022 22:30 12/11/2022 23:00 0.50 SURFAC, DRILL CIRC P INCREASE IN PUMP PRESSURE 300- 500PSI OVER, DECREASE PUMP RATE TO 950GPM, 2980PSI P/U OFF BOTTOM, HOLE UNLOADING, CIRC. RECIPROCATE 40RPM TILL PUMP PRESSURE STABILIZE AND SHAKERS CLEANED UP RECIP. PIPE AND ROTATING DURING THIS TIME 2,373.0 2,373.0 12/11/2022 23:00 12/12/2022 00:00 1.00 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/2,373 ' T/2,429 ‘ TVD=2,368 PUW=180K SOW=192K RWT=187K GPM=950 F/O=36%, WOB=30K PSI ON=2820 PSI OFF=2460 TQ. ON=11K TQ OFF=7K RPM=40 ECD=10.52 MAX GAS OBSERVED=0 UNITS TOUR BIT HR=3.97 TOTAL BIT HR=19.37 TOTAL JAR HR= 19.37 ADT=2.3 TST=1.67 TOTAL SLIDE=8.54 TOTAL DRILL TIME=10.83 2,373.0 2,429.0 12/12/2022 00:00 12/12/2022 02:00 2.00 SURFAC, DRILL DDRL P CONT DRILLING 24” SURFACE HOLE F/2,429'TO 2483' TVD=2,416' PUW=180K SOW=192K RWT=187K GPM=950 F/O=36%, WOB=30K PSI ON=2820 PSI OFF=2460 TQ. ON=11K TQ OFF=7K RPM=40 ECD=10.52 MAX GAS OBSERVED=0 UNITS TOUR BIT HR=3.97 TOTAL BIT HR=20.71 TOTAL JAR HR= 20.71 ADT=.1.34 TST=0 TOTAL SLIDE=8.54TOTAL DRILL TIME=20.71 2,429.0 2,483.0 12/12/2022 02:00 12/12/2022 02:30 0.50 SURFAC, TRIPCAS BKRM P BROOH F/ 2483 TO 2464' RPM 60 1.5 FPM 950 GPM 2910 PSI P/U 188 S/O 179 RWT 180 LAY DOWN SINGLE IN SHED 2,483.0 2,464.0 12/12/2022 02:30 12/12/2022 05:15 2.75 SURFAC, TRIPCAS BKRM P BROOH F/ 2464' TO 2250' RPM 60 1.5 FPM 950 GPM 2910 PSI P/U 188 S/O 179 RWT 180 AFTER FULL BOTTOMS UP RACK STAND BACK 2,464.0 2,250.0 12/12/2022 05:15 12/12/2022 05:30 0.25 SURFAC, TRIPCAS OWFF P 15 MIN FLOW CHECK AS PER CO MAN 2,250.0 2,250.0 12/12/2022 05:30 12/12/2022 09:00 3.50 SURFAC, TRIPCAS BKRM P BROOH F/2,250’ T/1,440’, ROT 154K, GPM= 1150, PSI= 2360, TQ= 2-5K, RPM= 50, F/O= 40% 2,250.0 1,440.0 12/12/2022 09:00 12/12/2022 09:30 0.50 SURFAC, TRIPCAS CIRC P CIRC/RECIP F/1,440' T/1,345', GPM=1150, PSI=2341, RPM=50, TQ= 2K, F/O= 40%, 6000 TOTAL STKS PUMPED 1,400.0 1,345.0 12/12/2022 09:30 12/12/2022 12:00 2.50 SURFAC, TRIPCAS PMPO P PUMP OUT OF HOLE @ 800 GPM, 1120 PSI, 42% F.O, F/1,345' T/662', PUW=141K, LAY DOWN ACCELERATOR AS PER DD 1,345.0 662.0 12/12/2022 12:00 12/12/2022 14:00 2.00 SURFAC, TRIPCAS PMPO P PUMP OUT OF HOLE @ 800 GPM, 970 PSI, 42% F.O, F/662' T/162', PUW=105K 662.0 162.0 12/12/2022 14:00 12/12/2022 18:00 4.00 SURFAC, TRIPCAS BHAH P LAY DOWN BHA AS PER DD, F/162' T/0 162.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 6/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/12/2022 18:00 12/12/2022 20:00 2.00 SURFAC, TRIPCAS BHAH P CLEAN AND CLEAR RIG FLOOR, PREP TO PULL WEAR RING 0.0 0.0 12/12/2022 20:00 12/12/2022 22:00 2.00 SURFAC, CASING WWWH P P/U 2 JTS 5'' DP AND WEAR RING PULLING TOOL, ATTEMPT TO PULL WEAR RING AS PER CAMERON REP, L/D 5'' DP AND PULLING TOOL 0.0 0.0 12/12/2022 22:00 12/12/2022 23:00 1.00 SURFAC, CASING WWWH T P/U STD OF 6-5/8 DP OUT OF DERRICK MAKE UP JOHNNY WAKER, JET THE WEAR RING PROFILE 480GPM, 5RPM, RECIPROCATING 3FPM BETWEEN 45 -60FT, RACK BACK STD IN DERRICK, B/D TOP DRIVE, SUCK OUT RISER, 0.0 0.0 12/12/2022 23:00 12/13/2022 00:00 1.00 SURFAC, CASING WWWH T P/U 2 JTS 5'' DP, P/U CAMERON WEAR RING RUNNING TOOL 0.0 0.0 12/13/2022 00:00 12/13/2022 01:30 1.50 SURFAC, CASING WWWH T CONT. P/U 2 JTS 5'' DP, P/U CAMERON WEAR RING RUNNING TOOL PULL WEAR RING AS PER COP AND CAMERON REP, L/D HANDLING TOOLS CLEAR RIG FLOOR 0.0 0.0 12/13/2022 01:30 12/13/2022 06:00 4.50 SURFAC, CASING RURD P PJSM PREP RIG FLOOR TO RUN 20" CASING, M/U VOLANT TOOLS AS PER DOYON CASING CREW, TORQUW THROUGH VOLANT TOOL VERIFY TORQUE IS GOOD. P/U 500 TON SPIDERS AND 6' PONY BAILES, 20" ELEVATORS AND BACK UP STRAP TONGS. 0.0 0.0 12/13/2022 06:00 12/13/2022 07:00 1.00 SURFAC, CASING RURD P CON'T PREPPING RIG FLOOR FOR CASING RUN, FILL RISER 0.0 0.0 12/13/2022 07:00 12/13/2022 09:15 2.25 SURFAC, CASING PUTB P RIH W/ 20" #133 L-80 T-ER CASING, TORQUE TO 31K, F/0', T/240' INSTALL CENTRALIZERS ON EVERY JT, BAKER LOK SHOE TRACK & FLOAT COLLAR ASSEMBLY, FILL EACH JT TOP OFF EVERY 5TH, SOW=112K 0.0 240.0 12/13/2022 09:15 12/13/2022 10:45 1.50 SURFAC, CASING RGRP T TROUBLE SHOOT PIPE SKATE REPLACE CONTROL AND CABLE ON MAIN BOX 240.0 240.0 12/13/2022 10:45 12/13/2022 12:00 1.25 SURFAC, CASING PUTB P RIH W/ 20" #133 L-80 T-ER CASING, TORQUE TO 31K, F/240', T/494' INSTALL CENTRALIZERS ON EVERY JT, BAKER LOK SHOE TRACK & FLOAT COLLAR ASSEMBLY, FILL EACH JT TOP OFF EVERY 5TH, SOW=133K, PUMP DOWN AS NEEDED @ 400 GPM, 124 PSI, 19% F/O 240.0 494.0 12/13/2022 12:00 12/13/2022 18:00 6.00 SURFAC, CASING PUTB P RIH W/ 20" #133 L-80 T-ER CASING, TORQUE TO 31K, F/494', T/1500' INSTALL CENTRALIZERS ON EVERY JT, BAKER LOK SHOE TRACK & FLOAT COLLAR ASSEMBLY, FILL EACH JT TOP OFF EVERY 5TH, SOW=215K, PUW= 230K PUMP DOWN AS NEEDED @ 400 GPM, 140 PSI, 19% F/O 494.0 1,500.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 7/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/13/2022 18:00 12/14/2022 00:00 6.00 SURFAC, CASING PUTB P RIH W/ 20" #133 L-80 T-ER CASING, TORQUE TO 31K, F/1500', T/'2416 INSTALL CENTRALIZERS ON EVERY JT, FILL EACH JT TOP OFF EVERY 5TH, SOW=286K, PUW=346K PUMP DOWN AS NEEDED @ 400 GPM, 120 PSI, 15% F/O 1,500.0 2,416.0 12/14/2022 00:00 12/14/2022 02:30 2.50 SURFAC, CASING PUTB P RIH W/ 20" #133 L-80 T-ER CASING, TORQUE TO 31K, F/2416', T/'2478 LAND OUT 20" CASING, INSTALL CENTRALIZERS ON EVERY JT, FILL EACH JT TOP OFF EVERY 5TH, SOW=286K, PUW=346K PUMP DOWN AS NEEDED @ 400 GPM, 120 PSI, 15% F/O 2,416.0 2,478.0 12/14/2022 02:30 12/14/2022 04:30 2.00 SURFAC, CEMENT CIRC P CIRCULATE 2X B/U GPM 420 PSI 141 F/O 17 % OWFF 15 MIN WELL STATIC 2,478.0 2,478.0 12/14/2022 04:30 12/14/2022 08:30 4.00 SURFAC, CEMENT PUTB P BACK OUT LANDING JOINT FROM HANGER, P/U LAY DOWN TOP LANDING JT, BREAK CONNECTION AND LAYDOWN VOLANT TOOL 2,478.0 2,478.0 12/14/2022 08:30 12/14/2022 09:30 1.00 SURFAC, CEMENT RURD P RIGGING DOWN DOYON 20" CASING TOOLS. CLEAN & CLEAR RIG FLOOR. PREP FOR RIH W/ CEMENT STING IN TOOL ON 6 5/8" HWDP & DP. 2,478.0 2,478.0 12/14/2022 09:30 12/14/2022 14:00 4.50 SURFAC, CEMENT TRIP P RIH W/ CEMENT STING IN TOOL F/ SURFACE TO 2356'. SOW=154K 2,478.0 2,478.0 12/14/2022 14:00 12/14/2022 14:45 0.75 SURFAC, CEMENT RURD P P/U & INSTALL CITADEL CEMENT HEAD WITH MANIFOLD FOR CHECKING FLOATS. 2,478.0 2,478.0 12/14/2022 14:45 12/14/2022 15:00 0.25 SURFAC, CEMENT TRIP P RIH R/ 2356' TO 2388'. SOW=164K, STING INTO STAB IN FLOAT COLLAR & SET DOWN 53K WT. 2,478.0 2,478.0 12/14/2022 15:00 12/14/2022 16:00 1.00 SURFAC, CEMENT RURD P M/U CEMENT MANIFOLD, LINE UP MANIFOLD PREPARING TO CIRCULATE. 2,478.0 2,478.0 12/14/2022 16:00 12/14/2022 18:00 2.00 SURFAC, CEMENT CIRC P BREAK CIRCULATION @ 2 BPM, VERIFY FLOW PATH AND ENSURE DEBRIS CUP IS IN PLACE. STAGE PUMPS UP TO 12 BPM, PSI=490, F/O=28%, CONTINUE CLEARING CASING EQUIPMENT FROM RIG FLOOR. RIG UP INJECTION LINE TO 4" VALVE IN CELLAR BOX FOR BLACK WATER FLUSH/CEMENT CLEAN UP. 2,478.0 2,478.0 12/14/2022 18:00 12/14/2022 22:00 4.00 SURFAC, CEMENT CIRC P PJSM FOR PUMPING CEMENT. SLB CEMENTER PUMP 5 BBL F/W. PRESSURE TEST CEMENT SYSTEM 3500 PSI. RIG PUMP 150 BBLS OF 10.0 PPG MUDPUSH II @ 10 BPM W/ RED DYE WITH 220 PSI. SLB CEMENTER PUMP 650 BBLS OF 11.0 PPG AT 11.0 BPM W/ 1250 PSI. PUMP 155 BBLS OF 15.8 PPG CLASS G TAIL CMT AT 4-8 BPM W/ 800 PSI. CHASE WITH 5 BBLS FW, DROP TOP LATCH DART, CHASE WITH 15 BBLS F/W. NO LOSSES DURING CEMENT JOB, FULL CEMENT RETURNS TO SURFACE. 2,478.0 2,478.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 8/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/14/2022 22:00 12/14/2022 23:00 1.00 SURFAC, CEMENT DISP P RIG PUMPS DISPLACE 68 BBLS OF 10.0 PPG DRIL PLEX MUD AT 420 GPM W/ 560 PSI. LATCH DART AND PRESSURE UP TO 1420 PSI, BLEED OFF, & CHECK FLOATS. FLOATS HOLDING. 2,478.0 2,478.0 12/14/2022 23:00 12/15/2022 00:00 1.00 SURFAC, CEMENT CIRC P PICK UP AND STING OUT OF STAB IN FC AT 2388' W/ 195K P/U WT. POOH TO 2355' PUW=180K. EST CIRCULATION, RELEASE 1ST FOAM BALL, CHASE WITH 30 BBLS F/W. CIRCULATE ONE DP VOLUME. RELEASE 2ND FOAM BALL & CIRCULATE SURFACE TO SURFACE AT 494 GPM W/ 350 PSI. 2,478.0 2,478.0 12/15/2022 00:00 12/15/2022 01:30 1.50 SURFAC, CEMENT CIRC P CONT. RELEASE 2ND FOAM BALL & CIRCULATE SURFACE TO SURFACE AT 494 GPM W/ 350 PSI. 2,478.0 2,478.0 12/15/2022 01:30 12/15/2022 02:00 0.50 SURFAC, CEMENT OWFF P FLOW CHECK WELL 30 MIN WELL STATIC 2,478.0 2,478.0 12/15/2022 02:00 12/15/2022 05:00 3.00 SURFAC, CEMENT RURD P L/D DOWN CEMENT HEAD AS PER CITADEL REP FLUSH CLEAN CEMENT LINES AND VAC TRUCKS AND MAGTEC EQUIP. SPOTTED 30 BBLS OF BLACK WATER AT WELLHEAD/CASING HANGER AREA. 2,478.0 2,478.0 12/15/2022 05:00 12/15/2022 07:30 2.50 SURFAC, CEMENT TRIP P POOH F/ 2343' TO 765', RACKING BACK IN DERRICK. PUW = 155K, HOLE FILL VIA PIT #5. 2,343.0 765.0 12/15/2022 07:30 12/15/2022 13:00 5.50 SURFAC, CEMENT CLEN T STOPPED POOH DUE TO ROTARY DRIP PAN, FLOWLINE BEING PACKED OFF. CLEANING ROTARY DRIP PAN, FLOWLINE & BOP DECK. CIRCULATE AT MAX RATE TO CLEAR RISER AND FLOWLINE. BLOW DOWN TOPDRIVE. PREPARE RIG FLOOR TO CONTINUE POOH. 765.0 765.0 12/15/2022 13:00 12/15/2022 14:00 1.00 SURFAC, CEMENT TRIP P POOH F/ 765' TO SURFACE, RACKING BACK IN DERRICK. L/D LAST 9 JTS OF HWDP, MONITORING HOLE FILL VIA PIT #5. SIMOPS: CONTINUE CLEANING MUD PITS. 765.0 0.0 12/15/2022 14:00 12/15/2022 18:00 4.00 SURFAC, CEMENT CLEN T CLEANING CONTAMINATED MUD FROM ROTARY DRIP PAN, FLOWLINES, FLOW BOX IN PITS, SHAKERS. OFFLOADING MUD FROM PITS #1, #2, & #3. CLEANING PLUGGED LINES IN CPU, JETTING RISER WITH BLACK WATER AT MAX RATE WITH ALL 4 MUD PUMPS. FLUS THROUGH RACE TRACK AND ALL SHAKER VALVES. FLUSH DUMP LINES TO CPU. JET FLOWLINE, BLOW DOWN JET AND HOLE FILL LINE. 0.0 0.0 12/15/2022 18:00 12/15/2022 21:00 3.00 SURFAC, CEMENT CLEN P DRAIN RISER, SEND BLACK WATER TO CPU. CIRCULATE BLACK WATER IN CPU WITH BOTH PUMPS. PREPARE TO PULL SURFACE RISER. CONTINUE CLEANING & OFFLOADING MUD PITS. PULL UPPER SECTION OF RISER. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 9/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/15/2022 21:00 12/16/2022 00:00 3.00 SURFAC, CEMENT NUND P NIPPLE DOWN SURFACE RISERS FROM WELLHEAD. MOBILIZE RISERS OUT OF THE BOP MOD. SIMOPS: CONTINUE TO CLEAN MUD PITS & CPU TANKS FROM CONTAMINATED MUD. (NO CEMENT FOUND IN ANY PITS OR TANKS). CLEAN & INSPECT ALL 4 SURGE TANKS ON MUD PUMPS. 0.0 0.0 12/16/2022 00:00 12/16/2022 02:00 2.00 SURFAC, CEMENT NUND P NIPPLE DOWN SURFACE RISERS FROM WELLHEAD. MOBILIZE RISERS OUT OF THE BOP MOD. SIMOPS: CONTINUE TO CLEAN MUD PITS & CPU TANKS FROM CONTAMINATED MUD. (NO CEMENT FOUND IN ANY PITS OR TANKS). CLEAN & INSPECT ALL 4 SURGE TANKS ON MUD PUMPS. 0.0 0.0 12/16/2022 02:00 12/16/2022 04:00 2.00 SURFAC, CEMENT NUND P N/D & REMOVE THE LOW PRESSURE ADAPTER SPOOL ASSY F/ WELLHEAD. 0.0 0.0 12/16/2022 04:00 12/16/2022 07:30 3.50 SURFAC, CEMENT WWWH P WASH DEBRIS AND CLEAN GRAVEL FROM CASING HANGER PROFILE IN WELLHEAD. CAMERON TECH INSPECT SAME & PREPARE TO INSTALL & TEST PRIMARY PACKOFF SUPPORT BUSHING. 0.0 0.0 12/16/2022 07:30 12/16/2022 12:00 4.50 SURFAC, WHDBOP WWSP P ATTEMPTING TO INSTALL CAMERON PACKOFF BUSHING IN WELLHEAD. UNABLE TO INSTALL DUE TO ALIGNMENT/CLEARANCE ISSUES. SIMOPS: WORKING TO CLEAR PLUG F/ CPU/MAGTEC LINE, CLEANING EQUIP IN PITS, REPAIRING ST-120 HYD LEAK. 0.0 0.0 12/16/2022 12:00 12/16/2022 15:00 3.00 SURFAC, WHDBOP WWSP T UNABLE TO INSTALL CAMERON PACKOFF BUSHING. CONSULTING WITH ENGINEERING TEAM TO RESOLVE ISSUES AND DEVELOP PLAN FORWARD. CONTINUE WITH RIG MAINTENANCE & SIMOPS CLEARING CPU/MAGTEC LINE. 0.0 0.0 12/16/2022 15:00 12/16/2022 19:30 4.50 SURFAC, WHDBOP WWSP T CONTINUE TO TROUBLESHOOT AND INSTALL CAMERON PACKOFF BUSHING IN WELLHEAD HOUSING. LOOSEN CONDUCTOR HOUSING STUDS & ATTEMPT TO CENTER WITH A HYD JACK. ATTEMPT TO ADJUST CLEARANCES IN WH, REMOVE O-RING SEALS ON BUSHING AND ATTEMPT TO INSTALL SAME. NO GOOD. 0.0 0.0 12/16/2022 19:30 12/17/2022 00:00 4.50 SURFAC, WHDBOP WWSP T DISCONTINUE CAMERON PACKOFF BUSHING INSTALLATION ATTEMPTS. ALLOW CAMERON REP TO REST DUE TO HOURS. ENGINEERING TEAM DEVELOPING A PLAN FORWARD. SIMOPS: RIG MAINTENANCE: INSULATING CPU/MAGTEC LINES, CLEANING PITS/RIG FLOOR, FUNCTION TEST BOP TEST PUMP, INSTALL BALL VALVE ON ANNULAR CONTROL LINE, PREPARING CROSSOVERS FOR BOP TESTING, LOAD BOP TEST MANDREL INTO PIPE SHED. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 10/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/17/2022 00:00 12/17/2022 06:00 6.00 SURFAC, WHDBOP WWSP T DISCONTINUE CAMERON PACKOFF BUSHING INSTALLATION ATTEMPTS. ALLOW CAMERON REP TO REST DUE TO HOURS. ENGINEERING TEAM DEVELOPING A PLAN FORWARD. SIMOPS: RIG MAINTENANCE: INSULATING CPU/MAGTEC LINES, CLEANING PITS/RIG FLOOR, FUNCTION TEST BOP TEST PUMP, INSTALL BALL VALVE ON ANNULAR CONTROL LINE, PREPARING CROSSOVERS FOR BOP TESTING, LOAD BOP TEST MANDREL INTO PIPE SHED. 0.0 0.0 12/17/2022 06:00 12/17/2022 12:00 6.00 SURFAC, WHDBOP WWSP T UNABLE TO INSTALL CAMERON PACKOFF BUSHING IN WH. ENGINEERING TEAM WORKING WITH CAMERON TO DEVELOP OPERATING PROCEDURE FOR PLAN FORWARD. HELD OPERATIONAL MEETING WITH OFFICE TEAM. SIMOPS: PERFORM WEEKLY DRK INSPECTION. CIRC PITS #1 & #2 OVER SHAKERS. TRANSFER PIT #1 TO PIT #3. TOP RINSE #1 PIT TO SUPER SUCKER, OPEN, CLEAN & INSPECT HAMMER MILL IN CPU. REWIRE HEAT TRACE ON #2 LINE FROM CPU TO MAGTEC. 0.0 0.0 12/17/2022 12:00 12/17/2022 14:00 2.00 SURFAC, WHDBOP WWSP T CONTINUE WAITING ON PLAN FORWARD FROM CAMERON ON OPERATING PROCEDURES FOR WH. SIMOPS: CONTINUE WORKING ON DERRICK INSPECTION. CHANGING OUT HAMMER MILL WEAR PLATES. RECIEVED MOC AND REVISED PROCEDURES FROM CAMERON AT 13:08 HRS. 0.0 0.0 12/17/2022 14:00 12/17/2022 17:00 3.00 SURFAC, WHDBOP PRTS P HOLD PJSM. TIGHTEN CONDUCTOR HOUSING SLIP STUDS. INSTALL HIGH PRESSURE ADAPTER ON CONDUCTOR HOUSING. SET DOWN BOP & SECURE ON TEST STAND. PRESSURE TEST T-SEALS TO 2800 PSI & LOWER SEALS TO 1300 PSI, WITNESSED BY CPAI REP. RIG UP TO PULL TEST ADAPTER FLANGE TO 10K OVERPULL. CAMERON REP CONSULTING WITH OFFICE ENGINEERING TEAM TO CONFIRM TEST PRESSURES & PROCEDURES. 0.0 0.0 12/17/2022 17:00 12/17/2022 19:30 2.50 SURFAC, WHDBOP PRTS P PULL TEST ADAPTER FLANGE TO 10K OVERPULL AS PER CAMERON SOP. PRESSURE TEST T-SEALS TO 3000 PSI & LOWER SEALS TO 1300 PSI, WITNESSED BY CPAI REP. 0.0 0.0 12/17/2022 19:30 12/18/2022 00:00 4.50 SURFAC, WHDBOP NUND P HOLD PJSM & N/U 18 3/4" 5M BOPE & RISER TO CAMERON HP ADAPTER. INSPECT FLANGE GAP. TORQUE LOCK DOWNS AS PER SOP TO 650 FT/LBS. CENTER & SECURE BOP STACK. INSTALL TRIP NIPPLE, CHECK AIR BOOTS. LOAD 45 JTS OF 17" 88.1# HYDRIL CASING INTO PIPE SHED. CLEAN & INSPECT CENTRIFUGE #2. C/O ALLEN HEAD BOLTS ON HAMMER MILL WEAR PLATES. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 11/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/18/2022 00:00 12/18/2022 06:00 6.00 SURFAC, WHDBOP NUND P HOLD PJSM, N/U MPD ORBIT VALVE, 6" HOSE TO MPD SKID, 2" HIGH PRESSURE HOSES AND HARD IRON. CONT INSTALLING ANNULUS VALVE, 1502 FITTINGS FOR DIGITAL READINGS AND 150 PSI PRV ON WELLHEAD. LOCKDOWNS ON HIGH PRESSURE RISER AS PER CAMERON. SIMOPS: FINISH CLEANING CENTRIFUGE DUMP LINE, CONT REPLACING BOLTS ON HAMMER MILL, AND BLOW OUT ALL GRAVEL FROM GUN LINE MANIFOLD AND JETS IN MUD PITS. RECORD RKB MEASUREMENTS ON BOP COMPONENTS, BUILD 4.5" TEST JT FOR SETTING TEST PLUG. RKB-ANNULAR--19.53' RKB-TOP VBR RAMS-23.90' RKB-BLIND/SHEAR RAMS-25.15' RKB-MUD CROSS-27.58' RKB-BOTTOM VBR RAMS-30.35' RKB-LDS-------------------48.55' RKB-GL---------------------54.35' 0.0 0.0 12/18/2022 06:00 12/18/2022 09:00 3.00 SURFAC, WHDBOP OTHR P RIG UP ANNULUS TO CELLAR BOX. REPOSITION BOP CENTERING LINES. SIMOPS: PUMPING MUD OVER SHAKERS, THAW TRIP TANK SUCTION LINES, FUNCTION TESTING ALARMS: CELLAR ALARM, GAS ALARM & PVT ALARMS. RIG UP CELLAR PUMP. 0.0 0.0 12/18/2022 09:00 12/18/2022 12:00 3.00 SURFAC, WHDBOP RURD P MAKE UP CROSSOVERS ON TEST PLUG & RIH W/ 2 STDS OF 6 5/8" HWDP BENEATH TEST PLUG. INSTALL TEST TORPEDO ON TOP DRIVE. M/U 4.5" TEST MANDREL TO TEST PLUG & RIH TO LAND OUT IN WH. 0.0 0.0 12/18/2022 12:00 12/18/2022 14:00 2.00 SURFAC, WHDBOP RURD P WHILE SETTING TEST PLUG, OBSERVED RETURNS FROM ANNULUS STOPPED. OBSERVED ANNULUS VALVE PLUGGED WITH MUD/GRAVEL. SET TEST PLUG AND STARTED FILLING BOPS, OBSERVED TEST PLUG SEALS LEAKING. PULL TEST PLUG BACK TO FLOOR & CLEANED GRAVEL FROM TEST PLUG SEAL PROFILE. C/O SEAL. TOP RINSED GRAVEL/DEBRIS OUT OF THE HIGH PSI ADAPTER PROFILE. 0.0 0.0 12/18/2022 14:00 12/18/2022 16:45 2.75 SURFAC, WHDBOP BOPE P RIH W/ TEST PLUG ON 4.5" MANDREL & SET. CONFIRMED GOOD SEAL ON TEST PLUG, NO LEAKAGE TO ANNULUS VALVE. CLOSE ANNULAR PREVENTER TO CENTER MANDREL, PERFORM BREAK IN FUNCTION ON THE NEW UPPER & LOWER VBRs ON THE 4.5" TEST MANDREL AS PER NOV PROCEDURE. L/D 4.5" TEST MANDREL. SIMOPS: EMPTY MUD PITS TO VAC TRUCK AND CLEAN PITS #1,3, & 4. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 12/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/18/2022 16:45 12/18/2022 20:00 3.25 SURFAC, WHDBOP BOPE P P/U 7 5/8" TEST MANDREL & PUP JTS. RIH & M/U TO TEST PLUG. CLOSE ANNULAR PREVENTER TO CENTER IN WELL & PROCEED WITH UPPER 4.5" X 7 5/8" & LOWER 3.5" X 6 5/8" VBRs BREAK IN PROCEDURE. SIMOPS: EMPTY MUD PITS INTO VAC TRUCK AND CONTINUE CLEANING PITS #1,3, & 4. 0.0 0.0 12/18/2022 20:00 12/18/2022 21:30 1.50 SURFAC, WHDBOP BOPE P HOLD PJSM, P/U & M/U 6 5/8" TEST JT, SPACE OUT PUP JTS. R/U HIGH PSI TEST EQUIPMENT & CONDUCT SHELL TEST. 0.0 0.0 12/18/2022 21:30 12/19/2022 00:00 2.50 SURFAC, WHDBOP BOPE P TEST 18 3/4" 5M BOPE'S W/ 6 5/8" TEST JT. ALL TESTS TO 250/5000 PSI 5/10 MIN, TEST ANNULAR PREVENTER TO 250/3500 PSI 5/10 MIN. TEST CM VALVES 1-16, HCR CHOKE/KILL, MANUAL VALVES CHOKE/KILL #3,, UPPER 4.5" x 7 5/8" VBRS (W/ 3000 PSI MANIFOLD PSI) & LOWER 3.5" x 6 5/8" VBRS. AOGCC REP - BOB NOBLE ON LOCATION TO WITNESS TESTING & THE FUNCTION TESTING OF PVT, G/L, FLOWSHOW ALARMS, TEST LEL & H2S ALARMS. 0.0 0.0 12/19/2022 00:00 12/19/2022 06:30 6.50 SURFAC, WHDBOP BOPE P Test 18.75" 5M BOPE at 250/5000 psi for 5/10 min. Test annular preventer at 250/3500 psi for 5/10 min. W/ 6 5/8" test mandrel. Test choke manifold valves 1-16 at 250/5000 for 5/10 min. Test manual operated & superchoke, choke/kill manual valves & HCR valves, dart valve, FOSV, Topdrive upper/lower IBOP, upper & lower VBR's, blind/shear rams. Perform accumulator system drawdown test: Acc psi-2950, Manifold psi-1650, Accumulator psi after all functions on bottles-1750 psi. Time lapse to build 200 psi with 1 electric pump-25 seconds. 117 seconds to build full system pressure with 2 electric pumps & 6 air pumps. Closing times for Annular-22 sec, UPR-17 sec, LPR-16 sec, Choke/Kill HCR-2 sec each. Average of 4000 psi x 10 Nitrogen bottles. Conducted a retest on the upper VBRs with 1500 psi manifold pressure to 250/5000 psi due to the first test we had to apply 3000 psi on the accumulator manifold pressure (opened bypass valve) to achieve the test. Function & test mud pit PVT, gain/loss sensor, & flowline sensor alarms, test LEL & H2S alarms. All tests witnessed by AOGCC Rep--Bob Noble on 12-19- 2022. 0.0 0.0 12/19/2022 06:30 12/19/2022 08:45 2.25 SURFAC, WHDBOP BOPE P Reposition fall arrestors above the BOP stack. Tighten flange between MPD head and riser. Simops: Pull 6 5/8" test joint, remove lower pup jt f/ test assy & install crossover w/ MPD test plug on test joint. 0.0 0.0 12/19/2022 08:45 12/19/2022 10:30 1.75 SURFAC, WHDBOP BOPE P Install MPD test plug into MPD head & test at 250/1250 psi for 5/5 min. L/d MPD test plug & xo sub. M/u pup jt & acme xo to test joint. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 13/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/19/2022 10:30 12/19/2022 12:45 2.25 SURFAC, WHDBOP BOPE P Rih with test joint. Make up to test plug, Pull test plug to the rig floor. L/d test plug & remove xo subs f/ the test joint. 0.0 0.0 12/19/2022 12:45 12/19/2022 13:30 0.75 SURFAC, WHDBOP RURD P Blow down top drive. R/u for 20" casing test. 0.0 0.0 12/19/2022 13:30 12/19/2022 15:30 2.00 SURFAC, WHDBOP PRTS P Hold PJSM. Pump through kill line w/ #2 mud pump & take returns to Triptank #2. Close Blind/shear rams. Test & chart 20" 133# L-80 T-ER casing to 3000 psi. Pump @ .48 bpm for a total of 10.4 bbls. Close kill line HCR & monitor casing pressure for 30 min. Bled off 10.4 bbls to trip tank. Good test. 0.0 0.0 12/19/2022 15:30 12/19/2022 18:00 2.50 SURFAC, WHDBOP BOPE P Drain BOPs, blow down mud pump #2, choke & kill line. Trouble shoot cellar pump, recalibrate drawworks, secure block hangoff line. Simops: Test MPD system @ 250/1250 psi. 0.0 0.0 12/19/2022 18:00 12/19/2022 20:15 2.25 SURFAC, DRILLOUT BHAH P Hold PJSM, and stage SLB bha #2 components to the rig floor via the beaver slide. Simops: Function test cellar alarm. R/u Totco monitor on OA. Calibrate crown saver & floor saver sensors on TDS. 0.0 0.0 12/19/2022 20:15 12/19/2022 23:45 3.50 SURFAC, DRILLOUT BHAH P Hold PJSM, and p/u 18 1/8" Intermediate 1 cleanout bha #2 as per SLB DD/MWD reps to 433'. P/U Wt = 107k, S/O Wt = 116k, monitoring displacement via the triptank. Sensor offset from bit: MVC-26.41' D+I-29.7' APWD-49.89' ARC res-52.22' ARC gr-52.39' 0.0 433.0 12/19/2022 23:45 12/20/2022 00:00 0.25 SURFAC, DRILLOUT SFTY P Hold PJSM on picking up singles of 6 5/8" DP from pipe shed. 433.0 433.0 12/20/2022 00:00 12/20/2022 01:15 1.25 SURFAC, DRILLOUT CIRC P Tih w/ 18 1/8" cleanout bha, picking up singles w/ 6 5/8" DP f/ 433' to 519', drifting each jt with 5.125" drift. M/u TDS and break circulation, staging mud pump up to 607 gpm w/ 535 psi. Had significant solids in returns over shakers, initially. MWD tools came on line at 600 gpm with an ECD of 14.0 ppg. Circulated 1400 stks (1200 stks b/u) and ECD reduced to 10.01 ppg as the annulus cleaned up. Blow down top drive. P/u wt=107k, S/o wt-116k. 433.0 519.0 12/20/2022 01:15 12/20/2022 02:45 1.50 SURFAC, DRILLOUT PULD P Tih w/ 18 1/8" cleanout bha, picking up singles of 6 5/8" DP f/ 519' to 1016', drifting each jt with a 5.125" drift. M/u TDS & break circulation, staging mud pumps up to 635 gpm w/ 570 psi. Returns over shakers were clean and ECD of 9.8 ppg was recorded. Circulated 900 stks total. P/U wt- 120k, S/O wt- 124k. Blow down topdrive. 519.0 1,016.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 14/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/20/2022 02:45 12/20/2022 04:00 1.25 SURFAC, DRILLOUT PULD P Tih w/ 18 1/8" cleanout bha, picking up singles of 6 5/8" DP f/ 1016' to 1513', drifting each jt with a 5.125" drift. M/u TDS & break circulation, staging mud pumps up to 638 gpm w/ 600 psi. Returns over shakers were clean and ECD of 9.8 ppg was recorded. Circulated 925 stks total. Mud wt coming out of hole-9.8 ppg. P/U wt=130k, S/O wt-134k, Monitoring displacement to Triptank. Blow down topdrive. 1,016.0 1,513.0 12/20/2022 04:00 12/20/2022 05:15 1.25 SURFAC, DRILLOUT PULD P Tih w/ 18 1/8" cleanout bha, picking up singles of 6 5/8" DP f/ 1513' to 2203', drifting each jt with a 5.125" drift. M/u TDS & break circulation, staging pumps up to 635 gpm. 1,513.0 2,203.0 12/20/2022 05:15 12/20/2022 07:15 2.00 SURFAC, DRILLOUT COCF P M/u topdrive & wash down f/ 2203' to 2383' w/ 50 rpm, 3-10k TQ, 600 gpms, 550 psi, 168k RTW, 30% flow. Tagged the Innovex stab in FC at 2383' MD w/ 3k WOB. 2,203.0 2,383.0 12/20/2022 07:15 12/20/2022 08:30 1.25 SURFAC, DRILLOUT DRLG P Drill out stab-in FC f/ 2383' to 2386' MD w/ 50 rpms, 5-12k TQ, 67 spm, 450 gpm, 300 psi & 4-12k wob. 2,383.0 2,386.0 12/20/2022 08:30 12/20/2022 09:15 0.75 SURFAC, DRILLOUT COCF P Washing, rotating & reciprocating bit through stab-in FC at 2383' to 2386' MD 3 times @ 50 rpm, 3-7k TQ, 67 spm, 450 gpm, 300 psi. Reciprocated one time without rotation. No torque or drag noted while passing through. 2,386.0 2,386.0 12/20/2022 09:15 12/20/2022 09:30 0.25 SURFAC, DRILLOUT COCF P Washing down with topdrive, f/ 2386' to 2426 MD w/ 50 rpm, 2-10k TQ, 600 gpm, 88 spm, 540 psi, 30% flow. 169k- RTW. 2,386.0 2,426.0 12/20/2022 09:30 12/20/2022 10:15 0.75 SURFAC, DRILLOUT DRLG P Drill out DL FC f/ 2426' to 2428' MD @ 50 rpm, 5-12k TQ, 450 gpm, 67 spm, 285 psi, 7-9k WOB, 25% flow, w/ 169k RTW. (note: circulated up a small quantity of thick mud from below FC) 2,426.0 2,428.0 12/20/2022 10:15 12/20/2022 12:15 2.00 SURFAC, DRILLOUT DRLG P Drilling cement in 20" casing f/ 2428' to 2470' MD @ 50 rpm, 6-13k TQ, 600 gpm, 88 spm, 590 psi, 16-19k WOB, 41% flow. 2,428.0 2,470.0 12/20/2022 12:15 12/20/2022 15:15 3.00 SURFAC, DRILLOUT CIRC P Circulating & condition mud while rotating & reciiprocating at 2470' to 2448' in preparation for the FWP displacement at 600 gpm w/ 590 psi & 50 rpm. 2,470.0 2,470.0 12/20/2022 15:15 12/20/2022 15:30 0.25 SURFAC, DRILLOUT OWFF P L/d single of 6 5/8" DP to skate. Blow down topdrive. Install FOSV & monitor well. 2,470.0 2,470.0 12/20/2022 15:30 12/20/2022 18:00 2.50 SURFAC, DRILLOUT CLEN P Cleaning mud pits & prepare for displacement from 10.0 ppg Drilplex to 10.5 ppg FWP. Clean suction screens & surge tanks on mud pumps #1 & #2. Clean CPU tank. Simops: Monitor well on trip tank #1. 2,470.0 2,470.0 12/20/2022 18:00 12/20/2022 19:00 1.00 SURFAC, DRILLOUT CLEN P Monitor well on trip tank #1 while transferring 10.5 ppg FWP mut to pits #4,5 & 6. Preparing for mud displacement. 2,470.0 2,470.0 12/20/2022 19:00 12/20/2022 19:30 0.50 SURFAC, DRILLOUT SFTY P Hold PJSM with all personnel for displacing f/ 10.0 ppg Drilplex to 10.5 ppg FWP mud. Walk the lines f/ rig to tank farm and support trucks. 2,470.0 2,470.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 15/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/20/2022 19:30 12/20/2022 21:30 2.00 SURFAC, DRILLOUT CIRC P Displacing to 10.5 ppg FWP: pump 140 bbls of Hi-vis spacer f/ pit #7 at 400 gpm w/ 150 psi. Follow spacer w/ new 10.5 ppg FWP mud at 800 gpm w/ 915 psi w/ 20 rpm. Reciprocating 1'/min f/ 2444' to 2417', PUW-166k, SOW-158k, RTW- 166k, F/O-40%, ECD-10.72 ppg, 10.5 ppg FWP mud at shakers after pumping 6400 stks. 2,470.0 2,470.0 12/20/2022 21:30 12/20/2022 21:45 0.25 SURFAC, DRILLOUT WASH P Wash & ream f/ 2444' to 2470'. PUW- 165k, SOW-158k, rpm-50, TQ-3k, WOB- 2k, F/O-39%, GPM-608, PSI-590. 2,470.0 2,470.0 12/20/2022 21:45 12/20/2022 22:30 0.75 SURFAC, DRILLOUT DRLG P Drill cement in 20" casing f/ 2470' to 2472' w/ WOB-6k, rpm-50, ROP-4'/hr, gpm-608, PSI-590. ECD-10.7 ppg 2,470.0 2,472.0 12/20/2022 22:30 12/21/2022 00:00 1.50 SURFAC, DRILLOUT DRLG P Drill Citadel 20" casing shoe f/ 2472.5' to 2473.5' at 613 gpm, w/ 533 psi. PUW- 166k, SOW-158k, RTW-166k, WOB-5- 8k, RPM-50. ECD-10.7 ppg. OA=10 psi 2,472.5 2,473.5 12/21/2022 00:00 12/21/2022 02:00 2.00 SURFAC, DRILLOUT DRLG P Drilling Citadel 20" casing shoe f/ 2473' to 2474'. WOB-5-8k, RPM-50, TQ-5- 9k, GPM-613, SPM-90, PUW-166k, SOW-158k, RTW-166k, Noted composite/fiber shoe material & aluminum at shakers, good indication of drilling the shoe. 2,473.5 2,474.0 12/21/2022 02:00 12/21/2022 04:00 2.00 SURFAC, DRILLOUT DRLG P Drilling Citadel 20" casing shoe f/ 2474' to 2476'. Drilling torque decreased to 5k TQ at 2475'. Started changing drilling parameters to improve ROP. WOB-5-8k, RPM-50, TQ-5-9k, GPM- 613, SPM-90, PUW-166k, SOW-158k, RTW-166k, Increased WOB to 18k, GPM-700, Noted composite/fiber shoe material & aluminum at shakers. Worked drillstring up to 2465' w/ maximum gpm-1100 gpms. Worked pipe back to bottom and noted an improvement in TQ. 2,474.0 2,476.0 12/21/2022 04:00 12/21/2022 06:15 2.25 SURFAC, DRILLOUT DRLG P Drilling 24" rathole f/ 2476' to 2486'. WOB-5-8k, RPM-50, TQ-5-9k, GPM- 613, SPM-90, PUW-166k, SOW-158k, RTW-166k, Drift shoe while pumping @ GPM-606, PSI-505, 36% f/o. 3x w/ rotation @ 60 RPM, 1x w/o rotation. 2,476.0 2,486.0 12/21/2022 06:15 12/21/2022 07:00 0.75 SURFAC, DRILLOUT DDRL P Drill 20' of new formation f/ 2,486' MD to 2,503' MD w/ WOB-5-13k, RPM-60, TQ-5-6k, GPM-990, PSI-1,340, 46% f/o, PUW-166k, SOW-158k, RTW-166k, ART-.3, ADT-.3, total bit hrs - .3, jar hrs - 21.01 2,486.0 2,503.0 12/21/2022 07:00 12/21/2022 08:45 1.75 SURFAC, DRILLOUT CIRC P Rot and recip pipe f/ 2,503' MD to 2,454' MD conditioning mud @ GPM-990, PSI- 1,340, 45% f/o, RPM-60, TQ-5-6k,PUW- 166k, SOW-165k, RTW-166k, 2,503.0 2,503.0 12/21/2022 08:45 12/21/2022 09:30 0.75 SURFAC, DRILLOUT CIRC P Downlink mwd as per slmb. 2,503.0 2,503.0 12/21/2022 09:30 12/21/2022 10:00 0.50 SURFAC, DRILLOUT OWFF P OWFF - static - Simops - L/D single and B/D td 2,503.0 2,481.0 12/21/2022 10:00 12/21/2022 11:00 1.00 SURFAC, DRILLOUT RURD P R/U, flood lines, close upper pipe rams. 2,481.0 2,481.0 12/21/2022 11:00 12/21/2022 12:00 1.00 SURFAC, DRILLOUT FIT P Perform FIT w/ 3 spm and observe break over at 362 psi at 30 stks. 2,481.0 2,481.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 16/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/21/2022 12:00 12/21/2022 13:15 1.25 SURFAC, DRILLOUT FIT P Close annular and perform FIT w/ 3 spm. Observe break over at 338 psi at 30 stks. Repeat test w/ 3 spm, Observe break over at 339 psi at 30 stks. Bled back 1.9 bbls to the trip tank. 2,481.0 2,481.0 12/21/2022 13:15 12/21/2022 14:00 0.75 SURFAC, DRILLOUT OWFF P OWFF - static. Simops - B/D and R/D test equipment. 2,481.0 2,481.0 12/21/2022 14:00 12/21/2022 15:30 1.50 SURFAC, DRILLOUT SRVY P Circulate at 740 GPM, 907 PSI, 27% F/O. Total stks pumped - 4290. Reduce rate to 340 GPM, 185 psi, 16% F/O. - Total Stks pumped - 1607 (943 bbls). Obtain MWD data and consult with town. 2,481.0 2,481.0 12/21/2022 15:30 12/21/2022 16:00 0.50 SURFAC, DRILLOUT RURD P B/D top drive and R/U to FIT. 2,481.0 2,481.0 12/21/2022 16:00 12/21/2022 16:45 0.75 SURFAC, DRILLOUT RURD P Close annular and FIT w/ 6 spm. Observe break over at 485 psi at 21 stks pumped. (EMW - 14.4 ppg). Bleed back 1 bbl to trip tank. 2,481.0 2,481.0 12/21/2022 16:45 12/21/2022 17:30 0.75 SURFAC, DRILLOUT WAIT P Consult with town on FIT results. - Simops - Service rig equipment. 2,481.0 2,481.0 12/21/2022 17:30 12/21/2022 18:00 0.50 SURFAC, DRILLOUT RURD P B/D and R/D testing equipment. 2,481.0 2,481.0 12/21/2022 18:00 12/21/2022 19:00 1.00 SURFAC, DRILLOUT TRIP P P/U single and drift shoe f/ 2,481' MD to 2,490' MD. Observe no obstructions. up wt - 165k, s/o wt - 164k. L/D single. 2,481.0 2,465.0 12/21/2022 19:00 12/21/2022 20:00 1.00 SURFAC, DRILLOUT CIRC P Recip pipe f/ 2,465' MD t/ 2,425' MD and circ b/u w/ GPM-1000, PSI-1600, 45% F/O, ECD-10.73, Total stks pumped - 4600 (736 bbls). 2,465.0 2,465.0 12/21/2022 20:00 12/21/2022 20:15 0.25 SURFAC, DRILLOUT OWFF P OWFF - static. 2,465.0 2,465.0 12/21/2022 20:15 12/21/2022 22:45 2.50 SURFAC, DRILLOUT TRIP P POOH on elevators f/ 2,465' MD t/ 532' MD. Monitor disp via tt, up wt - 165k, s/o wt - 161k. 2,465.0 532.0 12/21/2022 22:45 12/21/2022 23:00 0.25 SURFAC, DRILLOUT OWFF P OWFF - Static. simops - PJSM, L/D BHA 532.0 532.0 12/21/2022 23:00 12/22/2022 00:00 1.00 SURFAC, DRILLOUT BHAH P Continue to pooh f/ 532' MD, l/d BHA #2 as per slmb DD. Racked back 3 stds hwdp t/ 77' MD. 532.0 77.0 12/22/2022 00:00 12/22/2022 01:00 1.00 SURFAC, DRILLOUT BHAH P Continue to L/D BHA #2 as per slmb dd/mwd f/ 77' MD. 77.0 0.0 12/22/2022 01:00 12/22/2022 02:30 1.50 SURFAC, DRILLOUT BHAH P Clean and clear rig floor. Simops - stage wear ring and wear ring running tool to the rig floor. 0.0 0.0 12/22/2022 02:30 12/22/2022 03:00 0.50 SURFAC, DRILLOUT WWWH P P/U 2 jts of 6 5/8" dp out of the shed and m/u stack washer as per cameron rep. Flush profile w/ GPM-835, PSI- 123, F/O - 26%. 0.0 0.0 12/22/2022 03:00 12/22/2022 03:15 0.25 SURFAC, DRILLOUT RURD P B/D TD. L/D stack flushing tool. 0.0 0.0 12/22/2022 03:15 12/22/2022 04:00 0.75 INTRM1, DRILL RURD P M/U cameron running tool for wear ring install. Install cameron HP Riser wear bushing w/ 18 3/16" id as per cameron rep. R/D cameron running tool. 0.0 0.0 12/22/2022 04:00 12/22/2022 04:30 0.50 INTRM1, DRILL SVRG P Service washpipe, Iron Roughneck, and drawworks. 0.0 0.0 12/22/2022 04:30 12/22/2022 11:00 6.50 INTRM1, DRILL BHAH P P/U BHA #3 as per slmb dd to 602' MD. 0.0 602.0 12/22/2022 11:00 12/22/2022 12:30 1.50 INTRM1, DRILL TRIP P RIH W/ BHA #3 w/ 6 5/8" dp out of the derrick f/ 602' MD to 1,521' MD. Monitor disp via tt. 602.0 1,521.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 17/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/22/2022 12:30 12/22/2022 13:15 0.75 INTRM1, DRILL DHEQ P Fill pipe (26 bbls) @ 200 gpm, Shallow hole test MWD w/ 140 spm, 945 gpm, 995 psi (good). 1,521.0 1,521.0 12/22/2022 13:15 12/22/2022 14:30 1.25 INTRM1, DRILL TRIP P Continue to rih w/ BHA #3 w/ 6 5/8" DP out of the derrick f/ 1,521' MD to 2,641' MD. Monitor disp via tt. 1,521.0 2,641.0 12/22/2022 14:30 12/22/2022 15:00 0.50 INTRM1, DRILL CIRC P Fill pipe and obtain spr's 2,641.0 2,641.0 12/22/2022 15:00 12/22/2022 15:30 0.50 INTRM1, DRILL WASH P Wash and ream f/ 2,641' MD to 2,503' MD w/ GPM-1100, PSI-1385, FO-55%, RPM-50, TQ-5-10K, up wt - 193k, s/o wt - 187k, rot wt - 188k 2,641.0 2,503.0 12/22/2022 15:30 12/22/2022 16:00 0.50 INTRM1, DRILL DDRL P Control drill f/ 2,503' MD to 2,530' MD @ 50 fph w/ GPM-1123, PSI-1420, FO- 55%, RPM-50, TQ-9-12K, WOB-6-8K up wt - 193k, s/o wt - 187k, rot wt - 188k 2,503.0 2,530.0 12/22/2022 16:00 12/22/2022 16:15 0.25 INTRM1, DRILL DHEQ P At 2,530' MD increase flow rate to 1500 gpm, PSI-2450, FO-56% and shear xm reamer. 2,530.0 2,530.0 12/22/2022 16:15 12/22/2022 21:00 4.75 INTRM1, DRILL DDRL P Control drill 17½ x 20" intermeditate 1 @ 50 fph f/ 2,530' MD t/ 2,702' MD w/ GPM-1500, PSI-2388, FO-55%, RPM- 60, TQ-8-12k, ECD-10.7, WOB-2-4k, up wt - 200k, s/o wt - 190k, rot wt - 188k. simops - build stands on the fly via xy crane. 2,530.0 2,702.0 12/22/2022 21:00 12/22/2022 21:45 0.75 INTRM1, DRILL BKRM P BROOH to index reamer f/ 2,702' md to 2,539' md (center of xm reamer - 2,498) w/ GPM-1220, PSI-1712, FO-52%, ROT -30, TQ-7k, ECD-10.7, up wt - 184k, s/o -202k, rot wt - 190k. 2,702.0 2,539.0 12/22/2022 21:45 12/22/2022 22:15 0.50 INTRM1, DRILL DHEQ P Obtain perameters @ 2,539' MD w/ GPM-1504, PSI-2496, FO-56%, turbine speed - 4700. Index reamer as per reamer rep. Observe lower PSI-2175 and turbine speed - 3930 confirming reamer open. Ream dn f/ 2,539' MD to 2,544' MD. Stop rotation and pick up to ledge. up wt - 194k. Observe 10k overpull to confirm ream had opened. Index reamer closed as per reamer rep. 2,539.0 2,544.0 12/22/2022 22:15 12/22/2022 22:30 0.25 INTRM1, DRILL TRIP P RIH on elevators f/ 2,544' md to 2,679' md (XS2 cutters at 2,503). s/o wt - 187k. 2,544.0 2,679.0 12/22/2022 22:30 12/22/2022 23:00 0.50 INTRM1, DRILL DHEQ P Drop 2" od activation ball. Pump ball dn at 50 gpm, 107 psi, 1% f/o. Increase rate to GPM-200, PSI-69, FO-13%. Observe ball on seat @ 125 stks 1126 psi. Index XM open. Increase rate to GPM-1526, PSI-1830, FO-57% to confirm XS2 & XM are open. Index XM closed. Increase rate to 1800 gpm, 2830 psi, 64% f/o. Confirm XM closed w/ turbine speed - 4910. 2,679.0 2,679.0 12/22/2022 23:00 12/22/2022 23:15 0.25 INTRM1, DRILL TRIP P P/U to 2,657' md (center of XS2 at 2,480). Ream dn 5' to 2,662' MD w/ GPM-1800, PSI-2809, FO-63%, RPM- 60, TQ-8k, s/o wt - 183k. Stop rot and p/u at rate. Observe 10k overpull at 2,651' MD. 2,679.0 2,657.0 12/22/2022 23:15 12/23/2022 00:00 0.75 INTRM1, DRILL UREM P Underream hole f/ 2,657' MD to 2,702' MD w/ GPM-1800, PSI-2823, %fo-64, RPM-80, TQ-9, WOB-3k, 2,657.0 2,702.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 18/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/23/2022 00:00 12/23/2022 06:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate 1 f/ 2,702' MD to 3,020' MD w/ GPM-1800, PSI- 2844, %fo-60, RPM-150, TQ-9, WOB- 8k, 2,702.0 3,020.0 12/23/2022 06:00 12/23/2022 11:30 5.50 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate 1 f/ 3,020' MD to 3.300' MD w/ GPM-1650, PSI- 2510, %fo-60, RPM-150, TQ-9-10k, WOB-7-10k, ECD 10.89 PUW 204K SOW 201K RTW 203K Bit hours 12.04 3,020.0 3,300.0 12/23/2022 11:30 12/23/2022 12:00 0.50 INTRM1, DRILL SVRG P Service pipeskate for building stand offline, simops - circ b/u @ 1650 gpm, 2610 psi, and pump 40 bbl 10 ppb njut plug sweep. 3,300.0 3,300.0 12/23/2022 12:00 12/23/2022 12:30 0.50 INTRM1, DRILL CIRC P Cont to circ 40 bbl 10 ppb nut plug sweep to surface. simops - service st- 120 & st-100, and rig tongs. 3,300.0 3,300.0 12/23/2022 12:30 12/23/2022 16:00 3.50 INTRM1, DRILL RGRP T Break off stand R/U TIW and head pin to hose and circulate the well while replacing the Top Drive encoder. 3,300.0 3,300.0 12/23/2022 16:00 12/23/2022 16:30 0.50 INTRM1, DRILL SEQP P Test NOVOS enable switch & top drive. (good). R/D head pin and high pressure hose. 3,300.0 3,300.0 12/23/2022 16:30 12/23/2022 18:00 1.50 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate 1 f/ 3,300' MD to 3.389' MD, 3,194 TVD w/ GPM- 1670, PSI-2600, %fo-60, RPM-150, TQ- 10-13k, WOB-9-11k, ECD 10.79 PUW 208K SOW 207K RTW 209K 3,300.0 3,389.0 12/23/2022 18:00 12/24/2022 00:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate 1 via NOVOS f/ 3,389' MD to 3.763' MD 3,458 TVD, w/ GPM-1645, PSI-2745, %fo-61, RPM-150, TQ-13-15k, WOB-12k, ECD 11.01, PUW 210K SOW 199K RTW 200K Bit hours - 17.63, Jar Hrs - 39.29 3,389.0 3,763.0 12/24/2022 00:00 12/24/2022 06:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/3,763' to 4,161' MD / 3,696' TVD, 1640 GPM, 2793 PSI, 10.86 ppg ECD,15k WOB, 140/150 RPM, 12/16k Trq, 208k P/U Wt, 199k SO Wt, 200k ROT wt. 3,763.0 4,161.0 12/24/2022 06:00 12/24/2022 10:30 4.50 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/4,161' to 4,342' MD / 3,790' TVD, 1640 GPM, 2840 PSI, 10.79 ppg ECD,15/20k WOB, 140/150 RPM, 12/16k Trq, 216k P/U Wt, 207k SO Wt, 209k ROT wt. 4,161.0 4,342.0 12/24/2022 10:30 12/24/2022 11:15 0.75 INTRM1, DRILL CIRC T Trouble shoot SLB Power Drive w/1740 GPM, 3250 PSI, 50 RPM, 5 K Trq. Though we were having trouble maintaining tool face. Ended up being under-reamer was in a ratty formation. 4,342.0 4,342.0 12/24/2022 11:15 12/24/2022 13:30 2.25 INTRM1, DRILL CIRC P Perform 1000 bbl whole mud dilution w/200 GPM, 130 PSI, 50 RPM, 5k Trq, Reciprocate full stand. 4,342.0 4,342.0 12/24/2022 13:30 12/24/2022 18:00 4.50 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/4,342' to 4,520' MD / 3,878' TVD, 1790 GPM, 3100 PSI, 10.83 ppg ECD,17k WOB, 140/150 RPM, 16/18k Trq, 207k P/U Wt, 201k SO Wt, 207k ROT wt. 4,342.0 4,520.0 12/24/2022 18:00 12/25/2022 00:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/4,520' to 4,860' MD / 4,034' TVD, 1770 GPM, 3223 PSI, 10.93 ppg ECD,17k WOB, 140/150 RPM, 16/18k Trq, 207k P/U Wt, 201k SO Wt, 207k ROT wt. Bit Hrs: 32.04 / Jar Hrs 53.7 4,520.0 4,860.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 19/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/25/2022 00:00 12/25/2022 01:00 1.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/4,860' to 4,935' MD / 4,061' TVD, 1778 GPM, 3246 PSI, 10.85 ppg ECD,17k WOB, 140/150 RPM, 16/18k Trq, 207k P/U Wt, 206k SO Wt, 203k ROT wt. 4,860.0 4,935.0 12/25/2022 01:00 12/25/2022 02:00 1.00 INTRM1, DRILL CIRC P Circ B/U w/1773 GPM, 3271 PSI, 100 RPM, 8/10 k Trq. 4,935.0 4,935.0 12/25/2022 02:00 12/25/2022 02:30 0.50 INTRM1, DRILL OWFF P OWFF (Static) SIMOPS - B/D top drive 4,935.0 4,935.0 12/25/2022 02:30 12/25/2022 04:15 1.75 INTRM1, DRILL MPDA P Install RCD bearing. Break in bearing and collect SPR's as per MPD advisor 4,935.0 4,935.0 12/25/2022 04:15 12/25/2022 06:00 1.75 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/4,935' to 4,990' MD / 4,076' TVD while maintain 11.0 ppg EMW with MPD, 1650 GPM, 3000 PSI, 11.19 ppg ECD, 17k WOB, 120 RPM, 12/20k Trq, 214k P/U Wt, 195k SO Wt, 207k ROT wt. 4,935.0 4,990.0 12/25/2022 06:00 12/25/2022 11:00 5.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/4,990' to 5,255' MD / 4,168' TVD while maintain 11.0 ppg EMW with MPD, 1650 GPM, 3000 PSI, 11.19 ppg ECD, 17k WOB, 120 RPM, 12/20k Trq, 209k P/U Wt, 195k SO Wt, 209k ROT wt. Bit Hrs 37.95 / Jar Hrs 59.61 4,990.0 5,255.0 12/25/2022 11:00 12/25/2022 11:30 0.50 INTRM1, DRILL MPDA P Perform draw down finger print test on Qannik formation. OWFF (static) 5,255.0 5,255.0 12/25/2022 11:30 12/25/2022 13:30 2.00 INTRM1, DRILL MPDA P PJSM on removing RCD bearing. Pull PS-21's and install master bushings. Remove RCD bearing. B/D MPD equipment. Re-install PS-21's 5,255.0 5,255.0 12/25/2022 13:30 12/25/2022 13:45 0.25 INTRM1, DRILL REAM P Wash and ream f/5,226' to 5,255' w/1650 PSI, 2500 PSI, 100 RPM, 10k Trq. 5,255.0 5,255.0 12/25/2022 13:45 12/25/2022 18:00 4.25 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/5,255' to 5,442' MD / 4,210' TVD, 1650 GPM, 3000 PSI, 11.19 ppg ECD, 17k WOB, 140 RPM, 17/19k Trq, 209k P/U Wt, 195k SO Wt, 209k ROT wt. 5,255.0 5,442.0 12/25/2022 18:00 12/26/2022 00:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/5,442' to 5,710' MD / 4,264' TVD, 1785 GPM, 3280 PSI, 10.8 ppg ECD, 16k WOB, 120 RPM, 16/19k Trq, 206k P/U Wt, 198k SO Wt, 201k ROT wt. Bit Hrs 43.88 / Jar Hrs 65.54 5,442.0 5,710.0 12/26/2022 00:00 12/26/2022 06:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/5,710' to 5,986' MD / 4,321' TVD, 1798 GPM, 3367 PSI, 10.81 ppg ECD, 24k WOB, 140 RPM, 21/24k Trq, 206k P/U Wt, 200k SO Wt, 204k ROT wt. 5,710.0 5,986.0 12/26/2022 06:00 12/26/2022 12:00 6.00 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/5,986' to 6,331' MD / 4,390' TVD, 1760 GPM, 3390 PSI, 11.28 ppg ECD, 24k WOB, 120 RPM, 22k Trq, 209k P/U Wt, 194k SO Wt, 205k ROT wt. Bit Hrs 52.49 / Jar Hrs 74.15 5,986.0 6,331.0 12/26/2022 12:00 12/26/2022 13:45 1.75 INTRM1, DRILL DDRL P Drill 17½" x 20" intermediate #1 f/6,331' to 6,445' MD / 4,415' TVD, 1740 GPM, 3360 PSI, 11.41 ppg ECD,17k WOB, 120 RPM, 20/24k Trq, 209k P/U Wt, 194k SO Wt, 205k ROT wt. Bit Hrs 53.79 / Jar Hrs 75.45 6,331.0 6,445.0 12/26/2022 13:45 12/26/2022 15:00 1.25 INTRM1, TRIPCAS CIRC P Obtain final survey. Circ B/U w/1725 GPM, 3380 PSI, 120 RPM, 14/17k Trq. Obtain SPR's and final T&D 6,445.0 6,445.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 20/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/26/2022 15:00 12/26/2022 15:15 0.25 INTRM1, TRIPCAS UREM P Obtain base line under reamer parameters. 1500 GPM, 2688 PSI, 4000 TRPM, 205k ROT wt @ 30 RPM 6,445.0 6,445.0 12/26/2022 15:15 12/26/2022 16:00 0.75 INTRM1, TRIPCAS OWFF P B/D top drive. Rotae 10 rpm & OWFF for 30 min (static) 6,445.0 6,445.0 12/26/2022 16:00 12/26/2022 17:00 1.00 INTRM1, TRIPCAS UREM P Break out single joint and drop 2.25" under reamer closing ball. Pump down at 97 GPM, ball on seat at 35 bbls/218 stks. Pressure up to 1664 psi and close under reamer. Reamer Open: 1500 GPM, 2688 PSI, 4000 TRPM, 205k ROT wt @ 30 RPM Reamer Closed: 1500 GPM, 3080 PSI, 4630 TRPM, 201k ROT wt @ 30 RPM 6,445.0 6,445.0 12/26/2022 17:00 12/26/2022 17:45 0.75 INTRM1, TRIPCAS BKRM P BROOH f/6,445' to 6,298' w/1500 GPM, 3030 PSI, 20 RPM, 9/16k Trq. 6,445.0 6,298.0 12/26/2022 17:45 12/26/2022 20:30 2.75 INTRM1, TRIPCAS UREM P Index lower rat hole eliminator reamer open as per SLB rep. Set 10k on 17- 1/2" ledge and confirm blades are functioning properly. Under ream rat hole f/6,298' to TD of 6,445' w/1600 GPM, 2775 PSI, 10k WOB, 120 RPM, 18/22k Trq. (Bottom of 17" hole = 6,404') 6,298.0 6,445.0 12/26/2022 20:30 12/26/2022 21:00 0.50 INTRM1, TRIPCAS UREM P Index rat hole eliminator reamer closed as per SLB rep and L/D 1 single joint DP f/6,445' to 6,431' 6,445.0 6,431.0 12/26/2022 21:00 12/27/2022 00:00 3.00 INTRM1, TRIPCAS CIRC P Perform 400 bbl dilution and circ and condition mud/open hole w/1500 GPM, 2890 PSI, 100 - 120 RPM, 12/14k Trq. 204k ROT Wt. Reciprocate full stand. 6,431.0 6,431.0 12/27/2022 00:00 12/27/2022 06:00 6.00 INTRM1, TRIPCAS BKRM P BROOH f/6/431' to 4,870' w/1500 GPM, 2830 PSI, 11.31 ppg ECD, 100 RPM, 14/19k Trq, 203k ROT Wt, 700 ft/hr max pulling speed. 6,431.0 4,870.0 12/27/2022 06:00 12/27/2022 12:00 6.00 INTRM1, TRIPCAS BKRM P BROOH f/4,870' to 3,200' w/1500 GPM, 2890 PSI, 11.74 ppg ECD, 150 RPM, 9/11k Trq, 196k ROT Wt, 700 ft/hr max pulling speed. 4,870.0 3,200.0 12/27/2022 12:00 12/27/2022 12:30 0.50 INTRM1, TRIPCAS BKRM P BROOH f/3,200' to 3,019' w/1500 GPM, 2890 PSI, 11.74 ppg ECD, 150 RPM, 9/11k Trq, 196k ROT Wt, 700 ft/hr max pulling speed. 3,200.0 3,019.0 12/27/2022 12:30 12/27/2022 14:30 2.00 INTRM1, TRIPCAS CIRC P Pump 70 bbl low vis sweep followed by 70 bbl high vis sweep and circ clean w/1500 GPM, 2800 PSI, 100 RPM, 8k Trq. Hole unloaded on B/U and packed off flow box and flow line. Reduce flow rate to 250 GPM while cleaning out flow box. 3,019.0 3,019.0 12/27/2022 14:30 12/27/2022 16:45 2.25 INTRM1, TRIPCAS BKRM P BROOH f/3,019' to 2,740' w/1500 GPM, 2800, 100 RPM, 8k Trq, 196k ROT Wt, 700 ft/hr max pulling speed. 3,019.0 2,740.0 12/27/2022 16:45 12/27/2022 22:45 6.00 INTRM1, TRIPCAS BKRM P BROOH at reduced pulling speed while working BHA into 20" casing f/2,740' to 2,272'. w/1500 GPM, 2800, 30 - 100 RPM, 8k Trq, Hole periodically unloaded significant amounts of clay and caving's. Caving's appeared to be coming from Seabee formation. Pumped sweeps to aid in hole cleaning and BHA balling. Performed 400 bbl dilution to get mud properties back in spec. (Did not rotate thru liner hanger packer set depth) 2,740.0 2,272.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 21/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/27/2022 22:45 12/28/2022 00:00 1.25 INTRM1, TRIPCAS RGRP T Air boot on flow line failed resulting in a 3.1 bbl spill. (2 bbls inside of rig, 1 bbl outside rig on exterior walls and mat boards, and 2 gallons on pad). ACS and security was notified. Cleaned up mud from spill and replaced air boot. Function tested new air boot (good) 2,272.0 2,272.0 12/28/2022 00:00 12/28/2022 06:00 6.00 INTRM1, TRIPCAS BKRM P BROOH f/2,272' to 695' w/1500 GPM, 2620, 100 RPM, 3k Trq, 196k ROT Wt, Pumped low vis nut plug sweeps to aid in hole cleaning and BHA balling at 2,090' and 695' 2,272.0 695.0 12/28/2022 06:00 12/28/2022 06:30 0.50 INTRM1, TRIPCAS OWFF P OWFF (Static) SIMOPS - B/D top drive. 695.0 695.0 12/28/2022 06:30 12/28/2022 07:00 0.50 INTRM1, TRIPCAS TRIP P PJSmM on L/D BHA. Rack back stand #1 f/695' to 602' 695.0 602.0 12/28/2022 07:00 12/28/2022 07:30 0.50 INTRM1, TRIPCAS BHAH P L/D BHA f/602' to 464'. Rack back HWDP & L/D drilling jars. 602.0 464.0 12/28/2022 07:30 12/28/2022 09:15 1.75 INTRM1, TRIPCAS BHAH T Un-able to break connection between flex collar and accelerators. C/O dies in ST-120 and still not able to break. Steam connection and attempt to break out again with ST-120 with no success. Attempt to break with rig tongs with no success. Decision made to L/D in one piece. 464.0 464.0 12/28/2022 09:15 12/28/2022 16:00 6.75 INTRM1, TRIPCAS BHAH P Cont. L/D BHA f/464'. Bit grade – 1-1-CT -G-X-I-NO-TD. Reamer grade -1-2-CT-G -X-I-ER-TD. Over all BHA looked good. 464.0 0.0 12/28/2022 16:00 12/28/2022 17:30 1.50 INTRM1, TRIPCAS BHAH P Clean and clear floor of BHA tools and equipment. 0.0 0.0 12/28/2022 17:30 12/28/2022 19:30 2.00 INTRM1, TRIPCAS WWWH P P/U stand of drill pipe and M/U stack washer. Function rams and annular and flush stack w/800 GPM. SIMOPS - Cont to clear rig floor of BHA tools, XO's and equipment. 0.0 0.0 12/28/2022 19:30 12/28/2022 21:00 1.50 INTRM1, TRIPCAS RURD P R/D stack washer and M/U wear ring puller. Drain BOPE's and pull wear ring as per Cameron rep. 0.0 0.0 12/28/2022 21:00 12/29/2022 00:00 3.00 INTRM1, TRIPCAS RURD P PJSM. C/O upper rams to 17" full body. SIMOPS - prep to test rams. M/U test plug and XO's t/17" test joint. C/O mud pump liners to 5-1/2" on MP#4. 0.0 0.0 12/29/2022 00:00 12/29/2022 01:30 1.50 INTRM1, TRIPCAS RURD P Cont. R/U to test upper rams and 6-5/8" TIW. Set test plug w/17" test joint as per Cameron rep. 0.0 0.0 12/29/2022 01:30 12/29/2022 02:00 0.50 INTRM1, TRIPCAS BOPE P Test upper rams and spare 6-5/8" TIW to 250 PSI for 5 min and 4000 PSI for 10 min. 0.0 0.0 12/29/2022 02:00 12/29/2022 03:30 1.50 INTRM1, TRIPCAS RURD P R/D testing equipment. Pull test plug and L/D 17" test joint. 0.0 0.0 12/29/2022 03:30 12/29/2022 09:30 6.00 INTRM1, TRIPCAS RURD P R/U Doyon Casing tools and equipment. Volant, bale extensions, 17" elevators, and 17" spiders and 20" power tongs. 0.0 0.0 12/29/2022 09:30 12/29/2022 09:45 0.25 INTRM1, TRIPCAS SFTY P PJSM on running liner. Monitor well for 5 min. 0.0 0.0 12/29/2022 09:45 12/29/2022 11:15 1.50 INTRM1, TRIPCAS PUTB P M/U 17" P110-IC 88.1# liner shoe track to 172' Shoe track baker-lok'd to the pin of jt#4 0.0 172.0 12/29/2022 11:15 12/29/2022 11:45 0.50 INTRM1, TRIPCAS CIRC P Break cirulation and fill pipe. Check floats (good) 172.0 172.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 22/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/29/2022 11:45 12/29/2022 16:00 4.25 INTRM1, CASING PUTB P RIH w/17" P110-IC 88.1# liner f/172' to 804'. M/U Trq 47k ft/lbs. Filling pipe on the fly and topping off every 10 jts. SO Wt 132k 172.0 804.0 12/29/2022 16:00 12/29/2022 16:30 0.50 INTRM1, CASING CIRC P Break cirulation on jt# 20. Stage flow rate up to 5 BPM / 93 PSI. PU Wt 138k / SO Wt 132k 804.0 804.0 12/29/2022 16:30 12/30/2022 00:00 7.50 INTRM1, CASING PUTB P RIH w/17" P110-IC 88.1# liner f/804' to 2,045'. M/U Trq 47k ft/lbs. Filling pipe on the fly and topping off every 10 jts. SO Wt 188k 804.0 2,045.0 12/30/2022 00:00 12/30/2022 02:15 2.25 INTRM1, CASING PUTB P RIH w/17" P110-IC 88.1# liner f/2,045' to 2,444'. M/U Trq 47k ft/lbs. Filling pipe on the fly and topping off every 10 jts. SO Wt 206k 2,045.0 2,444.0 12/30/2022 02:15 12/30/2022 04:00 1.75 INTRM1, CASING CIRC P Circ and condition mud. Stage flow rate up to 10 BPM / 280 PSI. Add 400 bbls new mud. 11.0 ppg In/Out Torque and drag at 2,444'. PU Wt 272k w/2 bpm, SO Wt 215k, ROT Wt 252k @ 20 RPM, 15k Trq / 24k Trq break over. 2,444.0 2,444.0 12/30/2022 04:00 12/30/2022 14:00 10.00 INTRM1, CASING PUTB P RIH w/17" P110-IC 88.1# liner f/2,444' to 4,066'. M/U Trq 47k ft/lbs. Filling pipe on the fly and topping off every 10 jts. SO Wt 271k 2,444.0 4,066.0 12/30/2022 14:00 12/30/2022 18:15 4.25 INTRM1, CASING CIRC P Circ and condition mud prior to picking up liner hanger. Stage flow rate up to 163 GPM, 190 PSI, PU Et 361k, SO Wt 300k, Even mud wt 11.0 p-pg In/Out. Max mud wt observed 11.3 ppg. 4,066.0 4,066.0 12/30/2022 18:15 12/30/2022 20:45 2.50 INTRM1, CASING RURD P R/U liner hanger shuttle. P/U liner hanger. M/U cement plugs to bottom of liner hanger. R/U power tongs. M/U liner hanger to liner. R/D doyon casing. 4,066.0 4,112.0 12/30/2022 20:45 12/30/2022 21:15 0.50 INTRM1, CASING CIRC P P/U single joint DP. Stage up pumps to 142 GPM, 178 PSI and confirm circulation thru liner hanger (good) 4,112.0 4,143.0 12/30/2022 21:15 12/31/2022 00:00 2.75 INTRM1, CASING RUNL P RIH 17" liner on 6-5/8" DP f/4,143' to 4,325'. Tight hole f/4,260' to 4,300'. Had to work pipe with pumps at 42 GPM / 200 PSI. Tight hole correlates to formation change. PU Wt 354K, SO Wt 301k 4,143.0 4,325.0 12/31/2022 00:00 12/31/2022 12:30 12.50 INTRM1, CASING RUNL P RIH 17" liner on 6-5/8" DP f/4,325' to 6,404'.Tight hole f/4,430' to 4,480' and through Qannik. PU Wt 370k w/3.5 bpm, SO Wt 260k. No formation losses to formation while running liner. 4,325.0 6,404.0 12/31/2022 12:30 12/31/2022 13:30 1.00 INTRM1, CEMENT RURD P R/U Citadel cement head. R/U cement hoses. 6,404.0 6,404.0 12/31/2022 13:30 12/31/2022 20:30 7.00 INTRM1, CEMENT CIRC P Circ and condition mud for cement job. Stage pumps up to 510 gpm, 564 psi. SIMOPS - R/U cementers and prep for cement job. PJSM on cementing at 21:30 Hrs 6,404.0 6,404.0 12/31/2022 20:30 12/31/2022 22:00 1.50 INTRM1, CEMENT CIRC T Had to swap out SLB cement pump unit. Circ and condition mud for cement job. Stage pumps up to 510 gpm, 564 psi. SIMOPS - R/U cementers and prep for cement job. PJSM on cementing at 21:30 Hrs 6,404.0 6,404.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 23/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 12/31/2022 22:00 1/1/2023 00:00 2.00 INTRM1, CEMENT CMNT P SLB flood lines w/5 bbls H2O and pressure test to 6500 psi (good). Rig pump 100 bbls 11.0 ppg Mud Push II at 5 bpm / 180 psi. Drop bottom dart. SLB pump 382 bbls 11.0 ppg DeepCRETE lead at 4.5 bpm / 200 psi, (Bottom dart latched at 80.2 bbls into lead and sheared at 1137 psi). 6,404.0 6,404.0 1/1/2023 00:00 1/1/2023 01:00 1.00 INTRM1, CEMENT CMNT P Shut down and wash up cement tubs from lead. SLB pump 98 bbls 15.8 ppg Liquid UniSLURRY tail at 4 bpm / 90 psi. SLB pump 5 bbls H2O at 5 bpm / 50 psi. Drop top dart. SLB pump 10 bbls H2O at 5 bpm / 50 psi. 6,404.0 6,404.0 1/1/2023 01:00 1/1/2023 02:30 1.50 INTRM1, CEMENT CMNT T Turn over to rig for displacement. Attempt to displace cement. Pump 55 bbls at 12 bpm / 100 psi. Slow down to 2 bpm for last 10 bbls and top dart should have landed out on top plug. Saw no indication of top dart landing out while pumping at 2 bpm / 60 psi. Pumped an additional 40 bbls and still no indication of top dart landing out. Shut down and trouble shoot mud pumps and circulating system. Concluded that while attempting to displace cement fluid was bypassing thru pump #4 bleeder. Shut in pump #4. Broke circulation and immediately had pump pressure and confirm top dart was on seat. Pressure up to 2000 psi and shear out launching top cement plug. Discuss plan forward options with town Drilling Superintendent. Decision made to continue to displace cement and utilizing calculated liner volume only. 6,404.0 6,404.0 1/1/2023 02:30 1/1/2023 04:30 2.00 INTRM1, CEMENT CMNT P Rig displace with 11.0 ppg FWP. Pump 900 bbls at 12 bpm / initial pump pressure 740 psi and final pump pressure 945 psi. Slow rate to 6 bpm / initial pump pressure 380 psi and final pump pressure 600 psi for 58 bbls Slow rate to 3 bpm for remainder of displacement / initial pump pressure 487 psi and final pump pressure 600 psi. Pump 978 bbls total. Bump plug and pressure up 500 psi over final circulating pressure to 1100 psi and hold for 5 min. Check floats. (good) CIP at 4:30 Hrs. Full returns / zero down hole losses during cementing and displacement. 6,404.0 6,404.0 1/1/2023 04:30 1/1/2023 06:00 1.50 INTRM1, CEMENT HOSO P Drop 3" hanger setting ball as per Dril- Quip / Citadel reps. Isolate on mud pump #4. Pressure up to 4,050 psi and set liner hanger. Pressure drop to 2000 psi. Chase pressure back up to 4100 psi and hold for 10 min. P/U to 425 k (75 k over final P/U wt) Confirm liner hanger is set. Slack off to drill string wt and release the setting tool. (Bottom of setting tool 2,235') Blow down top drive. 17" liner shoe 6,404' / 17" liner top 2,319' 6,404.0 2,235.0 1/1/2023 06:00 1/1/2023 07:00 1.00 INTRM1, CEMENT RURD P R/D cement hoses and L/D cement head. M/U shock sub to bottom of single jt DP. M/U top drive. 2,235.0 2,235.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 24/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/1/2023 07:00 1/1/2023 08:00 1.00 INTRM1, CEMENT CIRC P Pressure up to 5,285' and shear ball off seat. Circ and condition mud 1529 gpm / 720 psi. Observe mud push and 2 bbls cement at shakers on B/U. 2,235.0 2,235.0 1/1/2023 08:00 1/1/2023 08:30 0.50 INTRM1, CEMENT OWFF P OWFF (static) SIMOPS - L/D single joint and shock sub. 2,235.0 2,235.0 1/1/2023 08:30 1/1/2023 10:30 2.00 INTRM1, CEMENT TRIP P POOH f/2,235' to liner running tools. 2,235.0 0.0 1/1/2023 10:30 1/1/2023 12:00 1.50 INTRM1, CEMENT RURD P R/U liner hanger shuttle. L/D liner hanger assembly as per Dril-Quip rep. 0.0 0.0 1/1/2023 12:00 1/1/2023 15:30 3.50 INTRM1, CEMENT RURD P Clean rig and pits post cement job. Clean drip pan, flow box, and under shakers. Replace valves and seats in MP#3 0.0 0.0 1/1/2023 15:30 1/1/2023 16:30 1.00 INTRM1, WHDBOP WWWH P M/U stack washer and flush stack. Function rams and annular. SIMOPS - cont. with pump maintenance and cleaning pits. 0.0 0.0 1/1/2023 16:30 1/1/2023 19:15 2.75 INTRM1, WHDBOP RURD P Close blind rams and C/O upper pipe rams to 4-1/2" x 7-5/8" VBR's. SIMOPS - cont. with pump maintenance and cleaning pits. 0.0 0.0 1/1/2023 19:15 1/1/2023 20:00 0.75 INTRM1, WHDBOP RURD P R/U for casing test 0.0 0.0 1/1/2023 20:00 1/1/2023 21:15 1.25 INTRM1, WHDBOP PRTS P Test 17" liner to 3000 psi and chart for 30 min (good). Pump 19 bbls / Bleed back 16 bbls 0.0 0.0 1/1/2023 21:15 1/1/2023 22:00 0.75 INTRM1, WHDBOP RURD P R/D from casing test. Drain stack and B/D choke / kill lines. Prep for N/D BOPE. 0.0 0.0 1/1/2023 22:00 1/2/2023 00:00 2.00 INTRM1, WHDBOP NUND P PJSM on N/D. Remove MPD hoses. Pull riser. N/D BOPE stack and high pressure riser. 0.0 0.0 1/2/2023 00:00 1/2/2023 01:30 1.50 INTRM1, WHDBOP NUND P N/D BOPE stack and rack back on pedestal. N/D high pressure riser and drilling spool. 0.0 0.0 1/2/2023 01:30 1/2/2023 14:00 12.50 INTRM1, WHDBOP WWSP P PJSM. Remove annulus valves from well head adaptor. Remove adaptor and secure in BOPE deck. Clean and inspect sealing surfaces for pack off and locking rings seals. Observe grooving on sealing face. Polish up grooves. Set pack off and locking ring and test to 1300 psi for 15 min (good). N/U well head and pad operator witness orientation. Test hanger neck seal 3000 psi for 15 min (good). Test void 1600 psi for 15 min (good). Test DCB connection 1300 psi for 15 min (good). Pull test well head to 10k (good). SIMOPS - Clean pits and take on new mud. C/O MP#4 liners back to 7", rebuild Strip-O-Matic, housekeeping and P/M's. 0.0 0.0 1/2/2023 14:00 1/2/2023 21:00 7.00 INTRM1, WHDBOP NUND P N/U high pressure riser and drilling adaptor. N/U BOPE's and MPD hoses and 1502 hard lines. N/U flow liner riser 0.0 0.0 1/2/2023 21:00 1/2/2023 23:45 2.75 INTRM1, WHDBOP RURD P M/U 1 stand of DP below test plug. Set test plug w/6-5/8" test joint as per Cameron rep. R/U to test BOPE's. Fill stack with H2O and purge air from system. 0.0 0.0 1/2/2023 23:45 1/3/2023 00:00 0.25 INTRM1, WHDBOP BOPE P Start testing BOPE's. Test annular 250 psi low for 5 min / 2500 psi high for 10 min with 6-5/8" test joint. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 25/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/3/2023 00:00 1/3/2023 08:00 8.00 INTRM1, WHDBOP BOPE P Test BOPE's to 250 psi for 5 min / 4000 psi for 10 min. Upper VBR's 4-1/2" X 7- 5/8", lower VBR's 3-1/2" X 6-5/8", choke valves #1 - #16, choke/kill manuals & HCR's, upper/lower IBOP, #1 and #2 FOSV, dart valve, and blind/shear rams. Perform draw down on manual and super choke. Test gas alarms and PVT alarms. Perform Koomey draw down. 17 sec/200 psi, 78 sec/full pressure. 10 bottles 4025 psi average. AOGCC - Adam Earl waive witness of test. 0.0 0.0 1/3/2023 08:00 1/3/2023 10:00 2.00 INTRM1, WHDBOP RURD P R/D testing equipment. L/D test joint, test plug and rack back stand of DP that was under test plug. Drain H2O from stack. SIMOPS - prime all 4 mud pumps w/FWP. Set seats on MP#3 0.0 0.0 1/3/2023 10:00 1/3/2023 12:00 2.00 INTRM1, WHDBOP RURD P P/U 2 joints of 5" DP and M/U wear ring running tool. Set wear ring 11.595" ID wear ring as per Cameron rep. L/D 5" DP and running tool. Clean and clear floor. 0.0 0.0 1/3/2023 12:00 1/3/2023 14:45 2.75 INTRM1, DRILLOUT RURD P Mobilize BHA tools and equipment to rig floor. Replace air boots for upper riser section. Install new rams in Strip-O- Matic. Hang cement hose. 0.0 0.0 1/3/2023 14:45 1/3/2023 16:45 2.00 INTRM1, DRILLOUT BHAH T Wait on BHA direction from town. Finalize hydraulics with CPA, SLB, and Weatherford. SIMOPS - Test MPD equipment to 2501200 psi for 5 min, MP2's, house keeping. 0.0 0.0 1/3/2023 16:45 1/3/2023 23:15 6.50 INTRM1, DRILLOUT BHAH P M/U 15-3/4" X 17-1/2" Intermediate #2 BHA to 536' 0.0 536.0 1/3/2023 23:15 1/4/2023 00:00 0.75 INTRM1, DRILLOUT TRIP P RIH with drill pipe out of derrick f/536' to 1,375'. SO Wt 142k. 536.0 1,375.0 1/4/2023 00:00 1/4/2023 01:00 1.00 INTRM1, DRILLOUT TRIP P RIH with drill pipe out of derrick f/1,375' to 2,213'. SO Wt 147k. 1,375.0 2,213.0 1/4/2023 01:00 1/4/2023 06:00 5.00 INTRM1, DRILLOUT RGRP T Break circulation and attempt to shallow hole test directional tools. Not able to build pressure and establish circulation. Trouble shoot mud pumps. Mud pumps #1 and #2 the pop offs wont stay reset and actuators need to be replaced. Pump #3 the charge pump is leaking and needs to be changed out. Pump #4 by itself will not generate a high enough flow rate to turn directional tools on. Mechanic came out at 03:30 Hrs to assist with the trouble shooting and repairs. 2,213.0 2,213.0 1/4/2023 06:00 1/4/2023 07:45 1.75 INTRM1, DRILLOUT DHEQ P Shallow hole test directional and MWD/LWD tools w/800 gpm/770 psi, 900 gpm/950 psi, 1000 gpm/1145 psi, 1100 gpm/1361 psi. All indications tools are functioning properly. 2,213.0 2,213.0 1/4/2023 07:45 1/4/2023 08:30 0.75 INTRM1, DRILLOUT WASH P Wash down f/2,213' to 2,339' w/1000 gpm, 1118 psi, PU Wt 178k, SO Wt 176k, tag liner drillable pack off bushing (DPOB) w/10 k 2,213.0 2,339.0 1/4/2023 08:30 1/4/2023 09:15 0.75 INTRM1, DRILLOUT DRLG P Drill out DPOB f/2,339' to 2,344' w/1000 gpm, 1120 psi, 50 rpm, 6 k trq, 3-6 k wob, ROT Wt 182k, ream through 3X's to confirm clear. 2,339.0 2,344.0 1/4/2023 09:15 1/4/2023 10:15 1.00 INTRM1, DRILLOUT CIRC P Circ B/U w/1150 gpm, 1440 psi and no rotation. Reciprocate pipe f/2,344' to top of liner at 2,319'. 2,344.0 2,344.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 26/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/4/2023 10:15 1/4/2023 13:15 3.00 INTRM1, DRILLOUT TRIP P RIH with stands out of derrick f/2,344' to 6,026'. SO Wt 184k 2,344.0 6,026.0 1/4/2023 13:15 1/4/2023 15:15 2.00 INTRM1, DRILLOUT SLPC P PJSM. Slip and cut drill line. Cut 54' of drilling line. SIMOPS - Circ and condition mud w/400 gpm, 250 psi. 6,026.0 6,026.0 1/4/2023 15:15 1/4/2023 16:30 1.25 INTRM1, DRILLOUT REAM P W&R f/6,026' to 6,268' w/800 gpm, 900 psi, 50 rpm, 15 k trq, ROT Wt 205 k. TOC/cement plugs at 6,268' w/10 k wob. 6,026.0 6,268.0 1/4/2023 16:30 1/5/2023 00:00 7.50 INTRM1, DRILLOUT DRLG P Drill cement plugs and shoe track f/6,268' to 6,404' w/800 - 1300 gpm, 900 - 2200 psi, 11.1 ppg ECD, 50 - 100 rpm, 12 - 24 k trq, ROT Wt 206k, (Landing collar 6,271' - 6,274', Float collar 6,316' - 6,318', and Float shoe 6,399' - 6,404') 6,268.0 6,404.0 1/5/2023 00:00 1/5/2023 01:30 1.50 INTRM1, DRILLOUT DRLG P Drill rat hole f/6,404' to 6,445' w/1250 gpm, 2000 psi, 11.1 ppg ECD, 8-10 k wob, 60-80 rpm, 24/28 k trq, ROT Wt 206k, 6,404.0 6,445.0 1/5/2023 01:30 1/5/2023 02:00 0.50 INTRM1, DRILLOUT DDRL P Drill 20' new formation f/6,445' to 6,465' MD / 4,419' TVD, w/1250 gpm, 2000 psi, 11.1 ppg ECD, 8-10 k wob, 120 rpm, 24/28 k trq, PU wt 255k, SO Wt 148k, ROT Wt 202k, ADT .38 hrs / Jar hrs 75.83. PJSM on displacing to new mud. 6,445.0 6,465.0 1/5/2023 02:00 1/5/2023 04:30 2.50 INTRM1, DRILLOUT DISP P Pump 60 bbls high vis spacer and displace to new 11.0 ppg FWP w/700 gpm, 650 psi, 30 rpm, 16-18 k trq. 1740 bbls surface to surface volume. (Tried various flow rates and 700 gpm was the sweet spot for receiving new fluid to the tank farm) Once displacement was finished pump out of open hole w/650 gpm / 600 psi f/6,465' to 6,400' 6,465.0 6,400.0 1/5/2023 04:30 1/5/2023 05:00 0.50 INTRM1, DRILLOUT OWFF P OWFF (static). SIMOPS - B/D top drive 6,400.0 6,400.0 1/5/2023 05:00 1/5/2023 05:30 0.50 INTRM1, DRILLOUT SVRG P Service rig, top drive, and draw works. SIMOPS - C/O dies in top drive and clean flow line and under shakers from displacement. 6,400.0 6,400.0 1/5/2023 05:30 1/5/2023 07:00 1.50 INTRM1, DRILLOUT MPDA P PJSM. Break out double. Drain same and drain riser. Install MPD bearing and break in bearing as per MPD advisor. 6,400.0 6,400.0 1/5/2023 07:00 1/5/2023 07:30 0.50 INTRM1, DRILLOUT DHEQ P Downlink and cycle MWD/LWD tools to clear the buffer. 6,400.0 6,400.0 1/5/2023 07:30 1/5/2023 08:30 1.00 INTRM1, DRILLOUT RURD P R/U for FIT. Break circ and flood lines with 11.0 FWP 6,400.0 6,400.0 1/5/2023 08:30 1/5/2023 09:30 1.00 INTRM1, DRILLOUT FIT P Attempt to FIT to 15.0 ppg. Pump 8.5 bbls at .5 bpm. Pressure leak off at 667 psi for a 13.9 ppg EMW LOT. Hold pressure for 10 min and bleed off pressure. Bleed back 4.3 bbls. 6,400.0 6,400.0 1/5/2023 09:30 1/5/2023 09:45 0.25 INTRM1, DRILLOUT RURD P R/D testing equipment and B/D lines 6,400.0 6,400.0 1/5/2023 09:45 1/5/2023 10:30 0.75 INTRM2, DRILL MPDA P Circ at 900 gpm / 1016 psi and simulate MPD connections with rig crew. 6,400.0 6,400.0 1/5/2023 10:30 1/5/2023 10:45 0.25 INTRM2, DRILL REAM P W&R f/6,400' to 6,465' w/1350 gpm, 2030 psi, 60 rpm, 15 k trq, ROT Wt 199 k. 6,400.0 6,465.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 27/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/5/2023 10:45 1/5/2023 12:30 1.75 INTRM2, DRILL DDRL P Drill ahead 15-3/4" hole f/6,465' to 6,543' MD / 4,435' TVD, 1330 gpm, 2040 psi, 11.90 ppg ECD, 25 k wob, 100 rpm, 24 k trq, PU Wt 231 k, SO Wt 157 k, ROT Wt 199 k, ADT 2.02 Hrs / Jar Hrs 77.47 6,465.0 6,543.0 1/5/2023 12:30 1/5/2023 13:15 0.75 INTRM2, DRILL UREM P Drop RFID tags and index Weatherford Rip Tide reamer open. Pull test w/10 k over pull against 17" shoe (good) Reamer Closed = 1350gpm, 2080psi, 3580 TRPM power drive, 3985 TRPM MWD Reamer Open = 1350gpm, 1575psi, 2600 TRPM power drive, 2800 TRPM MWD 6,543.0 6,543.0 1/5/2023 13:15 1/5/2023 18:00 4.75 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/6,543' to 6,690' MD / 4,462' TVD, 1750 gpm, 2407 psi, 12.01 ppg ECD, 27 k wob, 140 rpm, 24 k trq, PU Wt 226 k, SO Wt 162 k, ROT Wt 196 k, ADT 2.49 Hrs / Jar Hrs 79.53. MPD connection back pressure = 250 psi / 12.0 ppg EMW 6,543.0 6,690.0 1/5/2023 18:00 1/6/2023 00:00 6.00 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/6,690' to 7,090' MD / 4,542' TVD, 1794 gpm, 2572 psi, 12.16 ppg ECD, 27 k wob, 140 rpm, 25 k trq, PU Wt 225 k, SO Wt 170 k, ROT Wt 203 k, ADT 4.2 Hrs / Jar Hrs 83.73. MPD connection back pressure = 250 psi / 12.0 ppg EMW 6,690.0 7,090.0 1/6/2023 00:00 1/6/2023 06:00 6.00 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/7,090' to 7,475' MD / 4,619' TVD, 1800 gpm, 2660 psi, 12.11 ppg ECD, 27 k wob, 140 rpm, 21/27 k trq, PU Wt 229 k, SO Wt 174 k, ROT Wt 201 k, ADT 4.2 Hrs / Jar Hrs 87.93. MPD connection back pressure = 250 psi / 12.0 ppg EMW 7,090.0 7,475.0 1/6/2023 06:00 1/6/2023 06:30 0.50 INTRM2, DRILL SVRG P Service rig, top drive and draw works. 7,475.0 7,475.0 1/6/2023 06:30 1/6/2023 12:00 5.50 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/7,475' to 7,889' MD / 4,702' TVD, 1800 gpm, 2659 psi, 12.00 ppg ECD, 28 k wob, 140 rpm, 21/27 k trq, PU Wt 228 k, SO Wt 162 k, ROT Wt 199 k, ADT 3.36 Hrs / Jar Hrs 91.29. MPD connection back pressure = 250 psi / 12.0 ppg EMW 7,475.0 7,889.0 1/6/2023 12:00 1/7/2023 00:00 12.00 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/7,889' to 8,725' MD / 4,882' TVD, 1800 gpm, 2805 psi, 11.96 ppg ECD, 29 k wob, 160 rpm, 22/29 k trq, PU Wt 240 k, SO Wt 166 k, ROT Wt 209 k, ADT 7.13 Hrs, Total bit Hrs 22.97 / Jar Hrs 98.42. MPD connection back pressure = 250 psi / 12.0 ppg EMW 7,889.0 8,725.0 1/7/2023 00:00 1/7/2023 12:00 12.00 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/8,725' to 9,821' MD / 5,108' TVD, 1788 gpm, 3083 psi, 12.04 ppg ECD, 30 k wob, 160 rpm, 22/31 k trq, PU Wt 252 k, SO Wt 160 k, ROT Wt 214 k, ADT 8.22 Hrs, Total bit Hrs 31.58 / Jar Hrs 107.03. MPD connection back pressure = 250 psi / 12.0 ppg EMW 8,725.0 9,821.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 28/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/7/2023 12:00 1/8/2023 00:00 12.00 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/9,821' to 10,957' MD / 5,340' TVD, 1789 gpm, 3046 psi, 12.01 ppg ECD, 30 k wob, 160 rpm, 25/34 k trq, PU Wt 268 k, SO Wt 168 k, ROT Wt 221 k, ADT 8.15 Hrs, Total bit Hrs 39.73 / Jar Hrs 115.18. MPD connection back pressure = 250 psi / 12.0 ppg EMW 9,821.0 10,957.0 1/8/2023 00:00 1/8/2023 12:00 12.00 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/10,957' to 12,026' MD / 5,562' TVD, 1788 gpm, 3161 psi, 12.08 ppg ECD, 30 k wob, 160 rpm, 28/37 k trq, PU Wt 271 k, SO Wt 183 k, ROT Wt 222 k, ADT 8.57 Hrs, Total bit Hrs 48.30 / Jar Hrs 123.75 MPD maintain 12.0 ppg EMW on connections. 10,957.0 12,026.0 1/8/2023 12:00 1/8/2023 21:30 9.50 INTRM2, DRILL DDRL P Drill ahead 15-3/4" x 17-1/2" hole f/12,026' to TD 12,607' MD / 5,583' TVD, 1796 gpm, 2931 psi, 11.99 ppg ECD, 19 k wob, 160 rpm, 27/32 k trq, PU Wt 277 k, SO Wt 196 k, ROT Wt 225 k, ADT 7 Hrs, Total bit Hrs 55.3 / Jar Hrs 130.75 MPD maintain 12.0 ppg EMW on connections. Added 1500 bbls new mud on last stand drilled. Pump up final survey and collect T&D 12,026.0 12,607.0 1/8/2023 21:30 1/9/2023 00:00 2.50 INTRM2, TRIPCAS CIRC P Circ and condition mud/hole for 2+ B/U w/1780 gpm, 3235 psi, 11.99 ppg ECD, 180 rpm, 29 k trq, Reciprocate 60' 12,607.0 12,607.0 1/9/2023 00:00 1/9/2023 01:30 1.50 INTRM2, TRIPCAS UREM T Attempt to close reamer with pressure differential cycle. Cycle pumps 1800 gpm / 3050 psi and 1450 gpm / 2175 psi as per Weatherford pressure cycle procedure. Reduce pumps to 1350 gpm and collect base parameters. Drop RFID tags as per Weatherford rep and pump thru BHA. Return to base line parameters and all indications that reamer did not cycle closed. (Down link close cycle was un-successful / RFID close method was also un-successful). 12,607.0 12,607.0 1/9/2023 01:30 1/9/2023 03:15 1.75 INTRM2, TRIPCAS UREM P Attemtp again to close Under Reamer. Drop second round of RFID tags and while pumping tags down perform pressure differential cycle procedure. Return to base line parameters and reamer closed on second attempt. Collect final T&D, PU wt 260 k, SO Wt 200k, ROT Wt 230 k, 30 rpm, 22 k trq Reamer Open = 1350 gpm, 1930 psi, 2600 PD TRPM, 2968 MWD TRPM, ROT Wt 230 k, 24 k trq at 30 rpm Reamer Closed = 1350 gpm, 2300 psi, 3250 PD TRPM, 3750 MWD TRPM, ROT Wt 230 k, 22 k trq at 30 rpm 12,607.0 12,607.0 1/9/2023 03:15 1/9/2023 04:00 0.75 INTRM2, TRIPCAS OWFF P OWFF. Rotate at 10 rpm. Initially trap 12.0 ppg EMW and slowly decrease to 11.0 ppg EMW. Monitor returns on trip tank during draw down. Decrease at .5 ppg increments and gain total of 7 bbls back in trip tank. Open up bleeder and take returns to cellar and confirm no flow. Well static after 30 min. 12,607.0 12,607.0 1/9/2023 04:00 1/9/2023 04:30 0.50 INTRM2, TRIPCAS BKRM P Line up pump #4 for dynamic MPD connections. 12,607.0 12,100.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 29/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/9/2023 04:30 1/9/2023 06:00 1.50 INTRM2, TRIPCAS BKRM P BROOH f/12,607' to ~12,319' w/1350 gpm, 2250 psi, 150 rpm, 22 k trq. MPD 300 psi maintain 12.0 ppf EMW on connections. 12,607.0 12,319.0 1/9/2023 06:00 1/9/2023 12:00 6.00 INTRM2, TRIPCAS BKRM P BROOH f/12,319' to 10149' w/1350 gpm, 2354 psi, 160 rpm, 28 k trq. MPD 300 psi maintain 12.0 ppf EMW on connections. 12,319.0 12,000.0 1/9/2023 12:00 1/9/2023 18:00 6.00 INTRM2, TRIPCAS BKRM P BROOH f/ 10149' to 8770' w/1350 gpm, 2232 psi, 140 rpm, 22 k trq. MPD 300 psi maintain 12.0 ppf EMW on connections. 12,000.0 8,770.0 1/9/2023 18:00 1/10/2023 00:00 6.00 INTRM2, TRIPCAS BKRM P BROOH f/ 8770' to 7667' w/1350 gpm, 2020 psi, 140 rpm, 24 k trq. MPD 300 psi maintain 12.0 ppf EMW on connections. P/U 220 S/O 170K RT WT 196k 8,770.0 7,667.0 1/10/2023 00:00 1/10/2023 05:00 5.00 INTRM2, TRIPCAS BKRM P BROOH f/ 7667' to w/1350 gpm, 2020 psi, 140 rpm, 24 k trq. MPD 300 psi maintain 12.0 ppf EMW on connections. P/U 220 S/O 170K RT WT 196k 7,667.0 6,770.0 1/10/2023 05:00 1/10/2023 06:00 1.00 INTRM2, TRIPCAS CIRC P Circulate at 1335 gpm with 1950 psi wtih 150 RPMs and 23k to 28k torque. 6,770.0 6,770.0 1/10/2023 06:00 1/10/2023 08:00 2.00 INTRM2, TRIPCAS BKRM P BROOH from 6,771‘ MD to 6,400‘ MD. 350 gpm, 505 psi, 30 RPM with 26k torque. Flow out at 22%, ECD's at 12.30 ppg. P/U wt 225k, S/O wt 165k, ROT wt 196k @ 350 gpm. Hold 300 psi on connections. No rotation while pulling into the shoe. 6,770.0 6,400.0 1/10/2023 08:00 1/10/2023 09:00 1.00 INTRM2, TRIPCAS CIRC P Circulate bottoms up. 1,350 gpm with 1932 psi. Flow out 51%. 6,400.0 6,400.0 1/10/2023 09:00 1/10/2023 09:15 0.25 INTRM2, TRIPCAS CIRC P Drop 3.25" steel ball to open well commander as per DD. Pump ball down at 120 gpm with 400 psi. Ball seat at 200 strokes, well commander open at 2,208 psi. 6,400.0 6,400.0 1/10/2023 09:15 1/10/2023 11:00 1.75 INTRM2, TRIPCAS CIRC P Circulate wellbore. 1800 gpm with 1395 psi. Pump 75 bbl low vis sweep followed by 75 bbl high vis sweep. Total strokes pumped - 16,300 6,400.0 6,400.0 1/10/2023 11:00 1/10/2023 11:30 0.50 INTRM2, TRIPCAS OWFF P Blow down TDS. Prep floor and pits for SOOH. 6,400.0 6,400.0 1/10/2023 11:30 1/10/2023 15:45 4.25 INTRM2, TRIPCAS SMPD P SOOH from 6400' to 2645'. P/U wt 215k, MPD holding 360 psi. 6,400.0 2,645.0 1/10/2023 15:45 1/10/2023 16:30 0.75 INTRM2, TRIPCAS MPDA P PJSM, Remove MPD bearing as per SOP. 2,645.0 2,645.0 1/10/2023 16:30 1/10/2023 17:00 0.50 INTRM2, TRIPCAS CIRC P Circulate wellbore at 2,645'. 1800 gpm with 892 psi. Flow out 56%. 6,440 total strokes pumped. 2,645.0 2,645.0 1/10/2023 17:00 1/10/2023 17:30 0.50 INTRM2, TRIPCAS OWFF P B/D top drive, prep floor and pits for POOH, 15 min flow check (static). 2,645.0 2,645.0 1/10/2023 17:30 1/10/2023 18:00 0.50 INTRM2, TRIPCAS TRIP P POOH from 2,645' to 2,209'. P/U wt 175k. Monitor hole via trip tank. Correct fill noted. 2,645.0 2,209.0 1/10/2023 18:00 1/10/2023 19:30 1.50 INTRM2, TRIPCAS TRIP P Pooh f/ 2,209' t/ 626' puw= 96k, monitor hole file via t.t POOH from 2,209' to 626'. P/U wt 96k. Monitor hole via trip tank. Correct fill noted. 2,209.0 626.0 1/10/2023 19:30 1/10/2023 20:00 0.50 INTRM2, TRIPCAS OWFF P OWFF for 15min (static). PJSM for laying down intermediate 2 BHA. 626.0 626.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 30/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/10/2023 20:00 1/11/2023 00:00 4.00 INTRM2, TRIPCAS BHAH P Lay down Intermediate 2 BHA as per slb DD from 626' to 150'. Monitor hole via trip tank. 626.0 150.0 1/11/2023 00:00 1/11/2023 01:45 1.75 INTRM2, TRIPCAS BHAH P Lay down Intermediate 2 BHA as per SLB DD from 150' to bit. Monitor hole via trip tank. Correct fill. 0.0 0.0 1/11/2023 01:45 1/11/2023 04:00 2.25 INTRM2, CASING CLEN P Clean and clear rig floor. Remove all directional equipment and subs, Bit and Bit Breaker. 0.0 0.0 1/11/2023 04:00 1/11/2023 05:30 1.50 INTRM2, CASING WWWH P M/U stack jetting tool on 1 stand 6 5/8" DP, Was stack with 1080 GPM and10 RPM. Blow down top drive. 0.0 0.0 1/11/2023 05:30 1/11/2023 08:00 2.50 INTRM2, CASING RURD P Drain BOP stack and change out elevators, change upper rams to 13-5/8" solid body rams. Prepare to pull wear ring. SIMOPS conducting pump maintenance. 0.0 0.0 1/11/2023 08:00 1/11/2023 12:00 4.00 INTRM2, CASING RURD P Make up 2 joints of 6-5/8" drill pipe and wear ring running tool, attempt to pull wear ring, unable to get J hooks to engage. Make up stack jetting tool and wash at max rate. Drain stack and pull wear ring as per Cameron rep. 0.0 0.0 1/11/2023 12:00 1/11/2023 14:00 2.00 INTRM2, CASING RURD P Lay down 2 joints of 6-5/8" drill pipe and wear ring running tool, Make up test joint and pups. Set BOP test plug with 13-5/8" test joint on 1 stand of 6-5/8" drill pipe below test plug as per SOP. Flood BOP with H2O and notice leak in driller side ram door on top ram. 0.0 0.0 1/11/2023 14:00 1/11/2023 15:00 1.00 INTRM2, CASING RURD T Drain BOP close blind rams bleed off Koomey and open upper ram door and replace seal on ram door. SIMOPS continue pump maintenance. 0.0 0.0 1/11/2023 15:00 1/11/2023 16:00 1.00 INTRM2, CASING BOPE P Set 13-5/8" test plug , fill stack with H2O and test upper solid body rams to 250 psi low for 5 minutes and 4000 psi high for 10 minutes , charted. 0.0 0.0 1/11/2023 16:00 1/11/2023 18:00 2.00 INTRM2, CASING RURD P Mobilize Doyon casing equipment. M/U 13 5/8" Hanger and Landing Jt. Perform dummy run as per Cameron hand. Landed out on shoulder, Witness by COP Rep. 0.0 0.0 1/11/2023 18:00 1/11/2023 18:45 0.75 INTRM2, CASING RURD P L/D Hanger and Landing JT. as per Cameron Rep. 0.0 0.0 1/11/2023 18:45 1/11/2023 23:15 4.50 INTRM2, CASING RURD P Rig up to Run 13 5/8" 88.2# L-80 IC Hydril-563 casing. P/U long bales and 6' Bale Extensions, P/U 13 5/8" Volant CRT, Casing Spiders, Verify 13 5/8" casing swedge on rig with TIW install prior to run casing 0.0 0.0 1/11/2023 23:15 1/12/2023 00:00 0.75 INTRM2, CASING PUTB P PJSM, Verify casing count, P/U shoe track, Change out Collars on #2 and #3 jts, Baker lock each Collar as per casing program 0.0 60.0 1/12/2023 00:00 1/12/2023 02:30 2.50 INTRM2, CASING PUTB P Cont. P/U 13 5/8" shoe Baker Lock each collar and connection, Pump through Floats, Check floats are holding, Fill shoe track with 30 bbl's 11 ppg mud 60.0 211.0 1/12/2023 02:30 1/12/2023 03:00 0.50 INTRM2, CASING OWFF P Blow Down Top Drive, Verify floats are holding. 211.0 211.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 31/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/12/2023 03:00 1/12/2023 06:00 3.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril 563 casing as per casing tally f/ 211' to 901' Monitoring displacement via Pit 5 Getting Displacement strap every jt. 211.0 901.0 1/12/2023 06:00 1/12/2023 12:00 6.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, f/ 901 to 3428' Monitor displacements via Pit #5 Strapping every 5 jts. SOW=82K @ 3200' RPM=20 TQ=6K RW=101K 901.0 3,428.0 1/12/2023 12:00 1/12/2023 20:00 8.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, f/ 3428' to 7000' Monitor Displacements via Pit #5 Strapping every 5 jts. RW=95K TQ=13K @ 6398' in casing. Loss S/O Weight at 6613' SOW 63K, 3,428.0 6,613.0 1/12/2023 20:00 1/12/2023 21:00 1.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 6613' to 7000'Rotating each Jt. RPM=20 TQ=11K SO/RW 85K 6,613.0 7,000.0 1/12/2023 21:00 1/13/2023 00:00 3.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 7000' to 7728' Rotating each Jt. RPM=20 TQ=10K SO/RW= 85K Monitoring Displacement Via #5 Pit Strapping every 5 Jts. 7,000.0 7,728.0 1/13/2023 00:00 1/13/2023 02:30 2.50 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 7728' to 8300' Rotating each Jt. RPM=20 TQ=10K SO/RW= 85K Monitoring Displacement Via #5 Pit Strapping every 5 Jts. 7,728.0 8,300.0 1/13/2023 02:30 1/13/2023 02:45 0.25 INTRM2, CASING OWFF P OWFF 15 Min Observe 2 BBL, Discrepancy in Displacement strap at Pits, Found that casing jts had increased in length by1' to 2' Per-Jt. which increased Displacement values. Displacement was correct. OWFF Well Static. 8,300.0 8,300.0 1/13/2023 02:45 1/13/2023 06:00 3.25 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 8300' to 9008' Rotating each Jt. RPM=20 TQ=10K SO/RW= 74K Monitoring Displacement Via #5 Pit Strapping every 5 Jts. 8,300.0 9,008.0 1/13/2023 06:00 1/13/2023 12:00 6.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 9008' to 10395' Rotating each Jt. RPM=20 TQ=10K SO/RW= 74K Monitoring Displacement Via #5 Pit Strapping every 5 Jts. 9,008.0 10,395.0 1/13/2023 12:00 1/13/2023 18:00 6.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 10395' to 11638' Rotating each Jt. RPM=20 TQ=10K/12K SO/RW= 80K Monitoring Displacement Via #5 Pit Strapping every 5 Jts. 10,395.0 11,638.0 1/13/2023 18:00 1/14/2023 00:00 6.00 INTRM2, CASING PUTB P P/U and Run 13 5/8" 88.2# L-80 IC Hydril casing as per tally, RIH f/ 11638' to 12604 Rotating each Jt. RPM=20 TQ=10K/12K SO/RW= 80K Monitoring Displacement Via #5 Pit Strapping every 5 Jts. Obtain Final P/U 177K S/O 67K with no rotation 11,638.0 12,604.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 32/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/14/2023 00:00 1/14/2023 02:30 2.50 INTRM2, CASING HOSO P P/U Cameron 13 5/8" casing hanger, M/U to 13 5/8" casing Jt # 303. Work casing hanger down S/O 55K P/U 13 5/8" Landing Jt M/U to 13 5/8" hanger, Work Hanger down and land out Hanger on depth. Verify Hanger on Depth Via IA valve. Cameron and COP Rep's. 12,599.0 12,599.0 1/14/2023 02:30 1/14/2023 05:00 2.50 INTRM2, CEMENT CLEN P Clean and Clear Rig Floor, Mobilize Equipment for filling 13 5/8" casing and bleeding air. R/U equipment, Monitoring well Via Trip Tank. 12,599.0 12,599.0 1/14/2023 05:00 1/14/2023 05:30 0.50 INTRM2, CEMENT OTHR P SIMOPS Taking on 11.0 PPG mud at Mud pits Fluid Pack and prime Mud Pumps. Pressure test #1-4 Pumps due to changing liners to 6" before filling 13 5/8" casing with 11.0 ppg mud. 12,599.0 12,599.0 1/14/2023 05:30 1/14/2023 06:00 0.50 INTRM2, CEMENT CIRC P PJSM Start Pumping at 200 GPM, filling 13 5/8" casing w/ 11.0 PPG mud and bleeding air. Total Mud pumped 142 BBLS 12,599.0 12,599.0 1/14/2023 06:00 1/14/2023 10:00 4.00 INTRM2, CEMENT CIRC P Cont. filling 13 5/8" casing W/ 11.0 PPG mud @ 230 GPM, 68PSI @ 911BBLS pumped. Shut Down and bleed air off for 60 Minutes 12,599.0 12,599.0 1/14/2023 10:00 1/14/2023 12:15 2.25 INTRM2, CEMENT CIRC P Cont. filling 13 5/8" casing W/ 11.0 PPG mud @ 230 GPM, 68PSI @ 480 BBLS pumped. Shut Down and Bleed Air off for 45 Minutes. Total Mud Pumped 1391 BBLS. 12,599.0 12,599.0 1/14/2023 12:15 1/14/2023 16:30 4.25 INTRM2, CEMENT CIRC P Cont. Filling 13 5/8" casing W/ 11.0 PPG mud @ 230 GPM, 68PSI @ 489 BBLS pumped. Shut Down and bleed air off for 45 Minutes. Total Mud Pumped 1880 BBLS. 12,599.0 12,599.0 1/14/2023 16:30 1/14/2023 16:45 0.25 INTRM2, CEMENT OWFF P OWFF. Shut off hole fill and monitor well for 15 min. Well Static. 12,599.0 12,599.0 1/14/2023 16:45 1/14/2023 19:45 3.00 INTRM2, CEMENT RURD P Rig Down 13 5/8" casing filling equipment, Blow down all mud surface lines, Rig Down Casing Equipment. R/U high pressure equipment for circulating and up coming 13 5/8" cement job, R/U Chart Recorder. 12,599.0 12,599.0 1/14/2023 19:45 1/14/2023 20:00 0.25 INTRM2, CEMENT PRTS P Fluid Pack Surface Equipment and shell test T/3500 psi for 5 min. Test good. 12,599.0 12,599.0 1/14/2023 20:00 1/15/2023 00:00 4.00 INTRM2, CEMENT CIRC P Establish circulation parameters, staging flow rate up @ 1 BPM increments f/ 1BPM 376 psi F/O 3% T/ 5 BPM 520 psi F/O 3% T/ 10BPM 748 PSI F/O 8% T/ 12 BPM 823 psi F/O 20%. SIMOPS Blowing down cement line and clean Rig Floor from past Casing Run. 12,599.0 12,599.0 1/15/2023 00:00 1/15/2023 02:00 2.00 INTRM2, CEMENT CIRC P Circulate clean mud to ensure no air on back side for coming up Cement job. GPM=500 PSI=786 F/O 20% Total Strokes pumped 28000 STKS. MDWT at Bottoms up 11.1 ppg. 12,599.0 12,599.0 1/15/2023 02:00 1/15/2023 02:30 0.50 INTRM2, CEMENT SFTY P PJSM W/ SLB on Cement operations for 13 5/8" casing cement job 12,599.0 12,599.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 33/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/15/2023 02:30 1/15/2023 07:30 5.00 INTRM2, CEMENT CMNT P Pump 100 BBLS 13 PPG mud push via rig @ 7 BPM 390= PSI 2% F/O chase w/ 5 BBL H2O Via SLB. Pressure Test surface lines T/ 3500 PSI F/ 5min Drop Bottom plug pump 194 BBLS 15.8 PPG Tail cement @6 BPM 350 PSI W/ Full Returns Drop Top Plug chase w/ 20 BBLS H2O @ 6 BPM 200 PSI Swap to Rig Pump Displace Cement W/ 11.0 PPG Mud @ 10 BPM @ 320 PSI. Mud push at shoe 13270 strokes 380 PSI. Reduce rate to 3 BPM. Land bottom plug and observe pressure build to 516 PSI and drop to 412 PSI when the burst disc shears @13930 strokes. Continue pumping at 6 BPM and reduce down to 3 BPM at 14900 strokes observe top plug land at 15,550 strokes FCP 900 PSI, Continue pumping to 15,578 stokes to 1400 PSI final strokes and hold 1400 PSI for 5 minutes. Full returns throughout cement Job. 12,599.0 12,599.0 1/15/2023 07:30 1/15/2023 08:30 1.00 INTRM2, CEMENT CMNT P Bleed off additional 500 PSI and open cement valve on Volant to atmosphere, observe small amount of flow for 5 minutes then reducing down 2 quarts per minute. Continue to monitor for the next 45 minutes and observe flowback rate is not reducing. Shut in and allow cement to build to 50 PSI compressive strength. 12,599.0 12,599.0 1/15/2023 08:30 1/15/2023 15:30 7.00 INTRM2, CEMENT WOC T Wait for cement to reach 50 PSI compressive strength before rigging down. Simops prep 5-7/8" drill pipe for INT3 and begin L/D 6-5/8" drill pipe from the derrick. Clean Pits, Clean cement valves. 12,599.0 12,599.0 1/15/2023 15:30 1/15/2023 16:00 0.50 INTRM2, CEMENT OWFF P Bleed PSI off from 250 psi to O psi, Monitor well for 30 min 12,599.0 12,599.0 1/15/2023 16:00 1/15/2023 16:15 0.25 INTRM2, CEMENT RURD P R/D 1502 Cementing equip from Volant tool 12,599.0 12,599.0 1/15/2023 16:15 1/15/2023 17:00 0.75 INTRM2, CEMENT RURD P Back out and Pull landing Jt. Break Connection w/ Volant tool and Landing Jt. in two pieces to handled down beaver slide. 12,599.0 12,599.0 1/15/2023 17:00 1/15/2023 18:00 1.00 INTRM2, CEMENT RURD P R/D Clean and Remove Casing equipment Bales, Strap Tongs, Elevators Volant Slips, Crew Change 12,599.0 12,599.0 1/15/2023 18:00 1/15/2023 21:30 3.50 INTRM2, WHDBOP RURD P R/D Clean and Remove Casing Equipment, Bales, Strap Tongs, Volant Tool, Slips, R/u Bales and Rig Elevators for Jetting and setting Cameron Packoff. 12,599.0 12,599.0 1/15/2023 21:30 1/15/2023 23:00 1.50 INTRM2, WHDBOP WWWH P M/U Cameron Profile Jetting tool on STD 6 5/8" Drill Pipe. Jet Profile as Per Cameron Rep.RPM=5 GPM=800 60 BBLS pumped Lig Water. L/D Jetting Tool, Pump Out Stack 12,599.0 12,599.0 1/15/2023 23:00 1/16/2023 00:00 1.00 INTRM2, WHDBOP WWSP P M/U Cameron Pack off Setting Tool as Per Cameron Rep. 12,599.0 12,599.0 1/16/2023 00:00 1/16/2023 01:30 1.50 INTRM2, WHDBOP WWSP P Cont. R/U Cameron Packoff Running Tool as per Cameron Rep. 12,599.0 12,599.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 34/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/16/2023 01:30 1/16/2023 02:30 1.00 INTRM2, WHDBOP WWSP P RIH w/ Cameron Packoff, Sit Down 10K Set Pack off, Pull 50K over to verify Packoff is Set. Test Packoff to 5000 psi for 15 Min. Witness By COP Rep. Packoff ID 12.9375" 12,599.0 12,599.0 1/16/2023 02:30 1/16/2023 04:00 1.50 INTRM2, WHDBOP RURD P L/D Cameron Packoff Running Assy as per SOP and Cameron Rep. 12,599.0 12,599.0 1/16/2023 04:00 1/16/2023 06:00 2.00 INTRM2, WHDBOP FRZP P SIMOPS Changing out Top Rams to 4 1/2" x 7 5/8" VBR"S Note: R/U LRS Freeze Protect @ 20" x 13 5/8" Pump Rate @ 2 BPM PSI=700 12,599.0 12,599.0 1/16/2023 06:00 1/16/2023 08:00 2.00 INTRM2, WHDBOP FRZP P Cont. LRS, Freeze Protect @ 20" x 13 5/8" Pump Rate @ 2 BPM PSI=700 Bring Thread Protectors to Rig Floor and Prepare Rig floor to L/D 6 7/8" Drill pipe, Clean 135/8" Rams and store 12,599.0 12,599.0 1/16/2023 08:00 1/16/2023 10:15 2.25 INTRM2, WHDBOP RURD P R/U to Test BOPE, M/U 6 5/8" TIW valves and Dart Valves Mobilize 5 7/8" TIW Valves to rig floor M/U valves. 12,599.0 12,599.0 1/16/2023 10:15 1/16/2023 11:30 1.25 INTRM2, WHDBOP WWWH P M/U stack washer on STD of 6 5/8" Drill pipe. Space out in Stack. Function Annular and LPR'S Wash Ram Cavities. B/D TD 12,599.0 12,599.0 1/16/2023 11:30 1/16/2023 12:00 0.50 INTRM2, WHDBOP RURD P M/U 5 7/8" Test Jt. Pup Jt and Test Plug As per Cameron Rep. 12,599.0 12,599.0 1/16/2023 12:00 1/16/2023 12:45 0.75 INTRM2, WHDBOP RURD P Cont. M/U 5 7/8" Test Jt, Pup Jts, and Test Plug on Stand of 6 5/8" Drill Pipe Install Test Torpedo on Top Drive. 12,599.0 12,599.0 1/16/2023 12:45 1/16/2023 13:15 0.50 INTRM2, WHDBOP CIRC P Drain Stack Flush Choke and Kill lines with H2O. Via Charging Pump 12,599.0 12,599.0 1/16/2023 13:15 1/16/2023 14:15 1.00 INTRM2, WHDBOP RURD P RIH Set Test Plug, Test plug leaked by Seal 12,599.0 12,599.0 1/16/2023 14:15 1/16/2023 15:30 1.25 INTRM2, WHDBOP RURD T Pull Test Plug Inspect O-Ring, Cleaned and Greased Test Plug, RIH Reset Test Plug 12,599.0 12,599.0 1/16/2023 15:30 1/16/2023 18:00 2.50 INTRM2, WHDBOP BOPE P PJSM Fluid Pack Test Equipment Shell Test BOPE Stack Test BOPE with % 7/8" Test Jt Test Annular 250 PSI Low 5/Min 2500 PSI High 10/Min Upper Rams, IBOP, Lower IBOP, Valves 1, 4, 9, 10, 12, 13, 14, 15, 16, HCR Kill, Manual Kill,250 PSI Low 5/Min 4000PSI High 10 Min 12,599.0 12,599.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 35/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/16/2023 18:00 1/17/2023 00:00 6.00 INTRM2, WHDBOP BOPE P Cont. Test BOPE as Per SOP and Regulations, Witnessed By AOGCC Rep Sully Sullivan All Test Charted 5/Min Low 4000 PSI High 10/Min. With Exception of Annular 250 PSI low 5/Min 2500 PSI high 10/Min. W/ 5 7/8" Test Jt. Upper 4 1/2" x 7 5/8" VBR Rams< Lower 3 1/2" x 6 5/8" VBR Rams, Blind Rams, Choke Valves # 2, 3, 5, 8, 11 and Kill #3, HCR Choke, Manual Choke, 5 7/8" and 6 5/8" Dart and TIW valves. Perform Koomey Drawdown Test ACC=2900 PSI, Manifold 1480 PSI. ACC 1650 PSI after all Functions on Bottles 26 Sec. For 200 PSI. Build W/ 2 Electric Pumps 138 Sec. to Build Fill System PSI. Pressure up with 2 Electric Pumps and Air Pumps 14 Sec to close, Upper Rams 15 sec., Blind /Shear Rams 17 Sec., Lower Ram 17 sec., Choke HCR 2 sec., KIll HCR 2 Sec., Test PVT GAin/Loss and Flow Out Alarms, Test LEL and H2S Alarms all passed. Nitrogen 10 Bottles Average =4000 PSI 12,599.0 12,599.0 1/17/2023 00:00 1/17/2023 03:00 3.00 INTRM2, WHDBOP BOPE P Cont to test BOPE as Per SOP and Regulations. AOGCC REP Sully Sullivan, All Test Charted F/5 Min 250 Low F/10 Min high 4000 psi, With Exception of Annular 250 Low 5 Min 2500 High 10 Min, With 6 5/8" Test Jt. Upper 4 1/2" x 7 5/8" VBRS Ram, Manual Choke, Super Choke 1500 PSi with Controlled Bleed off. 12,599.0 12,599.0 1/17/2023 03:00 1/17/2023 04:45 1.75 INTRM2, WHDBOP RURD P B/D and R/U Test Equipment B/D 6 5/8" and 5 7/8" TIW'S and Dart Valve Drain BOP Stack Pull Test Plug / Test Joint And 1 Stand of Drill Pipe Clean/Clear Rig Floor. Mobilize Wear Ring to Rig Floor 12,599.0 12,599.0 1/17/2023 04:45 1/17/2023 05:30 0.75 INTRM2, WHDBOP WWWH P M/U Cameron Wear Ring RIH and Set ID=12.45 OD=18.40 Length 49.25" Verify Wear ring is Set. Run in Lock Down Screws. 12,599.0 12,599.0 1/17/2023 05:30 1/17/2023 06:00 0.50 INTRM2, WHDBOP RURD P R/D and L/D 6 5/8" Test Jt and Space Out Pups And Wear Ring Running Tool. 12,599.0 12,599.0 1/17/2023 06:00 1/17/2023 07:00 1.00 INTRM2, WHDBOP RURD P Cont. R/D and L/D 6 5/8" Test Jt and Space Out Pups And Wear Ring Running Tool. 12,599.0 12,599.0 1/17/2023 07:00 1/17/2023 08:30 1.50 INTRM2, WHDBOP RURD P R/U For Casing Test Mobilize Bit And BHA to Rig Floor. 12,599.0 12,599.0 1/17/2023 08:30 1/17/2023 09:00 0.50 INTRM2, WHDBOP CIRC P Purge Kill And Choke Line W/ H2O From Mud Pump #1 Close Blind Rams. 12,599.0 12,599.0 1/17/2023 09:00 1/17/2023 10:15 1.25 INTRM2, DRILLOUT PRTS P PJSM Test and Chart 13 5/8" casing to 4000 PSI @ 1 BPM Total Volume Pumped =29.2 BBLS Shut In Kill Line and Hold For 30/Min. 12,599.0 12,599.0 1/17/2023 10:15 1/17/2023 10:30 0.25 INTRM2, DRILLOUT PRTS P Bleed 29 BBLS Back To Trip Tank. Open Blind Rams Monitor Well 5/Min: Well Static 12,599.0 12,599.0 1/17/2023 10:30 1/17/2023 11:30 1.00 INTRM2, DRILLOUT CLEN P Drain Stack/Riser B/D Choke Andf Kill Line. Fill Stack/Riser W/Drill Out Mud. Monitor Well Via Trip Tank 12,599.0 12,599.0 1/17/2023 11:30 1/17/2023 12:00 0.50 INTRM2, DRILLOUT OTHR P Open Pipe Handler and Inspect Threads On Saver Sub. Prep To Changew Out Wash Pipe and Torque Bearing Retainer 12,599.0 12,599.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 36/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/17/2023 12:00 1/17/2023 14:30 2.50 INTRM2, DRILLOUT OTHR P Change Out Wash Pipe and Torque Bearing Retainer Plate Bolts. 12,599.0 12,599.0 1/17/2023 14:30 1/17/2023 16:30 2.00 INTRM2, DRILLOUT OTHR P Clean Pipe Handler, Saver Sub and Grabber Dies. Change Out VX69 Saver Sub. 12,599.0 12,599.0 1/17/2023 16:30 1/17/2023 18:00 1.50 INTRM2, DRILLOUT OTHR P Change Out Elevators And Move Stands Of 6 5/8" Drill pipe From ODS To Drillers Side 12,599.0 12,599.0 1/17/2023 18:00 1/17/2023 18:45 0.75 INTRM2, DRILLOUT BHAH P PJSM Rig Up Rig Floor To Pickup BHA Prep Slips, Dog Collar, Elevators. 12,599.0 12,599.0 1/17/2023 18:45 1/17/2023 19:00 0.25 INTRM2, DRILLOUT BHAH P P/U 12.25 x 13.5 Interm #3 BHA As Per SOP /SLB DD Rep. Attempt To Make Up 12.25 Axeblade Bit Rig Tong Wouldn't Bit On XCel Collar. 12,599.0 12,599.0 1/17/2023 19:00 1/17/2023 20:45 1.75 INTRM2, DRILLOUT BHAH T Change Out Rig Tongs F/ HT160 to HT100 Rig Tongs, TQ 12.25 Axeblade 53K 12,599.0 12,599.0 1/17/2023 20:45 1/18/2023 00:00 3.25 INTRM2, DRILLOUT BHAH P Cont. M/U 12.25"x 13.5" BHA F/ 27' T/ 163' Install 3 Size 10 Nozzles in the XM Reamer As Per SLB Reamer Rep, Clear Rig Floor Load Radiation Source. 27.0 163.0 1/18/2023 00:00 1/18/2023 02:30 2.50 INTRM2, DRILLOUT BHAH P Cont. M/U 12.25"x 13.5" BHA F/ 163' To 574' As Per SLB DD. Inspect Well Commander and GS-5F69 Floats, Drift Jars to 2.75" Drift Tools Above Well Commander To 2.5" P/U 133K S/O 133K 163.0 574.0 1/18/2023 02:30 1/18/2023 03:00 0.50 INTRM2, DRILLOUT CLEN P Clean And Clear Rig Floor. R/U To Single In From Pipe Shed 574.0 574.0 1/18/2023 03:00 1/18/2023 05:30 2.50 INTRM2, DRILLOUT TRIP P TIH F/ 574" to 1505' MD W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 138 K S/O 138 K. Monitoring well Via Trip Tank 574.0 1,505.0 1/18/2023 05:30 1/18/2023 06:00 0.50 INTRM2, DRILLOUT CIRC P @ 1505' MD Shallow Hole Test MWD Tools @ 670 GPM 1001 PSI: Good Test 1,505.0 1,505.0 1/18/2023 06:00 1/18/2023 06:30 0.50 INTRM2, DRILLOUT RURD P Remove X/O from Top-Drive, Blow Down Top Drive 1,505.0 1,505.0 1/18/2023 06:30 1/18/2023 09:15 2.75 INTRM2, DRILLOUT TRIP P TIH F/ 1505' to 2799' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 184 K S/O 181 K. Monitoring well Via Trip Tank 1,505.0 2,799.0 1/18/2023 09:15 1/18/2023 10:00 0.75 INTRM2, DRILLOUT CIRC P @ 2799' MD Shallow Hole Test MWD Tools @ 680 GPM 1090 PSI: Good Test 2,799.0 2,799.0 1/18/2023 10:00 1/18/2023 10:30 0.50 INTRM2, DRILLOUT RURD P Remove X/O from Top-Drive, Blow Down Top Drive 2,799.0 2,799.0 1/18/2023 10:30 1/18/2023 12:00 1.50 INTRM2, DRILLOUT TRIP P TIH F/ 2799' to 3760' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 188 K S/O 170K. Monitoring well Via Trip Tank 2,799.0 3,760.0 1/18/2023 12:00 1/18/2023 13:30 1.50 INTRM2, DRILLOUT TRIP P TIH F/ 3760' to 4662' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 195K S/O 160K. Monitoring well Via Trip Tank 3,760.0 4,662.0 1/18/2023 13:30 1/18/2023 14:00 0.50 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 4,662.0 4,662.0 1/18/2023 14:00 1/18/2023 15:45 1.75 INTRM2, DRILLOUT TRIP P TIH F/ 4662' to 6060' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 207K S/O 147K. Monitoring well Via Trip Tank 4,662.0 6,060.0 1/18/2023 15:45 1/18/2023 16:15 0.50 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 6,060.0 6,060.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 37/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/18/2023 16:15 1/18/2023 17:30 1.25 INTRM2, DRILLOUT TRIP P TIH F/ 6060' to 6986' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 220K S/O 145K. Monitoring well Via Trip Tank 6,060.0 6,986.0 1/18/2023 17:30 1/18/2023 18:00 0.50 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 6,986.0 6,986.0 1/18/2023 18:00 1/18/2023 19:00 1.00 INTRM2, DRILLOUT TRIP P TIH F/ 6986' to 7986 MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 225K S/O 140K. Monitoring well Via Trip Tank 6,986.0 7,986.0 1/18/2023 19:00 1/18/2023 19:15 0.25 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 7,986.0 7,986.0 1/18/2023 19:15 1/18/2023 20:15 1.00 INTRM2, DRILLOUT TRIP P TIH F/7986 to 8986' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 231K S/O 138K. Monitoring well Via Trip Tank 7,986.0 8,986.0 1/18/2023 20:15 1/18/2023 20:30 0.25 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 8,986.0 8,986.0 1/18/2023 20:30 1/18/2023 21:30 1.00 INTRM2, DRILLOUT TRIP P TIH F/ 8986' to 9986' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 242K S/O 130K. Monitoring well Via Trip Tank 8,986.0 9,986.0 1/18/2023 21:30 1/18/2023 21:45 0.25 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 9,986.0 9,986.0 1/18/2023 21:45 1/18/2023 22:45 1.00 INTRM2, DRILLOUT TRIP P TIH F/ 9986' to 10985' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 260K S/O 128K. Monitoring well Via Trip Tank 9,986.0 10,985.0 1/18/2023 22:45 1/18/2023 23:00 0.25 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 10,986.0 10,985.0 1/18/2023 23:00 1/19/2023 00:00 1.00 INTRM2, DRILLOUT TRIP P TIH F/10985'to 10766' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 270K S/O 125K. Monitoring well Via Trip Tank 10,985.0 10,766.0 1/19/2023 00:00 1/19/2023 02:15 2.25 INTRM2, DRILLOUT TRIP P TIH F/10766' to 11599' MD, W/ 5 7/8" Drill Pipe Singling in From Pipe Shed. P/U 290K S/O 120K. Monitoring well Via Trip Tank 10,766.0 11,599.0 1/19/2023 02:15 1/19/2023 02:30 0.25 INTRM2, DRILLOUT CIRC P Fill Drill Pipe Every 1000' Blow Down Top Drive. 11,599.0 11,599.0 1/19/2023 02:30 1/19/2023 06:30 4.00 INTRM2, DRILLOUT SLPC P R/U Slip and Cut Drill 42', 4.2 Wraps, Perform Derrick Inspection. Reset Block Height Limits 11,599.0 11,599.0 1/19/2023 06:30 1/19/2023 08:00 1.50 INTRM2, DRILLOUT RURD P Clean And Clear PS-21 Slips. Install Master Bushing. Change Out Elevators. Clean Clear Rig Floor. Mobilize 6 5/8" Thread Protectors 11,599.0 11,599.0 1/19/2023 08:00 1/19/2023 10:00 2.00 INTRM2, DRILLOUT PULD P L/D 7 Stands 6 5/8" Drill Pipe From Derrick. Via Mouse Hole. 11,599.0 11,599.0 1/19/2023 10:00 1/19/2023 10:15 0.25 INTRM2, DRILLOUT TRIP P M/U X/O F 5 7/8" x 6 5/8" Drill Pipe 11,599.0 11,602.0 1/19/2023 10:15 1/19/2023 11:30 1.25 INTRM2, DRILLOUT TRIP P TIH F/ 11599' to 12023' MD, W/ 6 5/8" Drill PipeFrom Derrick. P/U 300K S/O 107 K. Tag up on Cement. Monitoring well Via Trip Tank 11,602.0 12,023.0 1/19/2023 11:30 1/19/2023 12:00 0.50 INTRM2, DRILLOUT CIRC P M/U Top Drive, Stage Pumps up and Establish Paramenters @ 680=GPM 1700= PSI 40=RPM 30K=TQ 12,023.0 12,023.0 1/19/2023 12:00 1/19/2023 14:15 2.25 INTRM2, DRILLOUT WASH P Confirm Reamer Is Closed. Wash Down F/ 12023' T/ 12464' RPM = 70-100, TQ= 20-37K, Tag Float @ 12464' MD 12,023.0 12,464.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 38/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/19/2023 14:15 1/19/2023 16:15 2.00 INTRM2, DRILLOUT DRLG P Drill Out Plug/Float Collar F/ 12464' MD t/ 12470' MD GPM=700 PSI 1700 RPM=70-100 TQ=18-47K RTW= 213K WOB- 12-18K 12,464.0 12,470.0 1/19/2023 16:15 1/19/2023 18:00 1.75 INTRM2, DRILLOUT DRLG P Drill Cement F/ 12470' MD to 12513' MD GPM=702 PSI=1700 RPM=100 TQ 25-45K WOB- 16K P/U 305K S/O 125K 12,470.0 12,513.0 1/19/2023 18:00 1/19/2023 19:00 1.00 INTRM2, DRILLOUT DRLG P Drill Cement F/ 12513' MD to 12525' MD GPM 700 PSI 1700 RPM=100 TQ 25-45K WOB=8-9K P/U 305K S/O 125K RTW=205 12,513.0 12,525.0 1/19/2023 19:00 1/19/2023 20:45 1.75 INTRM2, DRILLOUT CIRC T Lost Prime On Mud Pumps, Blow Down Charging Pump Lines, While Reciprocate and Rotate Pipe RPM=20 GPM=100 PSI= 434, Move and Treat Contaminated Mud Establish Circulation W/ Charging Pumps Mud Was thick Due To Cement Contamination. 12,525.0 12,525.0 1/19/2023 20:45 1/20/2023 00:00 3.25 INTRM2, DRILLOUT DRLG P Drill Cement F/ 12525' MD to 12590' MD GPM 698 PSI=1675 RPM=80 TQ 20-44K WOB=10K P/U 308K S/O 150K RTW=200 12,525.0 12,590.0 1/20/2023 00:00 1/20/2023 03:00 3.00 INTRM2, DRILLOUT DRLG P Drill 13 5/8" Shoe F/12590' MD to 12593' MD GPM 698PSI=1675 RPM=80 TQ 20-44K WOB=10K P/U 308K S/O 150K RTW=200 12,590.0 12,593.0 1/20/2023 03:00 1/20/2023 04:30 1.50 INTRM2, DRILLOUT DRLG P Rat Hole F/12593' to 12607' MD GPM 698PSI=1675 RPM=80 TQ 20-44K WOB=10K P/U 308K S/O 150K RTW=200 12,593.0 12,607.0 1/20/2023 04:30 1/20/2023 05:15 0.75 INTRM2, DRILLOUT DDRL P Drill Interm #3 hole Section F/ 12607' to 12627' New Hole GPM 698PSI=1675 RPM=80 TQ 20-44K WOB=10K P/U 308K S/O 150K RTW=200 Work Through Shoe Three Times 12,607.0 12,627.0 1/20/2023 05:15 1/20/2023 07:45 2.50 INTRM2, DRILLOUT CIRC P Circulate and Condition Mud For FIT. GPM=697 PSI=1464 RPM=90 P/U 310 S/O 140K RTW= 204. Mud In and Out 10.9 PPG 12,627.0 12,627.0 1/20/2023 07:45 1/20/2023 08:30 0.75 INTRM2, DRILLOUT TRIP P Pull Up and Break Off @12597' MD 2 Jts of 6 5/8" Drill pipe in Mouse Hole. Monitor Well F/ 5 Min B/D Top-Drive. R/U 2" Pressure lines and Test Equipment. Purge Air from Lines. 12,627.0 12,597.0 1/20/2023 08:30 1/20/2023 09:30 1.00 INTRM2, DRILLOUT FIT P Close Annular, Perform FIT @ 4 SPM 20 GPM, Break Over @ 1100 PSi 58 Strokes Pumped Total. Shut In Monitor Pressure For 10/Min. Bleed 3 BBLS Back to Trip Tank. FIT EQ- 14.6 PPG 12,597.0 12,597.0 1/20/2023 09:30 1/20/2023 09:45 0.25 INTRM3, DRILL OWFF P Monitor well 15/Min Well Static 12,597.0 12,597.0 1/20/2023 09:45 1/20/2023 10:45 1.00 INTRM3, DRILL RURD P R/D FIT Equipment. B/D Choke and Kill Line. Make Double Back up to Stump in Rotary 12,597.0 12,597.0 1/20/2023 10:45 1/20/2023 11:30 0.75 INTRM3, DRILL CIRC P @ 12579' MD Circulate and Condition Mud and Obtain Parameters @ 140 SPM, 700 GPM, 1440 PSI, 50 RPM 31- 45 TQ, 395K P/U, 107K S/O, 207K ROT/W 12,597.0 12,579.0 1/20/2023 11:30 1/20/2023 12:00 0.50 INTRM3, DRILL SVRG P Service Rig, B/D Top drive Grease Wash Pipe. 12,579.0 12,579.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 39/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/20/2023 12:00 1/20/2023 12:15 0.25 INTRM3, DRILL TRIP P POOH on Elevators From 12597' to 12487' MD. Break Out And Drain Drill Pipe. 12,579.0 12,487.0 1/20/2023 12:15 1/20/2023 14:30 2.25 INTRM3, DRILL MPDA P PJSM Install MPD Bearing As per MPD Hand. Test MPD Bearing And Chokes 12,487.0 12,487.0 1/20/2023 14:30 1/20/2023 14:45 0.25 INTRM3, DRILL CIRC P Obtain SPR W/ MPD Bearing Installed 12,487.0 12,487.0 1/20/2023 14:45 1/20/2023 15:30 0.75 INTRM3, DRILL REAM P Wash And Ream From 12487' To 12627' MD @ 50 RPM, 32-42K TQ, 650 GPM, 1460 PSI MPD=200 PSI TRPM=1970 12,487.0 12,627.0 1/20/2023 15:30 1/20/2023 16:30 1.00 INTRM3, DRILL DDRL P Drill 12 1/4" Interm #3 Hole Section F/ 12627 tom 12639' WOB 18-20, GPM=700 PSI= 1677, TQ=21-51K, ECD=12.2 PPG, P/U 397K, S/O 107K, RTW=207K MPD= 550PSi 12,627.0 12,639.0 1/20/2023 16:30 1/20/2023 17:30 1.00 INTRM3, DRILL DDRL P P/U working Single F/ Pipe Shed. Increase Flow Rate T/1000=GPM, PSI=2860PSI, To Shear XM Reaqmer Pins. Cont Drill F/ 12639' to 12665' MD WOB=18-20, GPM=900, PSI=2400, RPM=80, TQ=22-51K, ECD=12.2 PPG 12,639.0 12,665.0 1/20/2023 17:30 1/20/2023 17:45 0.25 INTRM3, DRILL DHEQ P Pull F/ 12665' To 12655' MD. Index XM Reamer OPen By Lowering Pump Rate F/900=GPM 2520= PSI to 350=GPM, 760=PSI, Increase To 900=GPM, 2320=PSi TRPM W/ Reamer Close @ 900=GPM 2740 Open @ 900 GPM 2250 12,665.0 12,655.0 1/20/2023 17:45 1/20/2023 18:00 0.25 INTRM3, DRILL REAM P Ream F/ 12655' T/ 12665' MD @ 900- GPM 2320=PSI, 60=RPM, 30-45K TQ, 2-5K=WOB 12,655.0 12,665.0 1/20/2023 18:00 1/20/2023 19:30 1.50 INTRM3, DRILL DHEQ P Pull Up F/ 12665' To 12645' MD P/U 405K Pull T/ 415K Hold 10K Over Pull Against 13 5/8" Shoe W/ SLB Reamer AsPer Reamer Rep. 12,665.0 12,645.0 1/20/2023 19:30 1/20/2023 20:30 1.00 INTRM3, DRILL PULD P @ 12645' MD L/D Working Single P/U 400K. PJSM On Displacing Well W/11.0 PPG FWP Mud. 12,645.0 12,645.0 1/20/2023 20:30 1/20/2023 22:15 1.75 INTRM3, DRILL CIRC P @ 12645' MD Pump 60 BBLS (2 PPB Duo Vis) GPM=175 PSI=625 PSI, Flow=16%, RPM=15 TQ-41 RTW=198K, Chase W/ 11.0 PPG FWP @ GPM=900 PSI=2030 F/O= 47, RPM- 80, TQ=44, While Reaming Down F/ 12645' to 12665' MD. Maintain ECD=12.2 PPG. Observe Reduced Off Bottom TQ F/ 44-14K Once Mud Turn Corner At Shoe. 12,645.0 12,665.0 1/20/2023 22:15 1/20/2023 23:45 1.50 INTRM3, DRILL CIRC T Pump Cycles X5 w/ No Pressure Indicators Change For Open And Close XM reamer As Per SLB Rep.Due to Power Surge from Rig Causing Mud Pumps to Shut Down 12,665.0 12,665.0 1/20/2023 23:45 1/21/2023 00:00 0.25 INTRM3, DRILL DDRL P Drill 12 1/4" Interm #3 F/ 12665' to 12672' MD @ 900=GPM PSI=2000 80=RPM W/10-30=TQ 20 WOB 12,665.0 12,672.0 1/21/2023 00:00 1/21/2023 00:15 0.25 INTRM3, DRILL CIRC T Verify XM Reamer Is Indexed Open as Per SLB DD, Reamer REP Due To Power Surge On Rig, Causing Mud Pumps to Shut Down. 12,672.0 12,672.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 40/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/21/2023 00:15 1/21/2023 04:00 3.75 INTRM3, DRILL DDRL P Drill 12 1/4" Interm #3 Hole Section F/ 12672' To 12797' MD WOB 20K, GPM=950 PSI= 2250, TQ=20K, ECD=12.36 PPG, F/O 48%, P/U 397K, S/O 107K, RTW=198K MPD= 271 Out Slips 560 PSI in Slips ADT Hrs= 4.75 Bit/Jars Hrs= 4.75 12,672.0 12,797.0 1/21/2023 04:00 1/21/2023 04:30 0.50 INTRM3, DRILL DHEQ P @ 12794' Collect Parameters GPM=960 PSI-2300, RPM=30, TQ=8-10K P/U 236K S/O=169K ROT=195K Break Connection and Drop RFID Tags as Per Weatherford. 12,794.0 12,794.0 1/21/2023 04:30 1/21/2023 05:00 0.50 INTRM3, DRILL DHEQ P Perform 11 Pressure Cycles F/ 750-950 GPM T/ Locate RFID'S W/ Rotation RPM=30,TQ=9-10K 12,794.0 12,794.0 1/21/2023 05:00 1/21/2023 05:30 0.50 INTRM3, DRILL UREM P Ream Up F 12794' to 12781' MD @ GPM=950 PSI=-2275 RPM=80 TQ=16K, F/O=49% Stop Rotation, P/U into Shoe 12766' W/ 17K over Pull. T/ Verify RipTide Reamer Open Position. 12,794.0 12,766.0 1/21/2023 05:30 1/21/2023 06:15 0.75 INTRM3, DRILL UREM P Ream Down F/ 12766' to 12797' MD @ GPM=950/1300, PSI 2300/3530 RPM=80 TQ=14K, F/O 47%, @ 12785' MD Cycle Reamer T/ Verify TRPM & Pressures as PEr SLB & DD/Reamer Rep. 12,766.0 12,797.0 1/21/2023 06:15 1/21/2023 12:00 5.75 INTRM3, DRILL DDRL P Drill 12 1/4" Interm #3 Hole Section F/ 12797' to 13110' MD 5764' TVD WOB 15-25 K, GPM=250 PSI= 3313, RPM=140, TQ=23-25K, ECD=12.51 PPG, F/O 48%, P/U 247K, S/O 238K, RTW=209K MPD= 200 Out Slips 480 PSI in Slips ADT Hrs= 6.35 Bit/Jars Hrs= 8.52 Total BIT Hrs=8.52 12,797.0 13,110.0 1/21/2023 12:00 1/21/2023 12:15 0.25 INTRM3, DRILL CIRC T Power Surge Power Limit Cycled Mud Pumps & Indexing Reamer Open. Lower Flow rate To GPM=380 PSI-858, Pressure Up To GPM-1240, PSI=2390 To Index Reamer Closed. Verify W/ TRPM, Pressure. 13,110.0 13,110.0 1/21/2023 12:15 1/21/2023 18:00 5.75 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/13110' to 13573' MD 5892' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 25 K, GPM=1250 PSI= 3370, RPM=140, TQ=24-27K, ECD=12.51 PPG, F/O 48%, P/U 237K, S/O 238K, RTW=209K MPD= 200 Out Slips 480 PSI in Slips 13,110.0 13,573.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 41/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/21/2023 18:00 1/22/2023 00:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 13573' To 14041' MD 5976' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 25-30 K, GPM=1246 PSI= 3472, RPM=150, TQ=21-24K, Off Bottom TQ=11-16K, ECD=12.51 PPG, F/O 48%, P/U 244K, S/O 183K, RTW=210K MPD= 189 Out Slips 470 PSI in Slips. Obtain TQ and Drag Every 3x Stands. SIMOPS Cont. Processing 9 7/8" Casing Pipe Shed ADT HRS=3.98 Bit/Jar HRS= 16.50 SPR w/ MPD holding Back PSI SPR @ 13853' MD 5937' TVD MW 11.0PPG #1 MP 20 SPM 700/330 30SPM 720/310 #2 MP 20 SPM 710/330 30 SPM 720/310 No Losses F/ Last 24 Hrs 13,573.0 14,041.0 1/22/2023 00:00 1/22/2023 02:45 2.75 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 14041'To 14227'MD 6019' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 25-30 K, GPM=1246 PSI= 3472, RPM=150, TQ=21-24K, Off Bottom TQ=11-16K, ECD=12.51 PPG, F/O 48%, P/U 244K, S/O 183K, RTW=210K MPD= 189 Out Slips 470 PSI in Slips. Obtain TQ and Drag Every 3x Stands. 14,041.0 14,227.0 1/22/2023 02:45 1/22/2023 03:15 0.50 INTRM3, DRILL CIRC P @ 14227'MD 6019' TVD Observe -83 BBLS loss over 20 Min W/ Drilling Ahead. Verified No Surface Equipment Leaks, Reduced MPD PSI F/ 170 to 110 PSI and Losses Stopped. Mixing 100 BBLS 45 PPB LCM pill as per LCM Decision and Use for Back Ground LCM. 14,227.0 14,227.0 1/22/2023 03:15 1/22/2023 06:00 2.75 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 14227' to14503' MD 6048' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 25-30 K, GPM=1250 PSI= 3490, RPM=150, TQ=21-28K, Off Bottom TQ=11-16K, ECD=12.51 PPG, F/O 48%, P/U 244K, S/O 183K, RTW=210K MPD= 189 Out Slips 470 PSI in Slips. Obtain TQ and Drag Every 3x Stands. 14,227.0 14,503.0 1/22/2023 06:00 1/22/2023 10:30 4.50 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 14503' To 14797' MD 6143' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 30 K, GPM=1250 PSI= 3415, RPM=150, TQ=21-28K, Off Bottom TQ=11-16K, ECD=12.27 PPG, F/O 48%, P/U 244K, S/O 183K, RTW=210K MPD= 122 Out Slips 400 PSI in Slips. Obtain TQ and Drag Every 3x Stands. Encounterede IntermittentLosses Starting @ 14562' MD 180-30 BPH 14,503.0 14,797.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 42/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/22/2023 10:30 1/22/2023 11:00 0.50 INTRM3, DRILL CIRC P @ 14797' MD Pump 141 BBLS 45 PPB LCM @ 40=SPM, 200=GPM,560=PSI. Once Pill Is Out Of Bit, Increase MPD Pressure T/12.5 PPG ECD Squeeze LCM Pill Into Formation. Losses after Squeezing Pill Went From 180 PPB T/ 10-30 BPH 14,797.0 14,797.0 1/22/2023 11:00 1/22/2023 11:15 0.25 INTRM3, DRILL CIRC P XM Reamer Indexed Open While Pumping LCM Pill. Index XM Reamer Closed By Lowering Pump Rate T/ 380 GPM Then Uo T/ 1250 GPM. Confirm Closed W/ Torque, Pump Pressure & TRPM. 14,797.0 14,797.0 1/22/2023 11:15 1/22/2023 12:00 0.75 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 14797' MD to 14876' 6153' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 30 K, GPM=1250 PSI= 3415, RPM=150, TQ=28-30K, Off Bottom TQ=11-16K, ECD=12.27 PPG, F/O 48%, P/U 275K, S/O 186K, RTW=200K MPD= 207 Out Slips 490 PSI in Slips. Obtain TQ and Drag Every 3x Stands. ADt=7.47 Total Bit Hrs= 27.73 Total Jar Hrs=27.73 Magnets Last 12 hrs= 5 lbs after shakers, 10 lbs before shakers 10LBS Total Total Losses Last 12 Hrs,=833 BBLS 14,797.0 14,876.0 1/22/2023 12:00 1/22/2023 18:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 14876' to 15344' MD 6250' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 30 K, GPM=1250 PSI= 3595, RPM=150, TQ=28-30K, Off Bottom TQ=11-16K, ECD=12.44 PPG, F/O 48%, P/U 268K, S/O 190K, RTW=218K MPD= 190 Out Slips 425 PSI in Slips. Obtain TQ and Drag Every 3x STands Cont. Encounter Intermittent Losses 10-30 BPH. SIMOPS L/D 6 5/8" DP Offline. 14,876.0 15,344.0 1/22/2023 18:00 1/22/2023 20:15 2.25 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/15344' to 15519' MD 6250' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 30 K, GPM=1250 PSI= 3595, RPM=150, TQ=28-30K, Off Bottom TQ=11-16K, ECD=12.25 PPG, F/O 48%, P/U 276K, S/O 185K, RTW=220K MPD= 190 Out Slips 425 PSI in Slips.. 15,344.0 15,519.0 1/22/2023 20:15 1/22/2023 21:15 1.00 INTRM3, DRILL CIRC P @ 15490'-15519' MD Oserve 134 BBL Loss Pump 80 BBL 45 PPB Pill @ GPM=150, PSI=500,F/O 3% Once Pill Was Out Of Bit, Increase MPD Pressure T/ 12.3 PPG ECD and Squeeze LCM into Formation. Index XM Reamer Back To Close After Pumping Pill. 15,519.0 15,519.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 43/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/22/2023 21:15 1/23/2023 00:00 2.75 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 15519' To 15730' MD 6331' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 28 K, GPM=1250 PSI= 3340, RPM=150, TQ=28K, Off Bottom TQ=12K, ECD=12.32 PPG, F/O 48%, P/U 276K, S/O 185K, RTW=220K MPD= 178 PSI Out Slips 400 PSI in Slips.. SPR @ 15713' MD 6323' TVD MW 11.0 PPG @ 23:30 @1 MP 20 SPM 520/320 30 SPM 560/3002 2 MP 30 SPM 520/320 30 SPM 550/320 ADT 3.39 Total Bit Hrs= 31.12Total Jar Hrs = 31.12 Fluid Losses F/ 24 Hrs=1198 BBLS Magnet Weight For Each 12 Hrs 12/6.5 Total 24 Hrs 18.5 Hrs 15,519.0 15,730.0 1/23/2023 00:00 1/23/2023 06:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 15730' to 16207' MD 6422' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 28 K, GPM=1250 PSI= 3340, RPM=150, TQ=28K, Off Bottom TQ=12K, ECD=12.32 PPG, F/O 48%, P/U 284K, S/O 192K, RTW=227K MPD= 178 PSI Out Slips 400 PSI in Slips.. 15,730.0 16,207.0 1/23/2023 06:00 1/23/2023 12:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 16207' to 16725' MD 6534' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 28 K, GPM=1250 PSI= 3750, RPM=170, TQ=38K, Off Bottom TQ=12K, ECD=12.48 PPG, F/O 48%, P/U 298K, S/O 182K, RTW=229K MPD= 178 PSI Out Slips 400 PSI in Slips.. TQ and Drag Values Every 3x Stands 12,207.0 16,725.0 1/23/2023 12:00 1/23/2023 18:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/16725' to 17070' MD 6616' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 24 K, GPM=1250 PSI= 3780, RPM=170, TQ=34K, Off Bottom TQ=12K, ECD=12.55 PPG, F/O 48%, P/U 325K, S/O 179K, RTW=232K MPD= 178 PSI Out Slips 400 PSI in Slips.. TQ and Drag Values Every 3x Stands Pumped 40 BBL, LCM PIll 45 PPB @ 17015' & 40 BBL low Vis LCM Pill@ 17051' SIMOPS= L/D 6 5/8" Drill Pipe Offline. 16,725.0 17,070.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 44/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/23/2023 18:00 1/24/2023 00:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 17070' to 17576' MD 6711' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 18 K, GPM=1250 PSI= 3860, RPM=170, TQ=32K, Off Bottom TQ=12K, ECD=12.53 PPG, F/O 48%, P/U 356K, S/O 184K, RTW=237K MPD= 220 PSI Out Slips 460 PSI in Slips.. TQ and Drag Values Every other Stands SIMOPS= L/D 6 5/8" Drill Pipe Offline. ADT 7.35, Bit Hrs=46.45, Jar Hrs= 46.45 Total Drill @4 Hrs=15.83 SPR @ 17106' MD 6610' TVD W/11. PPG #1 20 SPM 580/360 30 SPM 622/345 #2 20 SPM 580/360 30 SPM 632/345 Magnet Weight 14 LBS Mud Losses 12Hrs 0 , Losses 24Hrs 111 17,070.0 17,576.0 1/24/2023 00:00 1/24/2023 06:00 6.00 INTRM3, DRILL DDRL P Drill 12 1/4"x 13 1/2" Interm #3 Hole Section F/ 17576' to 18016' MD 6883' TVD W/ Rip-Tide Reamer Open, XM Reamer Closed. WOB 18 K, GPM=1250 PSI= 3860, RPM=170, TQ=32K, Off Bottom TQ=12K, ECD=12.53 PPG, F/O 48%, P/U 356K, S/O 184K, RTW=237K MPD= 220 PSI Out Slips 460 PSI in Slips.. TQ and Drag Values Every other Stands SIMOPS= L/D 6 5/8" Drill Pipe Offline. @ 17859' MD Dump 500 BBLS of 11.0 PPG to Tank Farm, Replace With Fresh 11.0 PPG Black Product Treated 11.0 FWP Mud 17,576.0 18,016.0 1/24/2023 06:00 1/24/2023 11:00 5.00 INTRM3, DRILL DDRL P DRILL 12-1/4" X 13-1/2" Interm #3 Hole W/ Rip-Tide Reamer F/ 18,016‘ MD - T/ 18,411‘ MD, 6,883‘ TVD, WOB: 35K, GPM: 1245, PSI: 4060, RPM: 170, TQ: 43K, ECD: 12.48PPG, PUW: 385K, SOW: 175K, RTW: 248K. MPD Pressure 473/203 PSI. 18,016.0 18,411.0 1/24/2023 11:00 1/24/2023 11:15 0.25 INTRM3, DRILL FIT P @ 18,411' MD, Clear Cutting F/ BHA & Isolate Active T/ Pit #5 For The Dynamic Fit. 18,411.0 18,411.0 1/24/2023 11:15 1/24/2023 12:00 0.75 INTRM3, DRILL FIT P Perform Dynamic Fit T/ 12.93 PPG ECD W/ MPD @ 950 GPM, 2720 PSI, 20 RPM, 31K TQ. 18 BBL Total Losses. ADT F/ Tour 7.83 Hrs Total Bit/Jar Hrs 54.28 18 BBLS Loss For Tour 18,411.0 18,411.0 1/24/2023 12:00 1/24/2023 13:30 1.50 INTRM3, DRILL DDRL P Drill 12-1/4" X 13-1/2" Interm #3 Hole W/ Rip-Tide Reamer F/ 18,411‘ MD - T/ 18,458‘ MD, 6893‘ TVD, WOB: 35K, GPM: 1250, PSI: 4060, RPM: 170, TQ: 43K, ECD: 12.48PPG, PUW: 385K, SOW: 175K, RTW: 248K. Slow Rop T/ 75 FPH While Treating The Mud System With Black Product For the HRZ. 18,411.0 18,458.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 45/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/24/2023 13:30 1/24/2023 14:30 1.00 INTRM3, DRILL CIRC P @ 18,458' MD Circ & Recip F/ 18,458' MD T/ 18,440' MD @ 1245 GPM, 4200 PSI, 100 RPM, 37 TQ, MPD = 210PSI, ECD = 12.51. Cont. Treat Mud System With Black Product 18,458.0 18,458.0 1/24/2023 14:30 1/24/2023 15:30 1.00 INTRM3, DRILL OTHR P @ 18,440' MD, Drop 8 RFID Tags to Close Rip-Tide Reamer. Pressure cycle Reamer F/ 1245 GPM & 4180 PSI T/ 1050 GPM & 3260 PSI While ROT @ 30 RPM & 36K TQ. 18,440.0 18,440.0 1/24/2023 15:30 1/24/2023 16:30 1.00 INTRM3, DRILL OTHR P Drop 8 More RFID Tags To Close Rip- Tide Reamer. Pressure Cycle Reamer F/ 1245 GPM & 4180 PSI - T/ 1050 GPM & 3260 PSI While ROT @ 30 RPM & 36K TQ. 18,440.0 18,440.0 1/24/2023 16:30 1/24/2023 16:45 0.25 INTRM3, DRILL REAM P Ream Down F/ 18,440 MD - T/ 18,458 @ 1250 GPM, 4200 PSI. 100 RPM, 35K TQ, 12.49 ECD. 18,440.0 18,458.0 1/24/2023 16:45 1/24/2023 17:15 0.50 INTRM3, DRILL DDRL P Drill 12-1/4" Interm #3 Hole W/ Rip-Tide Reamer Closed F/ 18,458‘ MD - T/ 18,468‘ MD, 6898‘ TVD, WOB: 15K, GPM: 1250, PSI: 4220, RPM: 170, TQ: 44K, ECD: 12.5PPG. Obtain Final P/U & S/O WT. PUW: 400K, SOW: 170K, RTW: 250K. 18,458.0 18,468.0 1/24/2023 17:15 1/24/2023 17:45 0.50 INTRM3, TRIPCAS BKRM P BROOH F/ 18,468' MD - T/ 18,310' MD @ 100 RPM, 40K TQ, 1245 GPM, 4225 PSI, MPD = 230 PSI, ECD = 12.5. 18,468.0 18,310.0 1/24/2023 17:45 1/24/2023 18:30 0.75 INTRM3, TRIPCAS OTHR P @ 18,313' MD, 6,859'TVD,Index XM Reamer, Open GPM:1240, PSI:3930 W/ Good Pressure Drop Indication, PUW:429K, SOW:160K, RTW:230K. Slack Off W/out Rotary T/ 18,320' Set Down 15K (145K) Good Verification XM Reamer Is Open & Rip Tide Reamer Is Closed. 18,310.0 18,310.0 1/24/2023 18:30 1/24/2023 23:30 5.00 INTRM3, TRIPCAS REAM P P/U T/ 18,317' MD, Obtain Parameters, Ream 12-1/4" Rat Hole T/ 13-1/2: Down T/ 18,412' W/ XM Reamer Open RPM=60-100, TQ OFF-45K, TQ ON: 45- 56K, GPM:1240, PSI ON:3903, PSI OFF:3977, FLOW:41%, ECD:12.52PPG, MPD IN SLIPS:240 PSI, OUT SLIPS:475PSI.SIMOP'S Stage / Load Mud Pits, W/ 15.0PPG FWP Spike Fluid As Per CPAI Mud Engineer 18,317.0 18,412.0 1/24/2023 23:30 1/25/2023 00:00 0.50 INTRM3, TRIPCAS REAM P P/U T/ 18,407' MD After X7 Attempts T/ Ream Down. Index XM Reamer Closed To Attempt to Ream Down to Verify reamer Is Hanging Up in Formation. Could Not Ream Pass 18,412' W/ XM Reamer Closed . ADT F/ Tour = 4.81 HRS Total Bit / Jar Hrs = 59.09 Hrs Losses F/ Tour = 0 Losses F/ Last 24 HR = 18 BBLS Magnet Weight = 9.5 Before Shakers 12 After Shakers. Total = 21.5 LBS 18,412.0 18,407.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 46/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/25/2023 00:00 1/25/2023 01:00 1.00 INTRM3, TRIPCAS BKRM P BROOH w/ XM Reamer Closed F/ 18412' MD to 18343' W/ GPM-1240, PSI=4130, RPM=100, TQ=48-57K F/O 41% ECD=12.53 PPG Weight up using 15.0PPG Spike Fluid a Per SLB Mud Engineer, P/U=429K S/o=160K, RTW=238K MaintAIN 12.5 ppg ECD W/ MPD 18,412.0 18,343.0 1/25/2023 01:00 1/25/2023 02:15 1.25 INTRM3, TRIPCAS BKRM P @ 18343' MD 6869' TVD Work Pipe w/ 25-30K Overpull, RTW 237K GPM=1240, PSI=4130, F/O 41%, TQ 48 -60K, (No Sign of Packoffs) 18,343.0 18,343.0 1/25/2023 02:15 1/25/2023 02:30 0.25 INTRM3, TRIPCAS BKRM P BROOH w/ XM Reamer Closed F/ 18343' MD to 18222' W/ GPM-1240, PSI=4130, RPM=100, TQ=48-57K F/O 41% ECD=12.53 PPG Weight up using 15.0PPG Spike Fluid a Per SLB Mud Engineer, P/U=429K S/o=160K, RTW=238K Maintain 12.5 ppg ECD W/ MPD 18,343.0 18,222.0 1/25/2023 02:30 1/25/2023 02:45 0.25 INTRM3, TRIPCAS OTHR P @ 18222' MD Index XM Reamer Open @ GPM=405, PSI=915, W/ Good Indication Of Reamer Open As Per SLM Reamer Rep. 18,222.0 18,222.0 1/25/2023 02:45 1/25/2023 06:00 3.25 INTRM3, TRIPCAS REAM P Ream Down w/ XM Reamer Open F/ 18222' MD to 18468' W/ GPM-1240, PSI=4130, RPM=100, TQ=48-57K F/O 41% ECD=12.53 PPG Weight up using 15.0PPG Spike Fluid a Per SLB Mud Engineer, P/U=429K S/o=160K, RTW=238K Maintain12.5 ppg ECD W/ MPD, P/U 5 7/8" Offline from Pipe Shed and Rack Back in Derrick 18,222.0 18,468.0 1/25/2023 06:00 1/25/2023 06:15 0.25 INTRM3, TRIPCAS OWFF P @ 18467' MD Index XM Reamer Closed By Lowering Flow Rate T/ GPM=407, PSI=882, Then T/GPM=1240 PSI=4272. Confirm Reamer Is Closed With PSi increase and TRPM Increase 18,468.0 18,467.0 1/25/2023 06:15 1/25/2023 08:15 2.00 INTRM3, TRIPCAS BKRM P Grease Wash Pipe, BROOH F/ 18467' to 18222' MD @ RPM=30, TQ=39K, GPM=1240 PSI=4270. FPM=3.5 BROOH W/ RTW 235K 18,467.0 18,222.0 1/25/2023 08:15 1/25/2023 10:30 2.25 INTRM3, TRIPCAS BKRM P BROOH F/ 18222' to 17850' MD RPM=125, TQ=46, GPM=1240, PSI=4200, 8 fpm BROOH, RTW=230K, ECD=12.61, MPD=100 PSI 18,222.0 17,850.0 1/25/2023 10:30 1/25/2023 11:15 0.75 INTRM3, TRIPCAS OWFF P @ 17850' MD B/D Top-Drive Monitor Well F/ 30 Min Through MPD, While Rotating RPM=30 TQ=36 ( Well Static) Index Reamer to Closed, Reamer Was Opened F/ Bleed Off at MPD. 17,850.0 17,850.0 1/25/2023 11:15 1/25/2023 12:00 0.75 INTRM3, TRIPCAS BKRM P BROOH F/ 17850' to 17690 MD RPM=150, TQ=46, GPM=1240, PSI=4250, 8 fpm BROOH, RTW=230K, ECD=12.75, MPD=73 PSI Magnets=Flowline 3 lbs, Shakers 8 lbs 17,850.0 17,690.0 1/25/2023 12:00 1/25/2023 14:30 2.50 INTRM3, TRIPCAS BKRM P BROOH F/17690' To 17278' MD RPM=150, TQ=46, GPM=1240, PSI=4250, 8 fpm BROOH, RTW=230K, ECD=12.75, MPD=73 PSI Encountered 150PSi Pressure Increase & 8K increase In TQ @ 17401' MD 17,690.0 17,278.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 47/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/25/2023 14:30 1/25/2023 16:00 1.50 INTRM3, TRIPCAS CIRC P Circulate B/U and Work Pipe F/ 17278' To 17203' MD, RPM=150 TQ=55K GPM=1240, PSI=4160, ECD=12.81, MPD=101 PSI 17,278.0 17,203.0 1/25/2023 16:00 1/25/2023 18:00 2.00 INTRM3, TRIPCAS BKRM P BROOH F/17203' to 16915' MD RPM=150, TQ=46, GPM=1240, PSI=4250, 3 fpm BROOH, RTW=220K, ECD=12.81, MPD=101 PSI 17,203.0 16,915.0 1/25/2023 18:00 1/26/2023 00:00 6.00 INTRM3, TRIPCAS BKRM P BROOH F/16915' to 16267' MD RPM=150, TQ=46, GPM=1240, PSI=4150, 3 fpm BROOH, RTW=227K, ECD=12.85, MPD=101 PSI @ 16827' MD 6556' TVD Collected TQ/Drag For Up Coming Liner Run. P/U=444 S/O=138 RTW=235K TQ=52/35 Magnet Weight F/ Tour 8 LBS Total Losses F/ 24 Hrs to Formation 0 BBLS 16,915.0 16,267.0 1/26/2023 00:00 1/26/2023 01:15 1.25 INTRM3, TRIPCAS CIRC P Circulate B/U and Work Pipe F/ 16267' to 16174' MD, RPM=150 TQ=42-46K GPM=1240, PSI=4180, ECD=12.66, MPD=101 PSI 16,267.0 16,174.0 1/26/2023 01:15 1/26/2023 06:00 4.75 INTRM3, TRIPCAS BKRM P BROOH F/16174' to 15565' MD RPM=150, TQ=46, GPM=1240, PSI=4150, 3 fpm BROOH, RTW=227K, ECD=12.66, MPD=101 PSI Start 800 bbl Dump and Dilution In Pits @ 0430 Hrs XM Reamer indexed open @ 16734',16360',16081',15988', After Connections. Indexed Back To Closed each time. SIMOP= P/U 17 Stands 5 7/8" Drill Pipe Rack Back In Derrick. 16,174.0 15,565.0 1/26/2023 06:00 1/26/2023 12:00 6.00 INTRM3, TRIPCAS BKRM P Cont. BROOH F/ 15565' to 14650' MD GPM=1240, PSI=4050, RPM=130, TQ=38-45, ECD=12.69, MPD=88/360 PSI RTW=230K Obtain Torque And Drag Values @ 15448' MD P/U=380K, S/O=151K RTW=235K 15,565.0 14,650.0 1/26/2023 12:00 1/26/2023 16:00 4.00 INTRM3, TRIPCAS BKRM P Cont. BROOH F/14650' to 14007' MD GPM=1240, PSI=4050, RPM=130, TQ=38-45, ECD=12.69, MPD=88/360 PSI P/U=380K, S/O=151K RTW=238K 14,650.0 14,007.0 1/26/2023 16:00 1/26/2023 17:15 1.25 INTRM3, TRIPCAS CIRC P @ 14007' MD Circulate B/U and Work Pipe Up T/13944' MD @ GPM=1250, PSI=4126, RPM=130TQ=35 14,007.0 13,944.0 1/26/2023 17:15 1/26/2023 18:30 1.25 INTRM3, TRIPCAS BKRM P Cont. BROOH F/13944' to 13698' MD GPM=1240, PSI=4050, RPM=130, TQ=38-45, ECD=12.69, MPD=88/360 PSI P/U=380K, S/O=151K RTW=210K 13,944.0 13,698.0 1/26/2023 18:30 1/26/2023 18:45 0.25 INTRM3, TRIPCAS CIRC P @ 13698' MD Encounter Flow Restrictions W/ 100 PSI Increase F/ 4100 psi to 4200 PSI @ GPM=1250. Lowered Flow Rate To GPM=1000, PSI= 3200 Lowered String 12' top 13674' MD. Then We had Complete Losses. 13,698.0 13,674.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 48/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/26/2023 18:45 1/26/2023 21:00 2.25 INTRM3, TRIPCAS CIRC T Pump 40 BBLS LCM Pill @ GPM-400 PSI=718, & Work Pipe Up T/ 13665' at RPM=20 TQ=20K RTW=210 W/ No Returns, Ream Pipe Down to 13758' W/ Partial Return, Shut Down Pumping. B/D Top-Drive While Making Call To supervisor's 13,674.0 13,758.0 1/26/2023 21:00 1/26/2023 23:00 2.00 INTRM3, TRIPCAS STRP T Strip In Hole on Elevators W/ MPD F/ 13758' To 14875' MD P/U=305, S/O=165K, MPD=170 PSI In Slips=91 PSi ECD=12.0 13,758.0 14,875.0 1/26/2023 23:00 1/27/2023 00:00 1.00 INTRM3, TRIPCAS CIRC T @ 14879' to 14786' MD Work Pipe W/ No Rotation While Pumping 150 BBL 45 PPB LCM Pill, Stage Flow Rate While Monitoring losses F/ GPM=125-300, PSI=624,F/O 2%-13% SIMOPS - Fill pits with 11.5PPG FWP From Tank Farm. Losses for the Last 24 Hrs 1286 BBLS 14,875.0 14,786.0 1/27/2023 00:00 1/27/2023 01:30 1.50 INTRM3, TRIPCAS CIRC T @14879'-14786' MD Work Pipe W/ No Rotation, Cont. T/ Monitor Losses With Flow Rate GPM=300 PSI=624 Flow 2% to 13% P/U=305 S/O 165K Squeezed 77 BBls LCM W/ MPD @ Est. 12.2 PPG Fill Pits W/ 11.5 PPG FWP From Tank Farm 14,786.0 14,876.0 1/27/2023 01:30 1/27/2023 03:30 2.00 INTRM3, TRIPCAS STRP T @ 14875' MD B/D Top-Drive, Strip In Hole W/ MPD=170 PSI, To 15621' MD P/U=305, S/O=90 String Speed 720 FPH 14,876.0 15,621.0 1/27/2023 03:30 1/27/2023 05:45 2.25 INTRM3, TRIPCAS CIRC T @ 15621'MD Pump 150 BBLS 45 PPB LCM Pill @ GPM=175 PSI=420 Squeeze LCM into Formation W/ MPD Squeezed in 110 BBLS 15,621.0 15,621.0 1/27/2023 05:45 1/27/2023 09:00 3.25 INTRM3, TRIPCAS CIRC T @15,621 MD Stage up the flow rate from 50gpm to 1,200gpm. GPM=1,000 PSI=2,880 ROT=50rpm 12.3ppge observed losses at 1,200gpm 12.24ppge no losses observed 1,150gpm 15,621.0 15,621.0 1/27/2023 09:00 1/27/2023 11:00 2.00 INTRM3, TRIPCAS CIRC T Circulate Bottoms up. Large amount of LCM material over shakers. GPM=1,000 PSI=2,885 ROT=50rpm Tq=30k/lbs No Losses 15,621.0 15,621.0 1/27/2023 11:00 1/27/2023 13:30 2.50 INTRM3, TRIPCAS CIRC T Pump 147bbls of 45ppb LCM Pill. Chase at 1,000gpm for 3,200stks. Slow to 600gpm for Directional Tools. Chase pill for total 3,595stks to spot above potential loss zone at 15,410'. Shut down and apply MPD pressure staging up from 210psi to 360psi in 30psi increments. Squeezed total of 147bbls away. 15,621.0 15,621.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 49/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/27/2023 13:30 1/27/2023 18:00 4.50 INTRM3, TRIPCAS CIRC T CBU 15,621' to 15,718' Checking for potential LCM bridge/obstruction and clearing well bore of remaining LCM. Work rate and back pressure up to check for losses. 12.33ppge no losses 1,000gpm 53psi MPD back pressure. 12.5ppge 60bph losses at 1,100gpm 110psi MPD back pressure ROT=50 TQ=35k 15,621.0 15,718.0 1/27/2023 18:00 1/27/2023 21:00 3.00 INTRM3, TRIPCAS CIRC T Pump 147bbls of 45 ppb LCM Pill. Chase with 800 GPM @ 3200 STKS Slow to 600 GPM for Dierectional Tools Chase Pill W/ 3595 STKS to spot over Loss Zone, Increase MPD pressure to 220 PSI= 12.44 PPGE. Start pumping into Loss zone. 12.44 PPGE 800 GPM 200=MPH 45 BPH Losses 12.32 PPGE 800 GPM 150= MPD 5 BPH Losses 12.32 PPGE 1000 GPM 118= MPD 5 BPH Losses ROT=30 TQ=35k 15,621.0 15,718.0 1/27/2023 21:00 1/28/2023 00:00 3.00 INTRM3, TRIPCAS BKRM T BROOH / 15718' to 15344' MD GPM=955 PSI=2550, F/O 32% RPM=50 -70, TQ=29-35K ECD-12.11 MPD=68 PSI RTW=218K, SIMOPS, Build 150 BBLS 45 PPB LCM Pill Monitoring Losses VIA Gain/Loss Note: #2 Mud Lost it Bus Board that Sync Pumps and Charging pumps together. Electrician came out to rig Changed Bus board out. Pumping at 955 GPM 15,718.0 15,344.0 1/28/2023 00:00 1/28/2023 06:00 6.00 INTRM3, TRIPCAS BKRM T BROOH / 15344' to 14450' MD GPM=955/1000 PSI=2550/3000, F/O 32% RPM=50-70, TQ=29-35K ECD- 12.11 MPD=68 PSI RTW=218K, SIMOPS, Build 150 BBLS 45 PPB LCM Pill Monitoring Losses VIA Gain/Loss Note: Cont. #2 Mud Lost it Bus Board that Sync Pumps and Charging pumps together. While Electrician Changed Bus board out. Pumping at 955 GPM BROOH. #2 Pump Back online at 03:30hrs. Stage pumps up to 1000 GPM. 15,344.0 14,450.0 1/28/2023 06:00 1/28/2023 12:00 6.00 INTRM3, TRIPCAS BKRM P BROOH /14450' to13561' MD GPM=1000 PSI=2571, F/O 35% RPM=100, TQ=36K MPD=32 PSI RTW=218K, MPD maintain 12.16 ECD Begin 800 BBL Dump and Dilute Monitoring Losses VIA Gain/Loss 14,450.0 13,561.0 1/28/2023 12:00 1/28/2023 18:00 6.00 INTRM3, TRIPCAS BKRM P BROOH /13561' to 13388' MD GPM=1000 PSI=2568, F/O 35% RPM=100, TQ=31K MPD=32 PSI RTW=205K, MPD maintain 12.16 ECD Monitoring Losses VIA Gain/Loss 13,561.0 13,388.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 50/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/28/2023 18:00 1/29/2023 00:00 6.00 INTRM3, TRIPCAS BKRM P BROOH /13388' to 13205' MD GPM=1000 PSI=2568, F/O 35% RPM=100, TQ=30-44K MPD=32 PSI RTW=205K, MPD maintain 12.18 ECD Monitoring Losses VIA Gain/Loss Magnet Weight F/ 24 Hours 10 lbs Total Losses T/ Formation 24 Hours 132 BBLS 13,388.0 13,205.0 1/29/2023 00:00 1/29/2023 06:00 6.00 INTRM3, TRIPCAS BKRM P BROOH / 13205' to13100' MD GPM=1000 PSI=2568, F/O 35% RPM=100, TQ=30-44K MPD=32 PSI RTW=205K, MPD maintain 12.18 ECD Monitoring Losses VIA Gain/Loss 13,205.0 13,100.0 1/29/2023 06:00 1/29/2023 10:00 4.00 INTRM3, TRIPCAS BKRM P BROOH /13100' to 12543' MD GPM=1000 PSI=2565, F/O 35% RPM=100, TQ=20-24K MPD=32 PSI RTW=203K, MPD maintain 12.10 ECD Slow To RPM=40 GPM 400 While Pulling onto Shoe. Monitoring Losses VIA Gain/Loss 13,100.0 12,543.0 1/29/2023 10:00 1/29/2023 14:00 4.00 INTRM3, TRIPCAS CIRC P Circulate/Recip F/ 12543' to 12587' GPM=125 PSI=3747, RPM=130, TQ=23K, F/O 39%, ECD=12.20. Pump 150 BBL Nut Plug Sweep, Circulate until Shaker are Clean, 6700 total Strokes Pumped 12,543.0 12,587.0 1/29/2023 14:00 1/29/2023 14:30 0.50 INTRM3, TRIPCAS OWFF P OWFF, Blow Down Top-Drive 12,587.0 12,587.0 1/29/2023 14:30 1/29/2023 16:15 1.75 INTRM3, TRIPCAS SMPD P SOOH f/ 12587' to 11645' MD P/U 232K, S/O 175K, MPD Hold 260 psi 12,587.0 11,645.0 1/29/2023 16:15 1/29/2023 18:00 1.75 INTRM3, TRIPCAS MPDA P PJSM Remove 6 5/8" MPD Bearing and Bearing as Per SOP 11,645.0 11,645.0 1/29/2023 18:00 1/30/2023 00:00 6.00 INTRM3, TRIPCAS SMPD P SOOH W/ 5 7/8" Drill Pipe Back in Derrick F/ 11645' to 7906' MD P/U=215 S/O=153, Monitor Displacement Via Isolated Pit #5 MPD Holding 360 PSI, Drop 3.5" Rabbit W/ 100' wire tail. 11,645.0 7,906.0 1/30/2023 00:00 1/30/2023 06:00 6.00 INTRM3, TRIPCAS SMPD P SOOH racking back 5 7/8" DP f/7,906' to 624'. Maintain 12.2 ppg EMW. Monitor hole fill via pit #5. 7,906.0 624.0 1/30/2023 06:00 1/30/2023 06:15 0.25 INTRM3, TRIPCAS OWFF P OWFF 15 min (static) 624.0 624.0 1/30/2023 06:15 1/30/2023 06:30 0.25 INTRM3, TRIPCAS MPDA P Pull 5-7/8" RCD bearing and rack back on stand in derrick. 624.0 624.0 1/30/2023 06:30 1/30/2023 13:00 6.50 INTRM3, TRIPCAS BHAH P Cont. to POOH while L/D BHA. Bit Grade: 3-2-BT-A-X-2-LT-TD, XM Reamer: 1-1-WT-A-X-I-NO-TD, RipTide Reamer: 1-2-WT-G-X-I-NO-TD. Clean and clear floor of BHA tools and equipment. WFT RipTide Reamer had 2 Retainer pins missing for hinge pins. 1 was recovered on top of the cutter block void packed in clay. 2nd one was not found and presumed in the hole. (1.2" OD / 1.93" Long) 624.0 0.0 1/30/2023 13:00 1/30/2023 13:45 0.75 INTRM3, TRIPCAS WWWH P M/U stack washer and flush BOPE stack. 0.0 0.0 1/30/2023 13:45 1/30/2023 16:00 2.25 INTRM3, CASING RURD P C/O upper pipe rams to 9-7/8" full body. SIMOPS - C/O saver sub to VX-57 and replace IBOP actuator on top drive. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 51/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/30/2023 16:00 1/30/2023 17:15 1.25 INTRM3, CASING RURD P M/U wear ring running tool on 9-7/8" test joint and pull wear ring. M/U test plug and set same. R/U to test BOPE's. Flood lines and purge air from system. 0.0 0.0 1/30/2023 17:15 1/30/2023 17:45 0.50 INTRM3, CASING BOPE P Test upper rams w/9-7/8" test joint 250 psi 5 min / 4000 psi 10 min. 0.0 0.0 1/30/2023 17:45 1/30/2023 19:30 1.75 INTRM3, CASING RURD P R/D testing equipment and blow down lines. Remove test plug and set 12.43" ID wear ring. 0.0 0.0 1/30/2023 19:30 1/30/2023 22:00 2.50 INTRM3, CASING RURD P Stage 9-7/8" liner running tools and equipment at bottom of beaver slide. Clean and clear rig floor. SIMOPS - C/O air boot on bell nipple. 0.0 0.0 1/30/2023 22:00 1/31/2023 00:00 2.00 INTRM3, CASING RURD P Mobilize Volant, bale extensions, slips, PS-21 inserts to rig floor. 0.0 0.0 1/31/2023 00:00 1/31/2023 01:30 1.50 INTRM3, CASING RURD P Rig up to run 9-7/8" liner. SIMOPS - Stage casing RCD bearing and stabbing stand on rig floor. 0.0 0.0 1/31/2023 01:30 1/31/2023 03:30 2.00 INTRM3, CASING MPDA P M/U 9-7/8" casing RCD bearing to joint #16 and perform dummy run. (good). L/D joint w/bearing installed to pipe shed. 0.0 0.0 1/31/2023 03:30 1/31/2023 06:00 2.50 INTRM3, CASING PUTB P PJSM on running liner. M/U 9-7/8" 62.8# L-80 Hyd 563 liner shoe track to 160'. Baker lock to pin of joint #4. Fill pipe and check floats (good) 0.0 160.0 1/31/2023 06:00 1/31/2023 08:00 2.00 INTRM3, CASING PUTB P RIH 9-7/8" 62.8# L-80 Hyd 563 liner f/160' to 623'. S/O wt 96k 160.0 623.0 1/31/2023 08:00 1/31/2023 08:30 0.50 INTRM3, CASING MPDA P M/U 9-7/8" RCD bearing and function test equipment. 623.0 623.0 1/31/2023 08:30 1/31/2023 17:30 9.00 INTRM3, CASING PUTB P RIH 9-7/8" 62.8# L-80 Hyd 563 liner f/623' to 6,003' while maintaining 12.2 ppg EMW. S/O wt 115k 623.0 6,003.0 1/31/2023 17:30 1/31/2023 18:00 0.50 INTRM3, CASING MPDA P R/D liner running tools and equipment. Volant, PS-21's, bale extensions, etc. Prep to pull 9-7/8" RCD bearing. 6,003.0 6,003.0 1/31/2023 18:00 1/31/2023 18:15 0.25 INTRM3, CASING OWFF P OWFF 15 min (static) 6,003.0 6,003.0 1/31/2023 18:15 1/31/2023 19:45 1.50 INTRM3, CASING RURD P Clean and clear floor of liner running tools and equipment. R/U 5-7/8" handling equipment. Cont. to prep to pull 9-7/8" RCD bearing. Monitor well by circulating across the top of the hole thru MPD system. 6,003.0 6,003.0 1/31/2023 19:45 1/31/2023 22:00 2.25 INTRM3, CASING MPDA P Mobilize power tongs to rig floor and R/U. M/U 9-7/8" circ swedge and 1 stand of 5-7/8" DP. Pull 9-7/8" RCD bearing and L/D same. Rack back stand of 5-7/8" DP. Monitor well by circulating across the top of the hole thru MPD system. Mud wt out 11.5 ppg 6,003.0 6,003.0 1/31/2023 22:00 2/1/2023 00:00 2.00 INTRM3, CASING RURD P R/U liner hanger shuttle. P/U 9-7/8" x 13 -5/8" ZXP liner hanger packer assy. R/D liner hanger shuttle. 6,003.0 6,003.0 2/1/2023 00:00 2/1/2023 02:30 2.50 INTRM3, CASING PUTB P M/U liner wiper plugs to 9-7/8" x 13-5/8" ZXP liner hanger packer assy. M/U liner hanger to liner. Inspect hanger slips and verify pinned correctly. Fill liner hanger with pal mix. RIH to 6,055'. Mud wt out 11.5 ppg 6,003.0 6,055.0 2/1/2023 02:30 2/1/2023 02:45 0.25 INTRM3, CASING RUNL P RIH with liner on two stands of 5-7/8" drill pipe f/6,055' to 6,240' 6,055.0 6,240.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 52/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/1/2023 02:45 2/1/2023 04:15 1.50 INTRM3, CASING MPDA P Install 5-7/8" RCD bearing and line up MPD equipment to strip liner in the hole. Collect torque and drag data, P/U wt 167 k, S/O wt 130 k, ROT wt 154 k, 20 rpm @ 8 k/ft lbs trq. 6,240.0 6,240.0 2/1/2023 04:15 2/1/2023 14:00 9.75 INTRM3, CASING RUNL P RIH with liner 9-7/8" liner with 5-7/8" drill pipe f/6,240' to 12,550' while maintaining 12.2 ppg EMW. S/O wt 138 k. Mud wt out 11.5 ppg 6,240.0 12,550.0 2/1/2023 14:00 2/1/2023 14:15 0.25 INTRM3, CASING RUNL P Collect torque and drag data prior to entering open hole, P/U wt 217 k, S/O wt 139 k, ROT wt 182 k, 20 rpm @ 15 k/ft lbs trq. S/O wt w/rotation 158 k. 12,550.0 12,550.0 2/1/2023 14:15 2/2/2023 00:00 9.75 INTRM3, CASING RUNL P RIH with liner 9-7/8" liner with 5-7/8" drill pipe f/12,550' to 16,168' while maintaining 12.2 ppg EMW. S/O wt w/rotation at 20 rpm 185 k / 14 k ft/lbs trq. (22 - 26 k/ft lbs break over trq) Mud wt out 11.5 ppg (Started pushing fluid away at 15,000'.Stopped applying back pressure while tripping in and losses stabilized) 22 bbls total losses past 24 hrs. 12,550.0 16,168.0 2/2/2023 00:00 2/2/2023 07:00 7.00 INTRM3, CASING RUNL P RIH with liner 9-7/8" liner with 5-7/8" drill pipe f/16,168' to 18,468' while maintaining 12.2 ppg EMW. S/O wt w/rotation at 20 rpm 198 k / 20 k ft/lbs trq. Max break over torque 33 k ft/lbs. Mud wt out 11.4+ ppg. SIMOPS - Build vent assembly and prep to fill liner. 16,168.0 18,468.0 2/2/2023 07:00 2/2/2023 08:00 1.00 INTRM3, CASING RURD P M/U side entry sub vent assy. Tie in cement hose to fill pipe and R/U bleed lines to mud manifold. 18,468.0 18,468.0 2/2/2023 08:00 2/2/2023 08:30 0.50 INTRM3, CASING PRTS P Flood lines and PT to 1500 psi. Pull liner in tension t/325 k. Presure up to 1111 psi and rupture SD sub disk as per Baker rep. 18,468.0 18,468.0 2/2/2023 08:30 2/2/2023 11:00 2.50 INTRM3, CASING CIRC P Fill liner w/11.5 ppg FWP and lubricate and bleed as per program. Maintain 12.2 ppg EMW on annulus. 474 bbls to fill and fluid pack liner. 18,468.0 18,468.0 2/2/2023 11:00 2/2/2023 13:00 2.00 INTRM3, CASING RURD P B/D lines and R/D vent assy. Bring cement head to rig floor and load darts. M/U cement head and R/U cement hose. 18,468.0 18,468.0 2/2/2023 13:00 2/2/2023 22:15 9.25 INTRM3, CASING CIRC P Circ and condition mud/hole for cement job. Stage flow rate up to 8 bpm / 879 psi. SIMOPS - L/D 6-5/8" DP via XY crane. 18,468.0 18,468.0 2/2/2023 22:15 2/2/2023 23:45 1.50 INTRM3, CASING RURD P B/D lines and install lotorq valve on cement head for isolation between rig and Citadel. PT same to 5000 psi (good). R/U test chart to mud manifold and PJSM on setting liner. 18,468.0 18,468.0 2/2/2023 23:45 2/3/2023 00:00 0.25 INTRM3, CASING HOSO P S/O to nuetral wt and break connection at cement head. Drop 1-1/2" liner setting ball. M/U same. Pull liner in tension w/328 k. 18,468.0 18,468.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 53/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/3/2023 00:00 2/3/2023 02:15 2.25 INTRM3, CASING HOSO P Pump down 1-1/2" phenolic ball w/6 bpm @ 471 psi for first 150 bbls. Reduce rate to 2 bpm @ 316 psi for remaining 152 bbls. 302 bbls total pumped and ball on seat. Pressure up to 2650 psi and slack off to confirm liner is set. Slips did not engage. Pressure up to 2900 psi and slack off to confirm liner is set. Slips did not engage. Pressure up to 3000 psi and slack off to confirm liner is set. Slips did not engage. Pressure up to 3200 psi and slack off to confirm liner is set. Slips did not engage and liner running tools released. Liner is sitting on bottom at 18,468'. Initial P/U wt was 345 k and liner would not move up the hole. Final hook load after liner is released is 243 k with free travel. At this point ball is still on seat. 18,468.0 18,468.0 2/3/2023 02:15 2/3/2023 03:30 1.25 INTRM3, CASING WAIT T R/D cement lines and discuss plan forward options with Drilling Superintendent. Plan forward is to proceed with shifting DOBS, blow ball off seat, and cement liner as per approved section plan. 18,468.0 18,468.0 2/3/2023 03:30 2/3/2023 04:30 1.00 INTRM3, CEMENT HOSO T Attempt to shear the burst disk in HRDE running tools, shift the DOBS and blow ball off seat. Come on with pumps at 1 bpm @ 750 psi. Increase flow rate to 1.75 bpm @ 1150 psi and returns observed at shakers. Pump rate is half the rate and 3 times the pressure as the previous circulation rate. There is no positive indication that the ball is off seat. No formation losses during this operation. Shut down and discuss plan forward options town. 18,468.0 18,468.0 2/3/2023 04:30 2/3/2023 07:00 2.50 INTRM3, CEMENT WAIT T B/D cementing lines and line up to monitor well through MPD system across top of the hole. Discuss plan forward options with town. 18,468.0 18,468.0 2/3/2023 07:00 2/3/2023 07:15 0.25 INTRM3, CEMENT RURD T B/D MPD lines. PJSM on up-coming operations with rig team. 18,468.0 18,468.0 2/3/2023 07:15 2/3/2023 08:30 1.25 INTRM3, CEMENT HOSO T Attempt to shift DOBS and blow ball off seat. S/O string wt to 165 k. Pressure up to 3750 psi and attempt to hold pressure. Pressure bled off to 850 psi over 12 min. Pressure up to 3900 psi and dynamically maintain pressure. Stop pumping and pressure bled off to 850 psi over 12 min. Pressure up to 4000 psi and dynamically maintain pressure. Stop pumping and pressure bled off to 850 psi over 12 min. Pressure back up to 2000 psi and not able to hold pressure. Attempt to blow ball off seat and function DOBS was unsuccessful. No formation losses. 18,468.0 18,468.0 2/3/2023 08:30 2/3/2023 11:30 3.00 INTRM3, CEMENT CIRC T Circulate and 1 bpm @ 865 psi and discuss past operations and plan forward operations with town. Pick up on string 2' over break over wt and perform circ test at 1 bpm @ 522 psi. Pump pressure was ~300 psi less indicating lower seals on pack off could be damaged. 18,468.0 18,468.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 54/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/3/2023 11:30 2/3/2023 12:30 1.00 INTRM3, CEMENT RURD T B/D cement lines and L/D Citadel cement head. P/U single from pipe shed and rack back 1 stand of DP. L/D 15' space out pup. 18,468.0 18,468.0 2/3/2023 12:30 2/3/2023 13:30 1.00 INTRM3, CEMENT TRIP T Pull liner running tools out of top of liner. Pump at 1 bpm to confirm when fully out. Initial SPP 350 psi and final 193 psi once fully out. Took 80 k over pull to pull liner running tools out of top of the packer mandrel. TOL 12,423'. Free P/U wt 230 k. 18,468.0 12,423.0 2/3/2023 13:30 2/3/2023 14:00 0.50 INTRM3, CEMENT CIRC T Pump 35 bbl dry job. B/D top drive. Collect torque and drag data. P/U wt 30 k, S/O wt 170 k, ROT wt 206 k, 10 k ft/lbs trq at 10 rpm. 12,423.0 12,423.0 2/3/2023 14:00 2/3/2023 14:30 0.50 INTRM3, CEMENT MPDA T Pull 5-7/8" RCD bearing. 12,423.0 12,423.0 2/3/2023 14:30 2/3/2023 14:45 0.25 INTRM3, CEMENT OWFF T OWFF 15 min (static) 12,423.0 12,423.0 2/3/2023 14:45 2/4/2023 00:00 9.25 INTRM3, CEMENT TRIP T POOH on elevators f/12,423' to 433'. Monitor hole fill on trip tank. No losses observed. OWFF at 2,000' (static) 12,423.0 433.0 2/4/2023 00:00 2/4/2023 00:30 0.50 INTRM3, CEMENT TRIP T POOH on elevators f/433' to liner running tools. Monitor hole fill on trip tank. No losses observed. 433.0 0.0 2/4/2023 00:30 2/4/2023 02:00 1.50 INTRM3, CEMENT BHAH T Break down and inspect liner running tools. Initial visual inspection of liner running tools. HRDE had been released as expected. Upper pack-off seals fully intact with slight damage most likely from trip out. Lower pack-off body significantly damaged and eroded and seal rings were missing. Weep holes in LFC were packed full of debris and white plastic tape. Metal shavings and metal debris sitting on top liner wiper plugs. Liner wiper plugs were damaged most likely from the trip out. Internal inspection of liner running tools after break down. Ball was still on seat and the DOBS had not been shifted/stroked down. Solid mud over air barrier had been tripped as expected. 0.0 0.0 2/4/2023 02:00 2/4/2023 03:00 1.00 INTRM3, CEMENT BHAH T Clean and clear floor of liner running tools and equipment. 0.0 0.0 2/4/2023 03:00 2/4/2023 05:00 2.00 INTRM3, CEMENT SLPC T Slip and cut drilling line. 0.0 0.0 2/4/2023 05:00 2/4/2023 07:15 2.25 INTRM3, CEMENT RURD T C/O saver sub from VX-57 to VX-69. Perform block calibration and inspect deadman. 0.0 0.0 2/4/2023 07:15 2/4/2023 08:30 1.25 INTRM3, WHDBOP WWWH P M/U stack washing tool and RIH. Function rams and annular. Flush stack. B/D lines. 0.0 0.0 2/4/2023 08:30 2/4/2023 12:00 3.50 INTRM3, WHDBOP RURD P Shut in blind rams and bleed off Koomey. C/O upper rams to 4-1/2" x 7- 5/8" VBR's. M/U wear ring puller and pull same. Set test plug. R/U to test BOPE's. Fill stack with H2O and purge air from system. Perform shell test. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 55/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/4/2023 12:00 2/5/2023 00:00 12.00 INTRM3, WHDBOP BOPE P Test BOPE's w/4-1/2", 6-5/8" and 7-5/8" test joints to 250 psi for 5 min / 4000 psi for 10 min. Annular 250 psi for 5 min / 2500 psi for 10 min. Upper VBR's 4-1/2" X 7-5/8", lower VBR's 3-1/2" X 6-5/8", choke valves #1 - #16, choke/kill manuals & HCR's, upper/lower IBOP, #1 and #2 FOSV, dart valve, and blind/shear rams. Perform draw down on manual and super choke. Test gas alarms and PVT alarms. Perform Koomey draw down. 28 sec/200 psi, 154 sec/full pressure. 10 bottles 4000 psi average. AOGCC - Sean Sullivan waive witness of test. BLM - Quinn Sawyer witness test. 0.0 0.0 2/5/2023 00:00 2/5/2023 00:30 0.50 INTRM3, WHDBOP BOPE P Test upper rams with 7-5/8" test joint to 250 psi for 5 min / 4000 psi for 10 min. 0.0 0.0 2/5/2023 00:30 2/5/2023 04:00 3.50 INTRM3, WHDBOP RURD P R/D testing equipment and B/D lines. Clean and clear rig floor. Pull test plug and set wear ring. 0.0 0.0 2/5/2023 04:00 2/5/2023 06:00 2.00 INTRM3, CEMENT BHAH T M/U Baker TST packer BHA to 84' 0.0 84.0 2/5/2023 06:00 2/5/2023 16:00 10.00 INTRM3, CEMENT TRIP T RIH f/84' to 10,486' w/5-7/8" DP. Fill pipe and break circulation every 2,500'. S/O wt 149 k. Installed rotating dog sub on top of stand 61. 84.0 10,486.0 2/5/2023 16:00 2/5/2023 16:30 0.50 INTRM3, CEMENT RURD T C/O handling equipment to 6-5/8". C/O inserts in PS-21's. M/U 5-7/8" x 6-5/8" XO. 10,486.0 10,486.0 2/5/2023 16:30 2/5/2023 18:00 1.50 INTRM3, CEMENT TRIP T RIH f/10,486' to 12,354' w/6-5/8" DP. 10,486.0 12,354.0 2/5/2023 18:00 2/5/2023 19:00 1.00 INTRM3, CEMENT TRIP T Cont. RIH washing down thru liner top w/250 gpm @ 320 psi f/12,354' to 12,485' 12,354.0 12,485.0 2/5/2023 19:00 2/5/2023 21:30 2.50 INTRM3, CEMENT CIRC T Circ and condition mud surface to surface w/420 gpm @ 390 psi. P/U wt 252 k, S/O wt 153 k. 11.5 ppg In/Out 12,485.0 12,485.0 2/5/2023 21:30 2/6/2023 00:00 2.50 INTRM3, CEMENT TRIP T RIH f/12,485' to 14,491' w/6-5/8" DP. (Pumped at 2 bpm as TST packer entered liner top) Fill pipe and break circ every 2,000' P/U wt 292 k, S/O wt 153 k. 12,485.0 14,491.0 2/6/2023 00:00 2/6/2023 04:30 4.50 INTRM3, CEMENT TRIP T RIH f/14,491' to 17,932' w/6-5/8" DP. Fill pipe and break circ every 2,000' 14,491.0 17,932.0 2/6/2023 04:30 2/6/2023 06:00 1.50 INTRM3, CEMENT MPDA T Install 6-5/8" RCD bearing for cementing contingency if the floats do not hold. 17,932.0 17,932.0 2/6/2023 06:00 2/6/2023 06:30 0.50 INTRM3, CEMENT TRIP T RIH f/17,932' to 18,174' and no go out rotating dog sub on liner top. POOH to 18,147' and space out for cement job. 14,491.0 18,147.0 2/6/2023 06:30 2/6/2023 07:00 0.50 INTRM3, CEMENT MPSP T Break circ at 3 bpm @ 300 psi and confirm fluid path around TST packer is clear. Set packer as per Baker rep. Put 12 wraps to the left and work down. Set down w/30 k wob to confirm set., 18,147.0 18,147.0 2/6/2023 07:00 2/6/2023 07:45 0.75 INTRM3, CEMENT RURD T B/D top drive. R/U TIW, head pin and cement hose. PT lines to 4000 psi. 18,147.0 18,147.0 2/6/2023 07:45 2/6/2023 13:15 5.50 INTRM3, CEMENT CIRC T Slowly stage rat up to 8 bpm @ 670 psi and circ and condition for cement job with full returns. No losses to formation and no issues staging up to full rate. 18,147.0 18,147.0 2/6/2023 13:15 2/6/2023 13:45 0.50 INTRM3, CEMENT RURD P Blow air to cementers. Fluid pack lines with H2O and PT 3000 psi. PJSM on cementing. 18,147.0 18,147.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 56/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/6/2023 13:45 2/6/2023 16:15 2.50 INTRM3, CEMENT CMNT P Cement 9-7/8" liner. SLB pump 100 bbls 13.0 ppg mud push, 147 bbls 15.8 ppg UniSlurry cement, 5 bbls H2O, drop foam ball, 20 bbls 13.0 ppg mud push and clear lines with 20 bbls H2O with 6 bpm @ 600 psi. Turn over to rig for displacement. Rig pump 471 bbls 11.5 ppg FWP with 6 bpm @ 600 psi with full returns. 18,147.0 18,147.0 2/6/2023 16:15 2/6/2023 16:45 0.50 INTRM3, CEMENT PACK P B/D lines. Check floats (good). R/D cementing lines. Un-seat TST packer as per Baker rep. Pick up double in the mouse hole, tag TOL with RDS and slack off 80k to set liner top packer. Observed shear. Pick back up and rotate down to TOL and stack 80k wt while rotating to conifirm packer set. 18,147.0 18,147.0 2/6/2023 16:45 2/6/2023 17:00 0.25 INTRM3, CEMENT TRIP P POOH f/18,147' to 18,021' 18,147.0 18,021.0 2/6/2023 17:00 2/6/2023 17:30 0.50 INTRM3, CEMENT MPDA P Pull 6-5/8" RCD bearing. 18,021.0 18,021.0 2/6/2023 17:30 2/6/2023 21:30 4.00 INTRM3, CEMENT CIRC P Drop foam wiper ball and circ and cond mud for 2X liner volume w/6 bpm @ 370 psi. P/U wt 320 k, S/O wt 155 k. Reciprocate pipe full stand. 100 bbls after the foam ball exited the bull nose and started coming up the annulus we saw an increase in pump pressure from 370 psi to 600 psi and a 6 - 10 k increase in hook load. Reduced flow rate to 1 bpm and pump pressure was the same. This led us to believe we rolled the seals on the TST packer. Discussed plan forward options with team and decided to suspend any more circulating inside the 9-7/8" liner and finish circulating on top of liner. Pump dry job and B/D top drive. SIMOPS - L/D 6-5/8" DP from derrick via mouse hole. 18,021.0 18,021.0 2/6/2023 21:30 2/6/2023 23:00 1.50 INTRM3, CEMENT OWFF P OWFF (static) SIMOPS - Shuffle 5-7/8" DP in derrick from drillers side to off drillers side. Prep to L/D 6-5/8" DP 18,021.0 18,021.0 2/6/2023 23:00 2/7/2023 00:00 1.00 INTRM3, CEMENT PULD P POOH laying down 6-5/8" DP f/18,021' to 17,870' P/U wt 360 k, S/O wt 168 k 18,021.0 17,870.0 2/7/2023 00:00 2/7/2023 09:00 9.00 INTRM3, CEMENT PULD P POOH laying down 6-5/8" DP f/17,870' to 12,472' P/U wt 290 k 17,870.0 12,472.0 2/7/2023 09:00 2/7/2023 10:00 1.00 INTRM3, CEMENT CIRC P Circulate 9-7/8" liner top and 13-5/8" acing clean w/1500 gpm, 3166 psi for 1.5 B/U. Significant amount of cuttings, shoe track dpris and washed out TST packer seals. 12,472.0 12,472.0 2/7/2023 10:00 2/7/2023 10:30 0.50 INTRM3, CEMENT RURD P Pump 30 bbls 13.5 ppg dry job. B/D top drive. 12,472.0 12,472.0 2/7/2023 10:30 2/7/2023 12:00 1.50 INTRM3, CEMENT PULD P POOH laying down 6-5/8" DP f/12,472' to 10,484' P/U wt 254 k 12,472.0 10,484.0 2/7/2023 12:00 2/7/2023 12:30 0.50 INTRM3, CEMENT RURD P C/O handling equipment from 6-5/8" to 5 -7/8" 10,484.0 10,484.0 2/7/2023 12:30 2/7/2023 20:00 7.50 INTRM3, CEMENT TRIP P POOH racking back 5-7/8" DP in derrick f/10,484' to 84 10,484.0 84.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 57/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/7/2023 20:00 2/7/2023 20:45 0.75 INTRM3, CEMENT BHAH P C/O handling equipment to 5". L/D TST packer assy. Seals on packer were damaged and rolled. 6" x 3" piece missing off packer element. Prep packer for immediate return back to Bakers Shop to get rebuilt. ETA back to rig 8:00 - 9:00 hrs 84.0 0.0 2/7/2023 20:45 2/7/2023 22:00 1.25 INTRM3, CEMENT PRTS T R/U testing equipment and fluid pack lines. Attempted to pressure test the 9- 7/8” X 13-5/8” ZXP liner top packer. Started pumping at 1 bpm down the kill line, monitoring pressures on IA gauge and SPP gauge. Took 23.5 bbls to pressure up to 2200 psi. At this point it looked like we established an injection rate. Continued to pump an additional 1.5 bbls for 25 bbls total and it looked like we were starting to leak off. I stopped pumping and shut in at the HCR kill. The IA quickly bled off to 1100 psi and attempted to stabilize, the SPP/rig side stayed constant validating the leak was down hole. Bled off pressure and gained only 10 bbls. FIT for the 13-5/8” shoe was 14.6 ppg / 1100 psi. CIP was 16:15 hrs on 2/6/23. Discuss results of pressure test results with Drilling Superintendent. 0.0 0.0 2/7/2023 22:00 2/8/2023 00:00 2.00 INTRM3, CEMENT SVRG T Service rig. House keeping and MP2's. C/O saver sub to VX-57. Perform maintenance on rig pumps. 0.0 0.0 2/8/2023 00:00 2/8/2023 12:00 12.00 INTRM3, CEMENT SVRG T Service rig. House keeping and MP2's. Cont. C/O saver sub to VX-57. C/O wash pipe on top drive. Perform maintenance on rig pumps. C/O pulsation dampener on mud pump #2. Balance rig tong counter weights. Dress PS-21's for 4-1/2". SIMOPS - Waiting on TST packer to be rebuilt in Baker's Shop in Deadhorse. Discuss plan forward options with drilling team. 0.0 0.0 2/8/2023 12:00 2/8/2023 18:00 6.00 INTRM3, CEMENT SVRG T Service rig. House keeping and MP2's. Perform maintenance on rig pumps. C/O pulsation dampener on mud pump #2. Balance rig tong counter weights. Replace auger bearing in CPU. SIMOPS - Waiting on TST packer to be rebuilt in Baker's Shop in Deadhorse. 0.0 0.0 2/8/2023 18:00 2/8/2023 19:30 1.50 INTRM3, CEMENT SVRG T Service rig. House keeping and MP2's. SIMOPS - Packer arrive on location 18:00 hrs. Load packer in pipe shed and prep for BHA. 0.0 0.0 2/8/2023 19:30 2/8/2023 20:30 1.00 INTRM3, CEMENT BHAH T M/U TST packer BHA to 86' 0.0 86.0 2/8/2023 20:30 2/9/2023 00:00 3.50 INTRM3, CEMENT PULD T RIH TST packer assy f/86' to 2,418' while picking up 4-1/2" DP from pipe shed at 60 ft/min running speed. Fill pipe every 2500' w/4 bpm max. S/O wt 114 k. 86.0 2,418.0 2/9/2023 00:00 2/9/2023 06:45 6.75 INTRM3, CEMENT PULD T RIH TST packer assy f/2,418' to 6,032' while picking up 4-1/2" DP from pipe shed at 60 ft/min running speed. Fill pipe every 2500' w/4 bpm max. S/O wt 133 k. 2,418.0 6,032.0 2/9/2023 06:45 2/9/2023 07:00 0.25 INTRM3, CEMENT RURD T C/O handling equipment to 5-7/8". C/O inserts in PS-21's 6,032.0 6,032.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 58/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/9/2023 07:00 2/9/2023 12:00 5.00 INTRM3, CEMENT TRIP T RIH w/TST packer assy on 5-7/8" DP f/6,032' to 12,437' S/O wt 151 k. Pipe filling on its own. 6,032.0 12,437.0 2/9/2023 12:00 2/9/2023 12:15 0.25 INTRM3, CEMENT TRIP T RIH w/TST packer assy washing down thru liner top w/4 bpm @ 125 psi f/12,437' to 12,551' 12,437.0 12,551.0 2/9/2023 12:15 2/9/2023 12:30 0.25 INTRM3, CEMENT PACK T Set TST packer as per Baker rep. Apply 8 wraps to the left and set down 30 k wob. Free S/O wt 150 k. 12,551.0 12,551.0 2/9/2023 12:30 2/9/2023 13:00 0.50 INTRM3, CEMENT RURD T B/D top drive and R/U testing equipment. Fluid pack lines and PT lines to 3500 psi. 12,551.0 12,551.0 2/9/2023 13:00 2/9/2023 14:30 1.50 INTRM3, CEMENT PRTS T First test is PT below packer against 9- 7/8" shoe track. Pump at 1 bpm, gained pressure up to 1775 psi and then started injecting fluid. Failed test. Pumped 7 bbls total and gained 3.6 bbls back to trip tank. Second test is above packer testing ZXP liner top packer. Shut in on annular. Pump at 1 bpm and pressure up to 3500 psi. Hold on chart for 30 min. Good test. Pumped 18 bbls total and 18 bbls bled back to trip tank. 12,551.0 12,551.0 2/9/2023 14:30 2/9/2023 15:00 0.50 INTRM3, CEMENT PACK T R/D testing equipment and un-seat packer as per Baker rep. Verify free travel. P/U wt 226 k, S/O wt 151 k 12,551.0 12,551.0 2/9/2023 15:00 2/9/2023 21:00 6.00 INTRM3, CEMENT TRIP T RIH w/TST packer assy f/12,551' to 18,098'. Pipe filling on its own.P/U wt 301 k, S/O wt 152 k 12,551.0 18,098.0 2/9/2023 21:00 2/9/2023 22:15 1.25 INTRM3, CEMENT TRIP T RIH w/TST packer assy washing down w/2 bpm @ 300 psi f/18,098' to 18,251' and tag TOC w/10 k wob 18,098.0 18,251.0 2/9/2023 22:15 2/9/2023 22:30 0.25 INTRM3, CEMENT PACK T Set TST packer as per Baker rep. Apply 8 wraps to the left and set down 30 k wob. Free S/O wt 152 k. Packer element is at 18,170' 18,251.0 18,251.0 2/9/2023 22:30 2/9/2023 23:00 0.50 INTRM3, CEMENT RURD T B/D top drive and R/U testing equipment. Fluid pack lines. 18,251.0 18,251.0 2/9/2023 23:00 2/10/2023 00:00 1.00 INTRM3, CEMENT PRTS T Shut in on annular and pump down kill line only. Pressure test casing f/18,170' to surface testing 9-7/8" liner and 13- 5/8" casing. Pump at 1 bpm and pressure up to 3500 psi. Pumped 21.2 bbls total. Monitor drill string via open lotorq valve. 18,251.0 18,251.0 2/10/2023 00:00 2/10/2023 00:30 0.50 INTRM3, CEMENT PRTS T Monitor 3500 psi pressure test for 30 min. Equalize pressures and bleed off. Pumped 21.2 bbls total and bled back 21.2 bbls to trip tank. 18,251.0 18,251.0 2/10/2023 00:30 2/10/2023 00:45 0.25 INTRM3, CEMENT RURD T R/D testing equipment and B/D lines. 18,251.0 18,251.0 2/10/2023 00:45 2/10/2023 01:00 0.25 INTRM3, CEMENT PACK T Un-seat packer as per Baker rep. Verify free travel. P/U wt 303 k, S/O wt 158 k 18,251.0 18,251.0 2/10/2023 01:00 2/10/2023 01:30 0.50 INTRM3, CEMENT TRIP T POOH w/TST packer f/18,251' to 18,156'. P/U wt 303 k 18,251.0 18,156.0 2/10/2023 01:30 2/10/2023 02:00 0.50 INTRM3, CEMENT RURD T Pump 20 bbl 13.5 ppg dry job. B/D top drive and prep to POOH. OWFF - Static 18,156.0 18,156.0 2/10/2023 02:00 2/10/2023 02:30 0.50 INTRM3, CEMENT SVRG T Service rig, top drive and draw works. Service ST-120. 18,156.0 18,156.0 2/10/2023 02:30 2/10/2023 12:00 9.50 INTRM3, CEMENT TRIP T POOH w/TST packer assy f/18,156' to 6,685'. P/U wt 160 k. Monitor hole fill via trip tank. 18,156.0 6,685.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 59/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/10/2023 12:00 2/10/2023 17:30 5.50 INTRM3, CEMENT TRIP T POOH w/TST packer assy f/6,685' to 86'. Monitor hole fill via trip tank. 6,685.0 86.0 2/10/2023 17:30 2/10/2023 18:00 0.50 INTRM3, CEMENT BHAH T L/D TST packer BHA as per Baker rep. Packer in good shape. Bull nose was packed off with contaminated cement. Prepped packer for immediate return to Baker's Shop in Deadhorse for rebuild. 86.0 0.0 2/10/2023 18:00 2/10/2023 21:30 3.50 INTRM3, DRILLOUT BHAH P Clean and clear rig floor. Mobilize BHA tools and equipment to rig floor. Prep to P/U BHA. 0.0 0.0 2/10/2023 21:30 2/11/2023 00:00 2.50 INTRM3, DRILLOUT BHAH P M/U 8-1/2" x 10-1/4" Intermediate #4 drilling BHA to 143' 0.0 143.0 2/11/2023 00:00 2/11/2023 04:00 4.00 INTRM3, DRILLOUT BHAH P M/U 8-1/2" x 10-1/4" Intermediate #4 drilling BHA f/143' to 534' 143.0 534.0 2/11/2023 04:00 2/11/2023 07:00 3.00 INTRM3, DRILLOUT PULD P RIH Intermediate #4 drilling BHA f/534' to 3,179' while picking 4-1/2" DP (84 jts total) 534.0 3,179.0 2/11/2023 07:00 2/11/2023 08:00 1.00 INTRM3, DRILLOUT DHEQ P Fill DP and shallow hole test MWD/LWD tools w/500 gpm, 1475 psi. B/D top drive. 3,179.0 3,179.0 2/11/2023 08:00 2/11/2023 09:45 1.75 INTRM3, DRILLOUT TRIP P RIH w/4-1/2" DP out of derrick f/3,179' to 6,196' 3,179.0 6,196.0 2/11/2023 09:45 2/11/2023 11:30 1.75 INTRM3, DRILLOUT DHEQ P Fill DP and test MWD/LWD tools w/700 gpm, 3140 psi. B/D top drive. 6,196.0 6,196.0 2/11/2023 11:30 2/11/2023 13:30 2.00 INTRM3, DRILLOUT TRIP P RIH w/4-1/2" DP out of derrick f/6,196' to 9,126' 6,196.0 9,126.0 2/11/2023 13:30 2/11/2023 14:30 1.00 INTRM3, DRILLOUT RURD P C/O handling equipment to 5-7/8". C/O inserts in PS-21's. 9,126.0 9,126.0 2/11/2023 14:30 2/11/2023 15:15 0.75 INTRM3, DRILLOUT TRIP P RIH w/stand of 5-7/8" DP f/9,126' to 9,218'. Fill pipe. B/D top drive. 9,126.0 9,218.0 2/11/2023 15:15 2/11/2023 19:30 4.25 INTRM3, DRILLOUT SLPC P Hang blocks. Slip and cut 75' drill line. Un-hang blocks. Calibrate block height in Amphion. Perform empty block calibration. 9,218.0 9,218.0 2/11/2023 19:30 2/12/2023 00:00 4.50 INTRM3, DRILLOUT TRIP P RIH w/stands of 5-7/8" DP f/9,218' to 13,190'. Fill pipe every 25 stands and B/D top drive. P/U wt 218 k, S/O wt 140 k. The ILS stabilizer in the BHA was hanging up on the liner top. Rotated ILS thru TOL @ 10 rpm with no issue. 9,218.0 13,190.0 2/12/2023 00:00 2/12/2023 04:45 4.75 INTRM3, DRILLOUT TRIP P RIH w/stands of 5-7/8" DP f/13,190' to 18,036'. Fill pipe every 25 stands and B/D top drive. P/U wt 280 k, S/O wt 140 k. 13,190.0 18,036.0 2/12/2023 04:45 2/12/2023 06:45 2.00 INTRM3, DRILLOUT COCF P W&R f/18,036' and clean out cement to landing collar at 18,333' w/500 gpm, 2790 psi, 5 k wob, 40 rpm, P/U wt 307 k, S/O wt 155 k, ROT wt 208 k, 30 k ft/lbs trq. 18,036.0 18,333.0 2/12/2023 06:45 2/12/2023 07:45 1.00 INTRM3, DRILLOUT CIRC P Circ and condition w/500 gpm, 2750 psi. SIMOPS - Prep for OBM displacement. 18,333.0 18,333.0 2/12/2023 07:45 2/12/2023 11:45 4.00 INTRM3, DRILLOUT DISP P Displace well to 11.5 OBM w/500 gpm, 3520 psi, 80 rpm, 25 k trq. 18,333.0 18,333.0 2/12/2023 11:45 2/12/2023 15:00 3.25 INTRM3, DRILLOUT DHEQ T Trouble shoot LWD tools Having detection and noise issues. 18,333.0 18,333.0 2/12/2023 15:00 2/12/2023 15:30 0.50 INTRM3, DRILLOUT CIRC P Obtain SPR's. 18,333.0 18,333.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 60/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/12/2023 15:30 2/13/2023 00:00 8.50 INTRM3, DRILLOUT DRLG P Drill shoe track f/18,333' to 18,464' w/600 - 650 gpm, 4500 - 5400 psi, 12 - 14 k wob, 80 rpm, P/U wt 258 k, S/O wt 175 k, ROT wt 211 k, 14/18 k ft/lbs trq. SIMOPS- Swapped out mud pump liners to 5-1/2" 18,333.0 18,468.0 2/13/2023 00:00 2/13/2023 01:00 1.00 INTRM3, DRILLOUT DRLG P Drill shoe f/18,464' to 18,468' w/600 gpm, 4600 psi, 12 - 14 k wob, 80 - 100 rpm, P/U wt 258 k, S/O wt 175 k, ROT wt 211 k, 14/17 k ft/lbs trq. 18,464.0 18,468.0 2/13/2023 01:00 2/13/2023 01:30 0.50 INTRM3, DRILLOUT DDRL P Drill new formation f/18,468' to 18,475' MD / 6,897' TVD. ADT .33 Hrs. 600 gpm, 4600 psi, 12.3 ppg ECD, 12 k wob, 80 - 100 rpm, P/U wt 258 k, S/O wt 175 k, ROT wt 211 k, 14/18 k ft/lbs trq. Work thru shoe track 3X's 18,468.0 18,475.0 2/13/2023 01:30 2/13/2023 07:15 5.75 INTRM3, DRILLOUT CIRC P Circ and condition w/600 - 650 gpm, 4600 - 5250 psi, 60 - 100 rpm, 14 - 18 k ft/lbs trq. Reciprocate full 30 - 45'. SIMOPS - C/O pump liners to 5-1/2" in MP #3 18,475.0 18,475.0 2/13/2023 07:15 2/13/2023 07:45 0.50 INTRM3, DRILLOUT CIRC P Funtion test mud pumps #2 and #3 with 5-1/2" liners at 700 gpm, 6300 psi. BROOH to 18,422' 18,475.0 18,422.0 2/13/2023 07:45 2/13/2023 11:00 3.25 INTRM3, DRILLOUT MPDA P Remove PS-21's. Install 5-7/8" RCD bearing, Re-install PS-21's. Function test MPD as per rig advisors. 18,422.0 18,422.0 2/13/2023 11:00 2/13/2023 11:30 0.50 INTRM3, DRILLOUT DHEQ P Downlink to LWD tools. Fine tune detection and communication with smart tools. 18,422.0 18,422.0 2/13/2023 11:30 2/13/2023 12:00 0.50 INTRM3, DRILLOUT REAM P W&R back to TD f/18,422' to 18,475' w/700 gpm, 6160 psi, 30 - 60 rpm, 15 k ft/lbs trq. 18,422.0 18,475.0 2/13/2023 12:00 2/13/2023 14:15 2.25 INTRM3, DRILLOUT DDRL P Drill ahead f/18,475' to 18,488' MD / 6,900' TVD. ADT 1.05 Hrs. 700 gpm, 6160 psi, 12.44 ppg ECD, 5 - 12 k wob, 60 - 80 rpm, P/U wt 258 k, S/O wt 175 k, ROT wt 211 k, 14/18 k ft/lbs trq. 18,475.0 18,488.0 2/13/2023 14:15 2/13/2023 15:15 1.00 INTRM3, DRILLOUT DHEQ P Downlink to LWD tools. Fine tune detection and communication with smart tools. 18,488.0 18,488.0 2/13/2023 15:15 2/13/2023 16:00 0.75 INTRM3, DRILLOUT CIRC P Circ and condition for FIT w/700 gpm, 6100 psi, 80 rpm, 10 k ft/lbs trq. BROOH to 18,403', inside 9-7/8" shoe. 18,488.0 18,403.0 2/13/2023 16:00 2/13/2023 17:00 1.00 INTRM3, DRILLOUT FIT P R/U testing equipment. Perform FIT to 14.5 ppg (1075 psi w/11.5 ppg OBM) Chart for 30 min (good). Pump 10.2 bbls and bleed back 9.8 bbls to trip tank. 16,403.0 18,403.0 2/13/2023 17:00 2/13/2023 18:00 1.00 INTRM4, DRILL RURD P R/D testing equipment and B/D lines. 18,403.0 18,403.0 2/13/2023 18:00 2/13/2023 19:00 1.00 INTRM4, DRILL REAM P W&R back to TD f/18,403' to 18,488' w/700 gpm, 6130 psi, 60 rpm, 15 k ft/lbs trq. 18,403.0 18,488.0 2/13/2023 19:00 2/14/2023 00:00 5.00 INTRM4, DRILL DDRL P Drill ahead f/18,488' to 18,682' MD / 6,939' TVD. ADT 4.02 Hrs. 700 gpm, 6050 psi, 8 k wob, 120 rpm, P/U wt 257 k, S/O wt 162 k, ROT wt 204 k, 14/12 k ft/lbs trq. Maintaining 13.3 ppg EMW with MPD. 18,488.0 18,682.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 61/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/14/2023 00:00 2/14/2023 02:15 2.25 INTRM4, DRILL UREM P Index 10-1/4" XS2 Rhino Reamer. BROOH f/18,682' to 18,663' (Reamer blades 20' below 9-7/8" shoe). Collect base parameters. Drop 1-1/4" ball and pump down as per reamer rep w/250 gpm, 1580 psi initial and 200 gpm, 1370 psi final. Ball on seat 261 bbls / 2608 stks. Pressure up to 1800 psi to blow ball seat and activate reamer. Under- ream 8-1/2" hole to 10-1/4" f/18,663' to 18,470' w/700 gpm at 50 rpm. Ream thru twice. Kill rotation and pull test against 9-7/8" shoe with 10 k over pull. Free P/U wt 254 k. Pull 264 k max. Base parameters with reamer closed: 700 gpm, 6050 psi, 3632 TRPM, Base parameters with reamer open: 700 gpm, 5700 psi, 3281 TRPM 18,682.0 18,663.0 2/14/2023 02:15 2/14/2023 02:30 0.25 INTRM4, DRILL UREM P W&R under reaming 8-1/2" hole to 10- 1/4" f/18,663' to 18,682' w/700 gpm, 5700 psi, 100 rpm, 28 - 26 k ft/lbs trq. 18,663.0 18,682.0 2/14/2023 02:30 2/14/2023 12:00 9.50 INTRM4, DRILL DDRL P Drill ahead 8-1/2" x 10-1/4" hole f/18,682' to 19,190' MD / 7,023' TVD. ADT 6.57 Hrs. 700 gpm, 5527 psi, 8-12 k wob, 120 rpm, P/U wt 283 k, S/O wt 132 k, ROT wt 197 k, 23/14 k ft/lbs trq. Maintaining 13.3 ppg EMW with MPD. 18,682.0 19,190.0 2/14/2023 12:00 2/15/2023 00:00 12.00 INTRM4, DRILL DDRL P Drill ahead 8-1/2" x 10-1/4" hole f/19,190' to 19,890' MD / 7,103' TVD. ADT 8.6 Hrs. 700 gpm, 5605 psi, 9 k wob, 120 rpm, P/U wt 275 k, S/O wt 133 k, ROT wt 201 k, 23/14 k ft/lbs trq. Maintaining 13.3 ppg EMW with MPD. 19,190.0 19,890.0 2/15/2023 00:00 2/15/2023 12:00 12.00 INTRM4, DRILL DDRL P Drill ahead 8-1/2" x 10-1/4" hole f/19,890' to 20,158' MD / 7,121' TVD. ADT 9.98 Hrs. 700 gpm, 5530 psi, 10 - 15 k wob, 120 rpm, P/U wt 284 k, S/O wt 130 k, ROT wt 201 k, 25/14 k ft/lbs trq. Maintaining 13.3 ppg EMW with MPD. 19,890.0 20,158.0 2/15/2023 12:00 2/15/2023 17:30 5.50 INTRM4, DRILL DDRL P Drill ahead 8-1/2" x 10-1/4" hole f/20,158' to 20,448' MD / 7,135' TVD. ADT 4.57 Hrs. 700 gpm, 5530 psi, 10 - 15 k wob, 120 rpm, P/U wt 284 k, S/O wt 130 k, ROT wt 201 k, 25/14 k ft/lbs trq. Maintaining 13.3 ppg EMW with MPD. 20,158.0 20,448.0 2/15/2023 17:30 2/15/2023 18:15 0.75 INTRM4, TRIPCAS CIRC P Pump up final survey. Pump 50 bbl / 75 ppb LCM pill and spot outside bit with 700 gpm, 5570 psi, 100 rpm, 24 k ft/lbs trq 20,448.0 20,448.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 62/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/15/2023 18:15 2/15/2023 21:30 3.25 INTRM4, TRIPCAS FIT P Line up active system to 1 pit. Rotate drill string at 20 rpm / 12 k ft/lbs trq. Pump at 700 gpm and attempt to dynamic FIT to 14.5 ppg EMW. Apply surface back pressure in 40 psi increments. Achieved 13.72 ppg EMW. Continued to increase back pressure and started inducing formation losses. LOT = 13.75 ppg. Pump 50 bbls / 55 ppb LCM pill and slow roll w/250 gpm across open hole. Slowly decrease back pressure and formation stabilize with no losses at 13.2 ppg EMW. Discuss plan forward and mud cap options with drilling team. Dynamic FIT Results: Initial 700 gpm, 5640 psi, 350 psi back pressure, 13.25 ppg EMW Final 700 gpm, 5850 psi, 520 psi back pressure, 13.72 ppg EMW 20,448.0 20,448.0 2/15/2023 21:30 2/15/2023 22:30 1.00 INTRM4, TRIPCAS UREM P Collect open base parameters. Drop 1- 5/8" ball and pump down as per reamer rep w/250 gpm, 1560 psi initial and 100 gpm, 1100 psi final. Ball on seat 260 bbls / 2620 stks. Pressure up to 2800 psi to blow ball seat and close reamer. Stage flow rate to 700 gpm and collect closed parameters. Base parameters with reamer open: 700 gpm, 5560 psi, 3320 TRPM Base parameters with reamer closed: 700 gpm, 5850 psi, 3671 TRPM 20,448.0 20,448.0 2/15/2023 22:30 2/15/2023 23:30 1.00 INTRM4, TRIPCAS CIRC P Collect SPR's. Pump 50 bbl / 75 ppb LCM pill to bit with 700 gpm/ 5800 psi. Reduce pump rate to 250 gpm / 1600 psi and slow roll across open hole (163 bbls open hole volume) 20,448.0 20,448.0 2/15/2023 23:30 2/16/2023 00:00 0.50 INTRM4, TRIPCAS BKRM P Low energy BROOH w/150 gpm, 1130 psi, 30 rpm, 16 k ft/lbs trq, 25 ft/min f/20,448' to 20,350'. Maintain 13.2 ppg EMW Rotating P/U wt 225 k / ROT wt 196 k. 20,448.0 20,350.0 2/16/2023 00:00 2/16/2023 05:30 5.50 INTRM4, TRIPCAS BKRM P Low energy BROOH w/150 gpm, 1130 psi, 30 rpm, 14 k ft/lbs trq, 25 ft/min f/20,350' to 18,680. Maintain13.2 ppg EMW Rotating P/U wt 225 k / ROT wt 194 k. 20,350.0 18,680.0 2/16/2023 05:30 2/16/2023 06:00 0.50 INTRM4, TRIPCAS BKRM P Stay stationary and rotate at 5 rpm. Pump 50 bbls/75 ppb LCM pill to the BHA w/600 gpm / 4550 psi. (346 bbls/3460 stks) 18,680.0 18,680.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 63/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/16/2023 06:00 2/16/2023 07:30 1.50 INTRM4, TRIPCAS BKRM P Cont. low energy BROOH while laying 200' of LCM pill in open hole w/100 gpm, 1020 psi, 20 rpm, 15 k ft/lbs trq, 25 ft/min f/18,680' to 18,580'. Maintain 13.2 ppg EMW. Rotating P/U wt 220 k / ROT wt 190 k. Pull BHA into shoe without rotation f/18,580' to 18,406'. Free P/U wt 270 k. Observe 30 k over pull while bit was coming thru the float shoe f/18,448' to 18,442'. Had to work multiple times to get BHA into the shoe. As it was pulling tight the tight restriction in the shoe induced formation losses. 18,680.0 18,406.0 2/16/2023 07:30 2/16/2023 21:30 14.00 INTRM4, TRIPCAS CIRC P Circ 9-7/8" x 13-5/8" casing clean w/650 gpm, 5040 psi, 80 rpm, 16 k ft/lbs trq. Rotating wt 198 k. Work thru float shoe 2X and clear. Had to reduce EMW f/13.2 ppg to 13.0 ppg to minimize losses. Reciprocate pipe staying above float shoe. SIMOPS - Blend OBM mud cap in tank farm to 12.5 ppg. Mobilize 12.5 ppg OBM mud cap from mud plant. Prep for displacement. Crane crew on location at 20:00 hrs. Fly Dril-Quip 7-5/8" liner hanger/packer assy to liner shuttle on pipe shed roof. 18,406.0 18,406.0 2/16/2023 21:30 2/17/2023 00:00 2.50 INTRM4, TRIPCAS DISP P Displace well to 12.5 ppg OBM mud cap w/500 gpm, 3335 psi. Reciprocate pipe w/80 rpm, 15 k ft/lbs trq, Rotating wt 196 k. Maintain 13.0 ppg EMW. 18,406.0 18,406.0 2/17/2023 00:00 2/17/2023 02:00 2.00 INTRM4, TRIPCAS DISP P Displace well to 12.5 ppg OBM mud cap w/500 gpm, 3335 psi. Reciprocate pipe w/80 rpm, 15 k ft/lbs trq, Rotating wt 196 k. Maintain 13.0 ppg EMW. 18,406.0 18,406.0 2/17/2023 02:00 2/17/2023 02:30 0.50 INTRM4, TRIPCAS OWFF P OWFF for 30 min (static). SIMOPS B/D top drive and prep to StripOOH 18,406.0 18,406.0 2/17/2023 02:30 2/17/2023 15:30 13.00 INTRM4, TRIPCAS SMPD P StripOOH maintain 13.0 ppg EMW f/18,406' to 9,222'. P/U wt 165 k. No losses observed. 18,406.0 9,222.0 2/17/2023 15:30 2/17/2023 16:00 0.50 INTRM4, TRIPCAS RURD P Remove PS-21's and install master bushings. Recover 3.5" hollow drift in last stand of 5-7/8" DP 9,222.0 9,222.0 2/17/2023 16:00 2/17/2023 16:30 0.50 INTRM4, TRIPCAS SMPD P StripOOH f/9,222' to 9,161'. Break out stand and drain in preparation for RCD bearing removal. M/U stand back up. 9,222.0 9,161.0 2/17/2023 16:30 2/17/2023 17:30 1.00 INTRM4, TRIPCAS OWFF P Shut down MPD back pressure pump and monitor well. Slight flow. Perform breathing test. Shut in MPD chokes and pressure build to 3 psi in 5 min. Open up and monitor for 20 min (Slight ooze). Shut in MPD chokes and pressure build to 3 psi in 5 min. Open up and monitor for 10 min (Slight ooze). Shut in MPD chokes and pressure build to 2 psi in 5 min. Open up and monitor for 10 min (Slight ooze). Well appears to be breathing or mud is out of balance. 9,161.0 9,161.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 64/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/17/2023 17:30 2/17/2023 20:15 2.75 INTRM4, TRIPCAS MPDA P POOH with 5-7/8" RCD bearing to 9,126'. Remove from stand for rebuild. Rack back stand of 5-7/8" DP . Pull out of hole double of 4-1/2" DP to 9,063. M/U 4-1/2" RCD bearing to double. Was not able to fully engage RCD bearing onto DP using RCD stand. Make two un -successful attempts and bearing was hung up on tool joint. Suspend trying to use stand and M/U to drill string and torque through. 4-1/2" RCD bearing is above rotary table. 9,161.0 9,063.0 2/17/2023 20:15 2/17/2023 22:30 2.25 INTRM4, TRIPCAS OWFF P Line up to trip tank and monitor well for flow. Monitor for 2 hours and cannot confirm well is static. Slightly oozing and not slowing down or gaining in speed. Mud appears to out of balance. Discuss plan forward operations with Drilling Superintendent. Decision mad to circulate surface to surface and condition mud. 9,063.0 9,063.0 2/17/2023 22:30 2/18/2023 00:00 1.50 INTRM4, TRIPCAS CIRC P Circulate and condition mud to 12.5 ppg w/500 gpm, 2930 psi. Rotate 10 rpm and reciprocate pipe 30' keeping RCD bearing above rotary table. Confirm mud is out of balance. Lightest mud wt observed going in is 12.3 ppg and lightest mud wt coming out is 12.0 ppg. 9,063.0 9,063.0 2/18/2023 00:00 2/18/2023 02:30 2.50 INTRM4, TRIPCAS CIRC P Circulate and condition mud to 12.5 ppg w/500 gpm, 2930 psi. Rotate 10 rpm and reciprocate pipe 30' keeping RCD bearing above rotary table. Confirm mud is out of balance. Lightest mud wt observed going in is 12.3 ppg and lightest mud wt coming out is 12.0 ppg. Circulated a total of 2 full circulations. 9,063.0 9,063.0 2/18/2023 02:30 2/18/2023 03:00 0.50 INTRM4, TRIPCAS OWFF P OWFF. Circulate for 15 min on trip tank. (static). Monitor well for 15 min from rotary table (static). 9,063.0 9,063.0 2/18/2023 03:00 2/18/2023 04:15 1.25 INTRM4, TRIPCAS MPDA P Install 4-1/2" RCD bearing. Circ through MPD system and calibrate. RIH f/9,063' to 9,127'. Break out of top drive and B/D top drive. 9,063.0 9,063.0 2/18/2023 04:15 2/18/2023 12:15 8.00 INTRM4, TRIPCAS SMPD P Drop 2.9" OD hollow drift. StripOOH maintaining 13.0 ppg EMW f/9,127' to 629' 9,127.0 629.0 2/18/2023 12:15 2/18/2023 12:45 0.50 INTRM4, TRIPCAS RURD P Remove stripping rubber from below rotary table. Kick while tripping drill. 629.0 629.0 2/18/2023 12:45 2/18/2023 14:15 1.50 INTRM4, TRIPCAS OWFF P Shut down MPD back pressure and open up 2" line to OBM tote. OWFF. Oozing for 60 min, then static. SIMOPS - Blow down MPD lines and prep to remove RCD bearing. Mobilize SLB source box and bit tongs to rig floor. 629.0 629.0 2/18/2023 14:15 2/18/2023 15:15 1.00 INTRM4, TRIPCAS MPDA P Pull 4-1/2" RCD bearing and rack back left on stand of DP f/629' to 534'. 629.0 534.0 2/18/2023 15:15 2/18/2023 21:30 6.25 INTRM4, TRIPCAS BHAH P L/D BHA as per SLB reps. Break out all subs and XO's. Inspect reamer and bit. XS2 Rhino Reamer had 2 chipped teeth on BROOH edge. Bit Grade: 0-0-NO-A- X-I-NO-TD 534.0 0.0 2/18/2023 21:30 2/18/2023 22:30 1.00 INTRM4, TRIPCAS BHAH P Clean and clear floor of BHA tools and equipment. 0.0 0.0 2/18/2023 22:30 2/19/2023 00:00 1.50 INTRM4, TRIPCAS CLEN P Scrub and clean rig floor from wet OBM trip. Prep rig floor for liner run. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 65/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/19/2023 00:00 2/19/2023 01:00 1.00 INTRM4, CASING WWWH P M/U stack washer and flush stack. Function annular and upper/lower pipe rams and flush second time. R/D stack washer. B/D top drive. 0.0 0.0 2/19/2023 01:00 2/19/2023 03:30 2.50 INTRM4, CASING RURD P R/U to run 7-5/8" liner. Double stack tongs, hand slips and 7-5/8" handling equipment. M/U 7-5/8" swage and safety valve. PJSM on running liner. 0.0 0.0 2/19/2023 03:30 2/19/2023 09:15 5.75 INTRM4, CASING PUTB P M/U shoe track and check floats (good). RIH picking up 7-5/8" 29.7# L-80 Hyd 523 Liner to 2,319'. Fill pipe with 11.5 ppg OBM via fill up hose. (Shoe track Bakerlok'd to the pin of jt 8, M/U torque 11,900 ft/lbs) 0.0 2,319.0 2/19/2023 09:15 2/19/2023 12:00 2.75 INTRM4, CASING PUTB P R/U liner hanger shuttle. P/U 7-5/8" x 9- 7/8" Dril-Quip liner hanger extender assy. R/D liner hanger shuttle. 2,319.0 2,319.0 2/19/2023 12:00 2/19/2023 12:15 0.25 INTRM4, CASING PUTB P Install liner wiper plugs on bottom of hanger. M/U hanger to liner and RIH to 2,376' 2,319.0 2,376.0 2/19/2023 12:15 2/19/2023 12:45 0.50 INTRM4, CASING RURD P R/D liner running tools and equipment. 2,376.0 2,376.0 2/19/2023 12:45 2/19/2023 13:30 0.75 INTRM4, CASING PULD P P/U working single from pipe shed and M/U bumper sub assy to top of liner hanger and RIH to 2,421' 2,376.0 2,421.0 2/19/2023 13:30 2/19/2023 14:00 0.50 INTRM4, CASING CIRC P Break circulation with 63 gpm / 150 psi. Fill pipe and confirm flow path thru liner running tools is clear. 2,412.0 2,421.0 2/19/2023 14:00 2/19/2023 14:30 0.50 INTRM4, CASING PULD P L/D working single f/2,421' to 2,390'. B/D top drive. 2,421.0 2,390.0 2/19/2023 14:30 2/19/2023 16:00 1.50 INTRM4, CASING MPDA P RIH 4-1/2" RCD bearing on first stand of 4-1/2" DP to 2,438'. Line up MPD equipment and function test. Collect T&D data. P/U wt 127k, S/O wt 121k, ROT wt 120k, 30 rpm, 2-3 k ft/lbs trq. 2,390.0 2,438.0 2/19/2023 16:00 2/19/2023 17:30 1.50 INTRM4, CASING RUNL P RIH w/7-5/8" liner on 4-1/2" DP while maintaining 13.0 ppg EMW f/2,438' to 3,434'. 2,438.0 3,434.0 2/19/2023 17:30 2/19/2023 17:45 0.25 INTRM4, CASING RURD P Remove master bushing and install PS- 21's. 3,434.0 3,434.0 2/19/2023 17:45 2/19/2023 23:30 5.75 INTRM4, CASING RUNL P RIH w/7-5/8" liner on 4-1/2" DP while maintaining 13.0 ppg EMW f/3,434' to 8,526'. SIMOPS - Load 435 jts 4-1/2" DP in pipe shed for next hole section. 3,434.0 8,526.0 2/19/2023 23:30 2/20/2023 00:00 0.50 INTRM4, CASING OWFF P OWFF (static). Draw down MPD back pressure and shut down pump. SIMOPS - PJSM on removing RCD bearing and prep rig floor. 8,526.0 8,526.0 2/20/2023 00:00 2/20/2023 01:30 1.50 INTRM4, CASING MPDA P Pull 4-1/2" RCD bearing and remove from DP. Install 5-7/8" bearing on first stand of 5-7/8" DP to 8,570'. Function test MPD equipment. Collect T&D data. P/U wt 159 k, S/O wt 126 k, ROT wt 145 k , 30 rpm, 6-8 k ft/lbs trq 8,526.0 8,570.0 2/20/2023 01:30 2/20/2023 06:00 4.50 INTRM4, CASING RUNL P RIH 7-5/8" liner on 5-7/8" DP maintaining 13.0 ppg EMW f/8,570' to 11971',. SIMOPS - Load 435 jts 4-1/2" DP in pipe shed for next hole section. 8,570.0 11,971.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 66/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/20/2023 06:00 2/20/2023 06:30 0.50 INTRM4, CASING RUNL P RIH 7-5/8" liner on 5-7/8" DP maintaining 13.0 ppg EMW F/11971' T/ 12333',. SIMOPS - Load 435 jts 4-1/2" DP in pipe shed for next hole section. Monitor Displacement at pit #1, Filling every joint and Topping off every 5 Stands. 11,971.0 12,333.0 2/20/2023 06:30 2/20/2023 06:45 0.25 INTRM4, CASING RUNL P Obtain Torque and Drag @ 12333' MD prior to entering 9 7/8" liner top. P/U 206K S/O 155K @ 15 FPM RTW 182K TQ 8-10K @ 30 RPM. 12,333.0 12,333.0 2/20/2023 06:45 2/20/2023 11:45 5.00 INTRM4, CASING RUNL P RIH 7-5/8" liner on 5-7/8" DP maintaining 13.0 ppg EMW W/ MPD f/12333' to 14786' Slow to 17 FPM @ 14000' ,. SIMOPS - Load 435 jts 4-1/2" DP in pipe shed for next hole section. Monitor Displacement at pit #1, Filling every joint and Topping off every 5 Stands. 12,333.0 14,786.0 2/20/2023 11:45 2/20/2023 12:00 0.25 INTRM4, CASING RUNL T Encountered a Restriction @ 14786' W/30K Loss in hook load. P/U t/ 14774' MD Attempt to RIH Encountered same Restrictions @ 14786' 30K loss in hook load. 14,786.0 14,786.0 2/20/2023 12:00 2/20/2023 12:30 0.50 INTRM4, CASING RUNL T Rotate @ 5 RPM 10K TQ 189 RTW Ream Down F/ 14774' T/ 14803' MD 154K RTW Down, Stop Rotary @ 14803' MD and Attempt to RIH . Loss 321 K Hook Load @ 14806 MD 14,786.0 14,806.0 2/20/2023 12:30 2/20/2023 13:30 1.00 INTRM4, CASING RUNL T Pull up T/ 14803' MD @ 5 RPM ,10-14K TQ 187K RTW, Ream Down T/ 14807' MD, Top Drive Stalled @ 20K & 130K Hookload, Release torque , Pull up T/ 14795' MD attempted second time with same Results at same depth of 14807' Release Torque Pull up T/ 14803' MD 14,806.0 14,803.0 2/20/2023 13:30 2/20/2023 13:45 0.25 INTRM4, CASING RUNL T Attempt T/ RIH w/ No Rotary F/ 14803' T/ 14807' MD Set 50K down. Hook Load 100K Attempt 2 time with same result. 14,803.0 14,807.0 2/20/2023 13:45 2/20/2023 16:00 2.25 INTRM4, CASING RUNL T POOH T/ 14781' MD 250K P/U Consult Town 14,807.0 14,781.0 2/20/2023 16:00 2/20/2023 16:15 0.25 INTRM4, CASING RUNL T Rotate Down @ 7 FPM. F/ 14781' T/ 14844' MD @ 25 RPM, 12-14K TQ, 198K RTW 178K Rot Down Wt. Observed WOB 5-7K, @ 14801' 27K WOB, 14807' 20K WOB, 14811' 22K WOB, 14814' 20K WOB, 14831' 18K WOB, Torque Dropped T/ 10K Rot Down Wt Increased T/ 182K @ 14844' MD 14,781.0 14,844.0 2/20/2023 16:15 2/20/2023 18:00 1.75 INTRM4, CASING RUNL P RIH 7-5/8" liner on 5-7/8" DP maintaining 13.0 ppg EMW W/ MPD F/14844 T/ 15770' MD',. Monitor Displacement at pit #1, Filling every joint and Topping off every 5 Stands. w/ 11.5 PPG mud. 14,844.0 15,770.0 2/20/2023 18:00 2/20/2023 21:45 3.75 INTRM4, CASING RUNL P RIH F/ 15770' MD T/ 17540' MD W/ 5 7/8" Liner on 5 7/8" DP Out of Derrick SOW=165K MPD maintain 13.0 PPG EMW Monitor pipe Displacement at #1 pit. Fill Pipe from #5 Pit. Fill pipe every Jt. and Top off every 5 stands W 11.5 PPG mud 15,770.0 17,540.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 67/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/20/2023 21:45 2/20/2023 23:00 1.25 INTRM4, CASING OTHR P @ 17540' MD Stage Down MPD pump and Trap Pressure, Offload 12.5 PPG OBM F/ Pit #1 and #2 T/ Tank Farm, Load Pits #4, #5, #7 W/ 11.5 PPG OBM T/ continue RIH W/ Liner in Open hole. 17,540.0 17,540.0 2/20/2023 23:00 2/21/2023 00:00 1.00 INTRM4, CASING RUNL P RIH F/ 17540' MD T/ 17806' MD W/ 7 5/8" casing & TIW liner Hanger on 5 7/8" DP out of Derrick, Drift last 29 Stands of 5 7/8" DP W/ 2.90" Drift. SOW 165K MPD maintain 13.0 PPG EMW, Monitor pipe Displacement at #1 Pit and Pipe Displacement #5 Pit. Fill every jt. . Top off every 5 Stands W/ 11.5 PPG OBM MAgnet Weight for Past 24 Hrs= 1 LB Formation losses last 24 hrs = 0 17,540.0 17,806.0 2/21/2023 00:00 2/21/2023 01:30 1.50 INTRM4, CASING RUNL P RIH F/ 17806' MD T/ 18408' MD W/ 7 5/8" casing & TIW liner Hanger on 5 7/8" DP out of Derrick, Drift last 29 Stands of 5 7/8" DP W/ 2.90" Drift. SOW 165K MPD maintain 13.0 PPG EMW, Monitor pipe Displacement at #1 Pit and Pipe Displacement #5 Pit. Fill every jt. . Top off every 5 Stands W/ 11.5 PPG OBM 17,806.0 18,408.0 2/21/2023 01:30 2/21/2023 02:15 0.75 INTRM4, CASING CIRC P @ 18408' MD Verify Floats are clear @ 1 BPM 765 psi Collect Torque and Dram Values P/U 281K S/O 167K RTW 208K W/ 30 RPM, TQ/21K MPD Maintain 13.0PPG ECD 18,408.0 18,408.0 2/21/2023 02:15 2/21/2023 06:15 4.00 INTRM4, CASING RUNL P RIH F/ 185408' MD T/ 20406' MD W/ 7 5/8" casing & TIW liner Hanger on 5 7/8" DP out of Derrick, Drift last 29 Stands of 5 7/8" DP W/ 2.90" Drift. SOW 165K MPD maintain 13.0 PPG EMW, Monitor pipe Displacement at #1 Pit and Pipe Displacement #5 Pit. Fill every jt. . Top off every 5 Stands W/ 11.5 PPG OBM 18,408.0 20,406.0 2/21/2023 06:15 2/21/2023 07:00 0.75 INTRM4, CASING RUNL P P/U & M/U 30.85' Single off Top Stand #220 From Drill pipe Tally. P/U and M/U 9.87' 5 7/8" Pup Jt. RIH F/ 20406' T/ 20446' MD S/O 163K 20,406.0 20,446.0 2/21/2023 07:00 2/21/2023 07:30 0.50 INTRM4, CASING RUNL P M/U Top=Drive and P/U T/ 20439' MD Break Over /PUW 284K and Tag Bottom @ 20448' MD S/O W/ 10K P/U T/ 20483' MD 20,446.0 20,448.0 2/21/2023 07:30 2/21/2023 08:00 0.50 INTRM4, CEMENT CIRC P @ 20438' MD Rotate @ 20 RPM, 215K RTW 20K TQ & Circulate Staging Pumps Up F/ 50 GPM & 450 PSI - T/100 GPM & 800 PSI While Holding Back Pressure W/ MPD. Once we Had Returns, Shut off Rotary. 20,448.0 20,448.0 2/21/2023 08:00 2/21/2023 11:30 3.50 INTRM4, CEMENT CIRC P Circulate @ 100 GPM 750 PSI & Stage pumps up per Circulation Schedule @ 6500 Strokes Pumped, 214 GPM & 1076 PSI observed Losses @ 1 BPM, Staged Flow Rate Down Attempting to Match flow Out. 20,448.0 20,438.0 2/21/2023 11:30 2/21/2023 12:00 0.50 INTRM4, CEMENT CIRC P @ 1 BPM & 870 PSI Observed no returns, Pumps 30 GPM @ 846 PSI and Rotate @ 15 RPM, B/O Torque 38K, TQ= 20-24K Observe Little to No Returns 20,438.0 20,438.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 68/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/21/2023 12:00 2/21/2023 14:15 2.25 INTRM4, CEMENT CIRC P Stage Pumps up F/ 30 GPM and 846 PSI T/ 42 GPM And 870 PSI While Rotating @ 15 RPM and 23K TQ, Stage Pump up T/ 51 GPM and 890 psi, Once Full returns were Seen String Torque Up and Stalled out @ 38K. Released Torque and Staged Pumps Down to 30 GPM and 864 PSI W/ Little to No returns. Consult with Engineers in Town. 20,438.0 20,438.0 2/21/2023 14:15 2/21/2023 15:00 0.75 INTRM4, CEMENT CIRC P Pump @ 30 GPM 865 psi, Rotate @ 25 RPM String Broke Free @ 39K TQ. Stage Pumps up to 42 GPM and 870 20,438.0 20,438.0 2/21/2023 15:00 2/21/2023 15:15 0.25 INTRM4, CEMENT RUNL P RIH W/ No Pumps F/ 20438' to 20445' MD S/O 138K 20,438.0 20,445.0 2/21/2023 15:15 2/21/2023 15:30 0.25 INTRM4, CEMENT RURD P Blow Down Top Drive, Change out Elevators. 20,445.0 20,445.0 2/21/2023 15:30 2/21/2023 16:30 1.00 INTRM4, CEMENT RURD P PJSM, P/U Citadel Cement Head, M/U Plug Valve while in Elevators & Still on Skate 20,445.0 20,445.0 2/21/2023 16:30 2/21/2023 18:00 1.50 INTRM4, CEMENT RUNL P R/U Cement Hoses, Sensors & valves T/ Cement Head. 20,445.0 20,445.0 2/21/2023 18:00 2/21/2023 20:45 2.75 INTRM4, CEMENT RUNL P PJSM, R/D Citadel Hydraulic 3" valve, install 2" Block valve and High pressure 2" Cement Line and valves. Trouble Shoot SLM Cement Pump. Prep Mud Pits for Cement Job. 20,445.0 20,445.0 2/21/2023 20:45 2/21/2023 21:45 1.00 INTRM4, CEMENT CMNT P PJSM, Pump 60 BBLS 13.2 PPG Mud Push, SLB Pump 5 BBLS H2O, Pressure Test Lines T/ 3500 PSI @ 21:15 hrs, Drop Lead Wiper Dart #1 Chase W/ 84 BBLS 15.8 PPG Cement @ 4 BPM 790 PSi ( No Returns) @ 21:40 Drop Tail Wiper Dart #2, Chase W/ 20 BBLS H2O Swap T/ Rig Pumps and Blow Down Cement Line T/ Cement Unit. 20,445.0 20,445.0 2/21/2023 21:45 2/22/2023 00:00 2.25 INTRM4, CEMENT CMNT P Begin T/ Pump 11.5 PPG NAF W/ Rig Pump W/ Rig Pump @ 2.5 BBL @ 660 PSI ( No Returns), @ 810 Strokes away 22:25 hrs, Drop BOZO Dart and continue Chasing @ 2.5 BPM 948 PSI. Increase T/ 3.5 BPM 1021 PSI ( Very Minor Returns) Reduce Flow Rate @ 2560 Strokes T/ 2 BPM 1035 PSI @ 2715 Strokes, No Shear Indication of Bottom With Dart Wiper #1 Total Losses to Formation For Past 24 Hrs 434 BBLS, Magnet Weight For Past 24 Hrs 1 LBS 20,445.0 20,455.0 2/22/2023 00:00 2/22/2023 01:00 1.00 INTRM4, CEMENT CMNT P No Indication of bottom Dart Shear. @ 3,827 Strokes away Pressure increased T/ 2,455 PSI Talked W/ Town Pressure up T/ 2,800 PSI Observed pressure Drop T/ 735 PSI W/ God Indication #2 Wiper Dart Latch Sheared 20,455.0 20,445.0 2/22/2023 01:00 2/22/2023 01:15 0.25 INTRM4, CEMENT THGR P Bump The plug on Time @ 2BPM 1,054 PSI @ 4,568 Strokes away, Pressure up T/ 1,570 PSI F/ 5 MIN 20,445.0 20,445.0 2/22/2023 01:15 2/22/2023 02:30 1.25 INTRM4, CEMENT THGR P @ 20,445' MD Pressure up T/ 4400 PSI @ Shear Setting Ring Pick up T/ 345K W/ 75K OverPull and Slack Back off T/ 135K . TOL= 18,103' MD 20,445.0 20,445.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 69/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/22/2023 02:30 2/22/2023 03:15 0.75 INTRM4, CEMENT THGR P PJSM, R/U & Test Top of 7 5/8" T/ 2,000 PSI 20,445.0 20,445.0 2/22/2023 03:15 2/22/2023 04:45 1.50 INTRM4, CEMENT RURD P PJSM,Blow Down Cement Line and R/D Cement Head as Per Citadel Rep. 20,445.0 20,445.0 2/22/2023 04:45 2/22/2023 05:00 0.25 INTRM4, CEMENT RURD P C/O Handling Equip.T/ 5 7/8" 20,445.0 20,445.0 2/22/2023 05:00 2/22/2023 05:30 0.50 INTRM4, CEMENT THGR P P/U T/ 271K Observe Break over weight T/250K Confirm Expansion Pins Shear Presssure Up T/ 6,586 PSI & Blow Ball/Seat Obtain returns to Shakers 20,445.0 18,103.0 2/22/2023 05:30 2/22/2023 06:00 0.50 INTRM4, CEMENT RURD P L/D 10' 5-7/8" Space Out Pup. 18,093.0 18,093.0 2/22/2023 06:00 2/22/2023 06:15 0.25 INTRM4, CEMENT RURD P Finish Breaking out Single L/D 10' Pup 18,093.0 18,061.0 2/22/2023 06:15 2/22/2023 06:30 0.25 INTRM4, CEMENT RURD P Line Up MP #4 Through MPD to Monitor Well, B/D Top-Drive 18,061.0 18,061.0 2/22/2023 06:30 2/22/2023 07:00 0.50 INTRM4, CEMENT TRIP P M/U Stand #220 From Drilling BHA #6 Rack Back in Derrick 18,063.0 17,969.0 2/22/2023 07:00 2/22/2023 07:15 0.25 INTRM4, CEMENT OTHR P Change Bit Depth F/20405' to 18061' BHA Length Changed F/2392.38' T/49.00' Per TIW Liner REP. POOH on Elevators F. 18601' T/ 17968' MD Drain Stand For Pulling Bearing. 17,969.0 17,968.0 2/22/2023 07:15 2/22/2023 07:30 0.25 INTRM4, CEMENT RURD P Remove PS-21 Slips Install Master Bushings 17,968.0 17,968.0 2/22/2023 07:30 2/22/2023 08:00 0.50 INTRM4, CEMENT OWFF P B/D Top-Drive Monitor Well PJSM. 17,968.0 17,968.0 2/22/2023 08:00 2/22/2023 09:00 1.00 INTRM4, CEMENT MPDA P PJSM Remove 5 7/8" MPD Bearing. 17,968.0 17,968.0 2/22/2023 09:00 2/22/2023 12:00 3.00 INTRM4, CEMENT CIRC P Install Wiper Ball, M/U Top-Drive Circulate and Reciprocate F/ 17968'to 18063' @ 630 GPM 17,968.0 18,063.0 2/22/2023 12:00 2/22/2023 13:15 1.25 INTRM4, CEMENT CIRC P Install 2nd Wiper Ball After 1st B/U. Cont Circulate and Reciprocate F/ 18063 to/ 17968' @ 630 GPM Total Strokes Pumped 28000. 18,063.0 17,968.0 2/22/2023 13:15 2/22/2023 13:45 0.50 INTRM4, CEMENT OWFF P B/D Top-Drive & monitor Well F/30 Min 17,968.0 17,968.0 2/22/2023 13:45 2/22/2023 14:30 0.75 INTRM4, CEMENT RURD P R/U For Casing Test 17,968.0 17,968.0 2/22/2023 14:30 2/22/2023 16:00 1.50 INTRM4, CEMENT PRTS P Test 7 5/8" Casing and Liner T/3500 PSI F/ 30 Min Total Strokes Pumped 326 =32.6 BBLS Returned 31.5 BBLS 17,968.0 17,968.0 2/22/2023 16:00 2/22/2023 16:45 0.75 INTRM4, CEMENT RURD P R/D Casing Test Equip. Blow Down Choke and Kill Lines. 17,968.0 17,968.0 2/22/2023 16:45 2/22/2023 17:15 0.50 INTRM4, CEMENT RURD P POOH on Elevators F/ 18061' to 17968' Pull Master Bushing Install PS-21 Slips PUW 265K Pull PS-21 due to offset at rotary. 17,968.0 17,968.0 2/22/2023 17:15 2/22/2023 17:30 0.25 INTRM4, CEMENT CIRC P M/U Top-Drive & Pup Dry Job @ 6 BPM @ 800 PSI. 17,968.0 17,968.0 2/22/2023 17:30 2/22/2023 18:00 0.50 INTRM4, CEMENT RURD P B/D Top-Drive Line Up on Trip Tank 17,968.0 17,968.0 2/22/2023 18:00 2/23/2023 00:00 6.00 INTRM4, CEMENT TRIP P POOH W/ TIW Running tools F/ 17968' T/ 11845' RAcking Pipe Back in Derrick . P/U 204K Monitoring Well ViaTrip Tank. Formation Losses Last 24 hrs 303 BBLS Magnet Weight 1.2 lb 17,968.0 11,845.0 2/23/2023 00:00 2/23/2023 06:00 6.00 INTRM4, CEMENT TRIP P POOH W/ TIW Running Tool W/ 4 1/2" x 5 7/8" F/ 11845' T/ 2408 11,845.0 2,408.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 70/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/23/2023 06:00 2/23/2023 06:30 0.50 INTRM4, CEMENT TRIP P Cont. POOH W 4 1/2" Drill Pipe F/ 2408' T 2248' PUW 107K 2,408.0 2,248.0 2/23/2023 06:30 2/23/2023 07:00 0.50 INTRM4, CEMENT OWFF P Remove Master Bushing & Remove 2 Stripping Rubbers From Under Bushings. Monitor Well F/ 10 Min Due to Improper Hole Fill. 2,248.0 2,248.0 2/23/2023 07:00 2/23/2023 08:15 1.25 INTRM4, CEMENT TRIP P Cont. POOH W/ 4 1/2" DP F/ 2248' T/ 237' MD 2,248.0 237.0 2/23/2023 08:15 2/23/2023 08:30 0.25 INTRM4, CEMENT OWFF P @ 237' Shut off hole Fill and Monitor Well. Well Static 237.0 237.0 2/23/2023 08:30 2/23/2023 09:00 0.50 INTRM4, CEMENT TRIP P Cont. POOH W/ 4 1/2" DP, F/ 237' T/ 60' 237.0 60.0 2/23/2023 09:00 2/23/2023 10:00 1.00 INTRM4, CEMENT BHAH P P/U Working Single T/ Cross over to Hanger. POOH W/ Hanger. L/D Cross over and Pup Jt. 60.0 0.0 2/23/2023 10:00 2/23/2023 12:00 2.00 INTRM4, CEMENT CLEN P Clean/Prep Hanger Running Tools For Shipment & L/D skate 0.0 0.0 2/23/2023 12:00 2/23/2023 14:00 2.00 INTRM4, CEMENT CLEN P Clean and Clear Rig Floor of Oil Base Mud Prior Cutting Drill Line 0.0 0.0 2/23/2023 14:00 2/23/2023 18:00 4.00 INTRM4, CEMENT SLPC P PJSM Hang Blocks, Slip and Cut 141.3' Drill Line, Unhang Blocks Calibrate Blocks and Check COM. 0.0 0.0 2/23/2023 18:00 2/23/2023 18:30 0.50 INTRM4, WHDBOP WWSP P P/U 2 Jts 5" Drill Pipe, M/U Wear Bushing Puller RIH Pull Wear Bushing. 0.0 0.0 2/23/2023 18:30 2/23/2023 19:30 1.00 INTRM4, WHDBOP WWSP P Attempt to Drain Stack no able Due to Wear Bushing Location. 0.0 0.0 2/23/2023 19:30 2/23/2023 20:30 1.00 INTRM4, WHDBOP WWSP P RIH Pull Wear Bushing With Out Draining Stack. L/D Pulling Tools 0.0 0.0 2/23/2023 20:30 2/23/2023 21:00 0.50 INTRM4, WHDBOP WWWH P C/O Elevators and Pick-up 1 STD 5 7/8" Drill Pipe, M/U Stack Washer Tool to Stand 0.0 0.0 2/23/2023 21:00 2/23/2023 23:30 2.50 INTRM4, WHDBOP WWWH P Cycle Annular, Upper and Lower VBR's , Flush BOPE W/ OBM . Drain BOPE, Flush BOPE w/ Deep Clean, Drain BOPE and Blow Down Top Drive, Kill and Choke Lines. Mobilize Testing Tools and Equip. 0.0 0.0 2/23/2023 23:30 2/24/2023 00:00 0.50 INTRM4, WHDBOP BOPE P P/U and M/U 5 7/8" Test Joint and Test Plug 0.0 0.0 2/24/2023 00:00 2/24/2023 02:00 2.00 INTRM4, WHDBOP BOPE P P/U & M/U 5 7/8" Test Jt. and Test Plug , RIH and Set Test Plug. R/U BOP Test Equipment and Fluid Pack lines. 0.0 0.0 2/24/2023 02:00 2/24/2023 12:00 10.00 INTRM4, WHDBOP BOPE P Perform BOPE Tests W/ 4 1/2" and 5 7/8" Test Jts, Annular 250L 5 MIn/ 2500H 10Min on chart. Remaining Test 250L 5 Min 4000H 10 Min Charted, Upper 4 1/2" X 7 5/8" VBRS, Lower 3 1/2" x 6 5/8" VBRS, CMV #1-#16 Manual & HCR Choke/KIll and Kill Valve #3, Upper and Lower IBOPS, 5 7/8" and 6 5/8" TIW and Dart Valves, Blinds Shears, Conduct Koomey Draw Down Test ACC=3050 psi, MANIF=1500 psi ACC= 1650 psi after all functions on bottles, 26 Sec for 200 psi. Build W/ 2 Elec Pumps, 151 Sec T/ full System pressure W/2 Elec and Air Pumps.Closing Times Ann= 21 sec, UPR=17 sec, Blind Shears=18 sec, LPR=18 sec, Choke HCR=2 sec, Kill HCR= 2 sec, Test PVT Gain /Loss and Flow out Alarms. Test LEL and H2S alarms Witness By AOGCC Rep Guy Cook 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 71/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/24/2023 12:00 2/24/2023 19:30 7.50 INTRM4, WHDBOP BOPE T Found Leak On Door Seal Hinge Assy on upper Rams. Drain Stack, Close Blind Rams Power Down Koomey Unit. Prep to Change Ram Door Hinge Assy. Clean and Clear Rig Floor Prep to P/U BHA #7, Replaced Upper Ram Door Hinge seal Assy. Pressured up Koomey System No Leaks. 0.0 0.0 2/24/2023 19:30 2/24/2023 20:00 0.50 INTRM4, WHDBOP BOPE T Set 4 1/2" Test Jt. as Per SOP Fill Stack W/H2O Flood Surface Lines, Close Upper VBRS. Notice Hydraulic Leak Coming From Upper Ram Door Hinge Assy. 0.0 0.0 2/24/2023 20:00 2/24/2023 21:00 1.00 INTRM4, WHDBOP BOPE T Drain Stack, Shut Blind Rams, Blow Down Test Lines, Power Down Koomey, Prep For Door Hinge Removal 0.0 0.0 2/24/2023 21:00 2/24/2023 23:30 2.50 INTRM4, WHDBOP BOPE T PJSM Remove Upper Ram Door ODS, Inspect Hinge Coupling/ O-rings F/ Potential Leaks, Cont. Trouble Shoot Hinge Leak. 0.0 0.0 2/24/2023 23:30 2/25/2023 00:00 0.50 INTRM4, WHDBOP BOPE T Energize Koomey Unit, Lower 5 7/8" Test Jts, Function Test and Inspect upper Pipe Ram Door Hinge For Leaks Formation Losses 0 Magnet Weight 0 0.0 0.0 2/25/2023 00:00 2/25/2023 02:30 2.50 INTRM4, WHDBOP BOPE T Pressure up Accumulator, Observed Door Hinge Leak, Remove Upper Pipe ram door. Inspect and Found damaged O-ring, Install New O-ring, Install Upper ram door. function Test W/ Low 1500 psi and High 3000 psi (No leaks) 0.0 0.0 2/25/2023 02:30 2/25/2023 03:15 0.75 INTRM4, WHDBOP BOPE P Fluid Pack Test Equipment , Test upper 4 1/2" x 7 5/8" VBRS W/ 4.5" Test Jt. 250L F/ 5 Min 4000H F/ 10 Min. SIMOPS Mobilize BHA #7 to rig Floor as Per SLB DD. Perform Derrick Inspection 0.0 0.0 2/25/2023 03:15 2/25/2023 03:45 0.50 INTRM4, WHDBOP RURD P R/D Test Equipment, Drain BOPE Pull Test Plug and Blown Down Test Lines 0.0 0.0 2/25/2023 03:45 2/25/2023 05:00 1.25 INTRM4, WHDBOP WWSP P R/U and M/U Wear Bushing Running Tool RIH Set Wear Bushing Screw in Lock Down Pins as Per Cameron Procedure. R/D Running Tool. 0.0 0.0 2/25/2023 05:00 2/25/2023 06:00 1.00 INTRM4, DRILLOUT BHAH P PJSM P/U BHA #7 as per SLB DD & MWD F/ 0 to 66' 0.0 66.0 2/25/2023 06:00 2/25/2023 11:30 5.50 INTRM4, DRILLOUT BHAH P M/U BHA #7 F/ 66' To 213' Monitor Returns Via PIT #1 66.0 213.0 2/25/2023 11:30 2/25/2023 12:00 0.50 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Shed F/ 213' to 685' P/U 94K Monitor Displacement Via #1 Pit 213.0 685.0 2/25/2023 12:00 2/25/2023 15:00 3.00 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Shed F/ 685' to 3050' P/U 106K Monitor Displacement Via #1 Pit Filling Pipe Every 3000' 685.0 3,050.0 2/25/2023 15:00 2/25/2023 16:00 1.00 INTRM4, DRILLOUT CIRC P Fill Pipe, Shallow Test MWD Tools @ 200 GPM 1402 PSI Blow Down Top Drive (Good Shallow Hole test) 3,050.0 3,050.0 2/25/2023 16:00 2/25/2023 18:00 2.00 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Shed F/ 3050' to 4600' P/U 124K Monitor Displacement Via #1 Pit Filling Pipe Every 3000' 3,050.0 4,600.0 2/25/2023 18:00 2/26/2023 00:00 6.00 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Shed F/ 4600' to 8418' S/O 124K Monitor Displacement Via #1 Pit Filling Pipe Every 3000' 4,600.0 8,418.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 72/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/26/2023 00:00 2/26/2023 00:30 0.50 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Shed F/ 8418' T/ 8718' MD S/O 121K Monitor Displacement Via #1 Pit Filling Pipe Every 3000' ( Swapped out 4 Jts of 4.5" DP) 8,418.0 8,718.0 2/26/2023 00:30 2/26/2023 01:15 0.75 INTRM4, DRILLOUT CIRC P @ 8718' MD Test MWD Tools 202 GPM 1631 PSI 3% F/O ( Blow Down Top- Drive) 8,718.0 8,718.0 2/26/2023 01:15 2/26/2023 04:30 3.25 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Shed F/ 8718'T/ 11496' MD S/O 121K Monitor Displacement Via #1 Pit Filling Pipe Every 3000' ( Swapped out 4 Jts of 4.5" DP) 8,718.0 11,496.0 2/26/2023 04:30 2/26/2023 05:00 0.50 INTRM4, DRILLOUT CIRC P @ 11496' MD Finished Picking Up Singles, Test MWD Tools 202 GPM 1760 PSI 3% F/O ( Blow Down Top- Drive) Prep to Run 4.5" Drill Pipe Stands From Derrick 11,496.0 11,496.0 2/26/2023 05:00 2/26/2023 09:00 4.00 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Derrick F/11496' T/ 16877' MD S/O 170K Monitor Displacement Via #1 Pit Filling Pipe Every 3000' 11,496.0 16,877.0 2/26/2023 09:00 2/26/2023 10:15 1.25 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 16877' T/ 17063' MD w/ 4.5" DP f/ Derrick GPM=225, 2445 PSI, 6% F/O SOW 144K 16,877.0 17,063.0 2/26/2023 10:15 2/26/2023 10:45 0.50 INTRM4, DRILLOUT TRIP P RIH w/ 4.5" Drill Pipe F/ Derrick F/17063' T/ 17355' MD S/O 141K Monitor Displacement Via #1 Pit 17,063.0 17,355.0 2/26/2023 10:45 2/26/2023 12:00 1.25 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 17355' T/ 17590' MD w/ 4.5" DP f/ Derrick GPM=225, 2445 PSI, 6% F/O SOW 147K C 17,355.0 17,590.0 2/26/2023 12:00 2/26/2023 14:30 2.50 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/17063' T/ 18084' MD w/ 4.5" DP f/ Derrick GPM=225, 2445 PSI, 6% F/O SOW 147K Tag POB @ 18084' MD Set Down 10K P/U 210K S/O 145K 17,063.0 18,084.0 2/26/2023 14:30 2/26/2023 16:30 2.00 INTRM4, DRILLOUT DRLG P Drill Out POB F/18084' T/18100' MD W/ 4.5" Drill Pipe RPM=70 TQ=12K WOB=6-8 F/O=4% GPM 225 PSI=2566 Ream through 3X Drift Through 3x Times 18,084.0 18,100.0 2/26/2023 16:30 2/26/2023 18:00 1.50 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 18084' T/ 18263' MD w/ 4.5" DP f/ Derrick GPM=225, PSI= 2466 S/O 147K 18,084.0 18,263.0 2/26/2023 18:00 2/26/2023 20:00 2.00 INTRM4, DRILLOUT BKRM P Ream Up F/18263' T/ 18196' MD RT=168K RPM-=30 WOB=8-12K GPM=224 PSI=2457 F/O 3% 18,263.0 18,196.0 2/26/2023 20:00 2/26/2023 22:15 2.25 INTRM4, DRILLOUT TRIP P TOOH F/ 18196' T/ 16407' MD P/U 214K 18,196.0 16,407.0 2/26/2023 22:15 2/27/2023 00:00 1.75 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 16407' T/ 16689' MD w/ 4.5" DP F/ Derrick GPM=225, PSI= 2445I, 6% F/O SOW 147K No Losses last 24Hrs. Magnets Last @ 24Hrs 2 Lbs 16,407.0 16,689.0 2/27/2023 00:00 2/27/2023 03:45 3.75 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 16689' T/ 17440' MD w/ 4.5" DP F/ Derrick GPM=225, PSI= 2445I, 6% F/O SOW 147K 16,689.0 17,440.0 2/27/2023 03:45 2/27/2023 05:30 1.75 INTRM4, DRILLOUT WASH P Wash Down F/ 17440' T/ 18425' MD W/ 4.5" Drill Pip Out Derrick S/O 141K P/U 216K GPM 20 PSI 760 F/O 2% 17,440.0 18,425.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 73/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/27/2023 05:30 2/27/2023 06:00 0.50 INTRM4, DRILLOUT REAM P @ 18425' Set Down Weight 10K x2, Start To Ream Down @ 18425 F/ To 18477 18,425.0 18,477.0 2/27/2023 06:00 2/27/2023 12:00 6.00 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 18477' T/ 19803' MD w/ 4.5" DP F/ Derrick GPM=225, PSI= 2600I, 4% F/O SOW 144K 18,477.0 19,803.0 2/27/2023 12:00 2/27/2023 14:00 2.00 INTRM4, DRILLOUT DLOG P RIH Logging W/ Sonic F/ 19803' T/ 20126' MD w/ 4.5" DP F/ Derrick GPM=225, PSI= 2600I, 4% F/O SOW 144K 19,803.0 20,126.0 2/27/2023 14:00 2/27/2023 18:00 4.00 INTRM4, DRILLOUT DRLG P Tag Top of Plugs @ 20126' Drill Upper and Lower Plugs. GPM 225 PSI 2845 RPM 40-60 TQ 6-18K WOB 6-18K Working Pipe as Needed 20,126.0 20,126.0 2/27/2023 18:00 2/28/2023 00:00 6.00 INTRM4, DRILLOUT DRLG P Cont. Drill F/ 20126' T/ 20177' MD Drill Upper and Lower Plugs, Drill Dril-Quip Landing Collar @ 20129' MD And Cement As Directed By SLB DD. GPM 225, PSI 2845, RPM 40-60, TQ 6-18K, WOB 6-18K Working Pipe as Needed Formation Losses Last 24 Hrs. 0 Magnet Weight For past 24 HRs. 20,126.0 21,177.0 2/28/2023 00:00 2/28/2023 06:00 6.00 INTRM4, DRILLOUT DLOG P F/ 20177' T/ 20317' MD Ream Down Cement Sonic Log Every Stand Drill Down. GPM=200 PSI=2690. F/O 4% RPM=40-70. TQ=11-19K. WOB=6-18K Work Pipe as Needed. 20,177.0 20,317.0 2/28/2023 06:00 2/28/2023 11:00 5.00 INTRM4, DRILLOUT DLOG P F/20317' T/ 20390' MD Ream Down Cement Sonic Log Every Stand Drill Down. GPM=200 PSI=2690. F/O 4% RPM=40-70. TQ=11-19K. WOB=6-18K Work Pipe as Needed. 20,317.0 20,390.0 2/28/2023 11:00 2/28/2023 12:00 1.00 INTRM4, DRILLOUT RGRP P PJSM Install MPD Bearing, Change Out MWD sensor on Top-Drive Goose Neck 20,390.0 20,390.0 2/28/2023 12:00 2/28/2023 13:30 1.50 INTRM4, DRILLOUT RGRP P Cont. Change Out MWD sensor on Top -Drive Goose Neck. Clean Clear Rig Floor. Isolate and Test Pulsation Dampener on #2 Pump. No Test. 20,390.0 20,390.0 2/28/2023 13:30 2/28/2023 19:15 5.75 INTRM4, DRILLOUT CIRC P Displace Well W/ 10. PPG Flo Pro GPM=250, PSI=2270, RPM=40, TQ=13K F/O 5%, @ 6000 Strokes Drop 1.75" Well Commander Ball #1 to Open Well Commander, Ball on Seat @ 8000 Strokes, Shear @ 2650 PSI =,GPM=250, F/O 20% RPM=40, TQ=11. Cont. Displacement W/ Well Commander Open GPM=600 PSI=2614 Flow=20% Total Strokes Pumped 29,461, Total Interface 450 BBLS 20,390.0 20,390.0 2/28/2023 19:15 2/28/2023 19:45 0.50 INTRM4, DRILLOUT OWFF P @ 20366' MD Perform Casing in Flow Gas Test F/ 11.1 PPG to 10. PPG EMW (Static) 20,366.0 20,366.0 2/28/2023 19:45 3/1/2023 00:00 4.25 INTRM4, DRILLOUT CLEN P Clean and Transfer all 11.0 PPG NAF F/ Mud Pits, Onload 10.PPG Flo Pro To Pits , Prep Mud Pits Drill Out Casing Shoe 20,366.0 20,366.0 3/1/2023 00:00 3/1/2023 00:45 0.75 INTRM4, DRILLOUT CLEN P Clean and Transfer all 11.0 PPG NAF F/ Mud Pits, Onload 10.PPG Flo Pro To Pits , Prep Mud Pits Drill Out Casing Shoe 20,366.0 20,366.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 74/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/1/2023 00:45 3/1/2023 01:30 0.75 INTRM4, DRILLOUT CIRC P Pump 1.75" Steel Ball #2 W/ GPM =250 PSI=600 To Cycle Well Commander Closed, Ball on Seat And Shift Closed 1775 Strokes, PSI 2547, W/ Communication to MWD Tools. 20,366.0 20,366.0 3/1/2023 01:30 3/1/2023 01:45 0.25 INTRM4, DRILLOUT CIRC P Establish Parameters W/ MPD T/ Maintain 11.1PPG EMW. 20,366.0 20,366.0 3/1/2023 01:45 3/1/2023 06:00 4.25 INTRM4, DRILLOUT DRLG P Drill Cement F/ 20366' T/ 20399" Tag 7 5/8" Shoe @ 20397' MD Set Down 10- 15K X2, RTW=165K, RPM=40-60, TQ=13-18K, GPM=200-225, PSI=1644- 1850, MAintain 11.1 PPG EMW W/ MPD 20,366.0 20,399.0 3/1/2023 06:00 3/1/2023 08:45 2.75 INTRM4, DRILLOUT DRLG P Drill Cement And Shoe Track F/20399' T/ 20448' GPM=250, PSI=2142, RPM=70 TQ=17K WOB= 12-17K, F/O 6% MAintain 11.1 PPG EMW W/ MPD 20,399.0 20,448.0 3/1/2023 08:45 3/1/2023 09:45 1.00 INTRM4, DRILLOUT DDRL P Drill 6 3/4" Production Hole F/ 20448' T/ 20468' GPM=250, PSI=2142, RPM=70 TQ=17K WOB= 12-17K, F/O 6% MAintain 11.1 PPG EMW W/ MPD 20,448.0 20,468.0 3/1/2023 09:45 3/1/2023 10:15 0.50 INTRM4, DRILLOUT BKRM P BROOH F/ 20468' T/ 20365' GPM=250, PSI=2142, RPM=70 TQ=17K WOB= 12- 17K, F/O 6% MAintain 11.1 PPG EMW W/ MPD 20,468.0 20,365.0 3/1/2023 10:15 3/1/2023 10:30 0.25 INTRM4, DRILLOUT MPDA P Perform Draw Down Test W/ MPD Shut Down Pump and Monitor Pressure on MPD Chokes, Pressure Build to 877 PSI - Determine Formation Pressure 11.19 EMW 20,365.0 20,365.0 3/1/2023 10:30 3/1/2023 12:00 1.50 INTRM4, DRILLOUT CIRC P Stage Up Pumps T/ GPM=225, PSI=2333, Maintain 895 PSI W/PD Circulate B/U Holding 12.55 ECD 4200 Strokes Pumped @ 1200 Hrs 20,365.0 20,365.0 3/1/2023 12:00 3/1/2023 18:00 6.00 PROD1, DRILL CIRC P Cont. Circulate B/U Through Gas Buster @ 225 GPM, PSI=2344, Maintain 895 PSI MPD Holding 12.55 ECD, 21643 Total Strokes Pumped @ 1800Hrs 20,365.0 20,365.0 3/1/2023 18:00 3/1/2023 20:15 2.25 PROD1, DRILL MPDA P Perform Draw Down Test W/ MPD F/ 12.55 EMW T/11.PPG EMW Monitor Volume Bleed to Trip Tank #2. 20,365.0 20,365.0 3/1/2023 20:15 3/1/2023 23:15 3.00 PROD1, DRILL CIRC P Pump @ 1/2 BPM T/ Bum,p Floats Open on Drill Pipe, Observe Floats Opening @ 402 PSI W/ MPD=870 PSI ( 12.35 PPG EMW) Monitor Pressure While Discussing W/ Town On Plan Forward. 20,365.0 20,365.0 3/1/2023 23:15 3/2/2023 00:00 0.75 PROD1, DRILL CIRC P @ 20365' MD Circulate B/U Through Mud Gas Separator, Stage Up flow Rate T/ 250 GPM. PSi=2610, Maintain 12.5 PPG EMW W/ MPD 20,365.0 20,365.0 3/2/2023 00:00 3/2/2023 06:00 6.00 PROD1, DRILL CIRC P @ 20365' MD Circulate B/U Through Mud Gas Separator, Stage Up flow Rate T/ 250 GPM. PSi=2610, Maintain 12.5 PPG EMW W/ MPD Total Strokes Pumped 22882 20,365.0 20,365.0 3/2/2023 06:00 3/2/2023 06:45 0.75 PROD1, DRILL RURD P Shut Down Pumps, Trap 12.5 PPG EMW/ W/MPD, Blow Down, Top-Drive, R/U Head Pin and High Pressure Hose. 20,365.0 20,365.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 75/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/2/2023 06:45 3/2/2023 12:00 5.25 PROD1, DRILL MPDA P Pump Down Drill Pipe @ 1/2 BPM Open Floats Conduct Draw Down Test W/ MPD, Begin W/ 12.5 PPG EMW T/ 11.5 PPG EMW @ 10 Min Intervals, Let Pressure Build, Final Pressure 978 PSI Start with 918psi on Annulus. Icrementally bleed down 100psi and hold for 10minutes 918-736psi Build to 755psi in 10min 755-655psi Build to 668psi in 10min 668-568psi Build to 727psi in 10min 727-627psi Build to 747psi in 10 min 747-648psi Build to 975psi and flat line in 2.5hrs Total volume bled back 2.3bbls 20,365.0 20,365.0 3/2/2023 12:00 3/2/2023 14:00 2.00 PROD1, DRILL MPDA P Conduct 2nd Draw Down Test W/ MPD, Begin W/ 12.5 PPG EMW T/ 11.5 PPG EMW @ 10 Min Intervals, Final Pressure 765PSI R/D Head Pin and High Pressure Hose. 952-842psi Build to 865psi in 10min 865-756psi Build to 785psi in 10min 785-649psi Build to 685psi in 10min 685-588psi Build to 668psi in 10min 668-588psi Build to 656psi in 10min 656-591psi Build to 639psi in 10min 639-594psi Build to 762psi in 30min Volume bled back 3.2bbls 20,365.0 20,365.0 3/2/2023 14:00 3/2/2023 20:45 6.75 PROD1, DRILL CIRC P Circulate and Recip. F/ 20355' to 20365' MD GPM=250 PSi=2680, F/O 2% RPM=40 TQ=12K RTW=158K, Maintain 12.5 PPG EMW W/ MPD Bottoms up mud wight came back as high as 10.5+ added water to maintain 10ppg. Max 391 gas units on Bottoms up. 20,365.0 20,365.0 3/2/2023 20:45 3/3/2023 00:00 3.25 PROD1, DRILL CIRC P @ 20365' MD Circulate and Monitor Fluid Levels and Mud Properties @ GPM=250 PSI=2680 F/O 3% Maintain 12.5 PPG EMW W/ MPD While Building 11.1 PPG FloPro @ mud Plant Formation Losses 0 Magnet Weight 1/2 LB 20,365.0 20,365.0 3/3/2023 00:00 3/3/2023 06:30 6.50 PROD1, DRILL CIRC T @ 20365' MD Circulate and Monitor Fluid Levels and Mud Properties @ GPM=250 PSI=2680 F/O 3% Maintain 12.5 PPG EMW W/ MPD While Building 11.1 PPG FloPro @ mud Plant Formation Losses 0 Magnet Weight 0 LB 20,365.0 20,365.0 3/3/2023 06:30 3/3/2023 08:00 1.50 PROD1, DRILL CIRC T Shut down pumps and trap 925psi (12.5EMW) with MPD. Rig up head pin to monitor drill pipe pressure and blow down Top Drive. Flush chokes and blow down same. Recover cement plug material in chokes. 20,365.0 20,365.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 76/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/3/2023 08:00 3/3/2023 10:00 2.00 PROD1, DRILL OWFF T Conduct a drawdown test monitoring the Drill Pipe and Annulus. Pump down drill string to bump floats and begin draw down monitored on Trip Tank 2 every 10min. Annulus 865-745psi Build Pressure to 760psi 760-661psi Build Pressure to 685psi 685-577psi Build Pressure to 627psi 627-511psi Build Pressure to 587psi 587-475psi Build Pressure to 917psi in 45min Gained 3.2bbls 20,365.0 20,365.0 3/3/2023 10:00 3/3/2023 14:45 4.75 PROD1, DRILL CIRC T @ 20365' MD Circulate and Monitor Fluid Levels and Mud Properties @ GPM=250 PSI=2667 F/O 3% Maintain 12.5 PPG EMW W/ MPD While Building 11.1 PPG FloPro @ mud Plant Formation Losses 0 Magnet Weight 0 LB 20,365.0 20,365.0 3/3/2023 14:45 3/3/2023 22:45 8.00 PROD1, DRILL CIRC T Shut down pumps and trap 931psi, line up to Coriolis meter on MPD manifold. Bring pumps back on line 225gpm 2178psi maintain a 12.5EMW as per MPD with 763psi on back side. Begin Dynamic Draw Down Test Incrementally coming down .1ppg at a time starting with a 12ppg ECD to 10.1 ECD monitor pit levels and Coriolis for signs of gain/flow. Total Gain 22 BBLS @ 10.1 ECD well was Static No Gain MPD choke open to 100% For 30 Min, No Gain 20,365.0 20,365.0 3/3/2023 22:45 3/4/2023 00:00 1.25 PROD1, DRILL OWFF T Shut Well at MPD Chokes Monitor Press, Pressure Increase F/ 0 PSI to 617 PSI In 1.25 Hrs. Pressure Still increasing slowly 15 Min =128 PSi 30 Min= 254 PSI 45 Min=514 PSI 60 Min=594 PSI 2400 HRS= 617 PSI 20,365.0 20,365.0 3/4/2023 00:00 3/4/2023 01:00 1.00 PROD1, DRILL OWFF T Monitor shut in casing pressures against the MPD choke. Pressure stabilize at 736psi with mud weight 9.6+ppg. 20,365.0 20,365.0 3/4/2023 01:00 3/4/2023 08:30 7.50 PROD1, DRILL CIRC T Circulate to check bottoms up. Pump 22,423 STKS. Observed 9.6+ coming out of hole. 223 Units Gas 225 GPM 2414 PSI 40 RPM 13K TQ 12.43 ECD 160K ROT No gains or losses 20,365.0 20,365.0 3/4/2023 08:30 3/4/2023 11:00 2.50 PROD1, DRILL DISP T Shut down trap at 920 PSI w/ 9.7 PPG MW 12.2 PPGE. Empty pits 4& 5 of 10PPG Flo Pro & clean same. Take on 11.1 PPG Flo Pro into pits. Stabbed TIW Valve Blow down Top Drive & Service same. Conduct PJSM w/ crew on displacement 20,365.0 20,365.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 77/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/4/2023 11:00 3/4/2023 19:45 8.75 PROD1, DRILL DISP T Begin displacement from 10 PPG Flo Pro to 11.1 PPG. Pump 50 BBl of 11.1 PPG 300 Vis Spacer @ 250 GPM, 2400 PSI, RPM + 40, TQ= 13K. 34364 STKS Pumped. Maintain 12.5 PPGE w/ MPD Choke throughout circulation. 20,365.0 20,365.0 3/4/2023 19:45 3/4/2023 20:15 0.50 PROD1, DRILL RURD T B/D Top Drive R/U for FIT Test 20,365.0 20,365.0 3/4/2023 20:15 3/4/2023 21:15 1.00 PROD1, DRILL FIT T Perform FIT Test To a 12.5 PPG EMW= 520 PSI, 11.1ppg mud @ 20 GPM. Total Strokes Pumped 34= 3.4 BBLS, Shut Down Mud Pump, Shut in Well Monitor Pressure For 10 Min. Charted 20,365.0 20,365.0 3/4/2023 21:15 3/5/2023 00:00 2.75 PROD1, DRILL OWFF T Line Up To Exhale and Bleed pressure back to Trip Tank #2 1.8 bbls in Trip Tank Bleed Back 520 PSI 3.4 BBLS Fluid bleed back. Start With 1.8 BBLS in Trip Tank. Logging Every 1/2 BBL Bleed Back and time to a total of 7 bbls. 20,365.0 20,365.0 3/5/2023 00:00 3/5/2023 03:30 3.50 PROD1, DRILL OWFF T Continue to perform Exhale Test with 11.1ppg mud. Monitor flow back on Trip Tank 2 until 10bbls out reached. 20,365.0 20,365.0 3/5/2023 03:30 3/5/2023 04:00 0.50 PROD1, DRILL OWFF T Close choke and monitor pressure build up. Built 25psi in 30minutes 20,365.0 20,365.0 3/5/2023 04:00 3/5/2023 08:00 4.00 PROD1, DRILL OWFF T Open choke and continue with Exhale Test monitoring on Trip Tank #2. Bleed back 3bbls more in 4 hours. Conclude test after determined well was breathing. 20,365.0 20,365.0 3/5/2023 08:00 3/5/2023 09:00 1.00 PROD1, DRILL OTHR T Blow down surface lines. Rig down TIW and Head pin. Kelly up and break circulation. Capture slow pump rates. 20,365.0 20,365.0 3/5/2023 09:00 3/5/2023 09:30 0.50 PROD1, DRILL DLOG T Log Down with Sonic Tool Real Time F/20,366'-20,468' 350ft/hr 250gpm 2070psi 5rpm 11k Tq F/O 3% Rot Wt 182k 20,366.0 20,468.0 3/5/2023 09:30 3/5/2023 11:15 1.75 PROD1, DRILL DDRL P Drill 6-3/4" production hole F/ 20,468' T/20,542' 7,136'TVD 275gpm 2,505psi 120rpm 22k Tq F/O 4% 11.67PPG ECD Rot wt 171k 16-20 wob 20,468.0 20,542.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 78/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/5/2023 11:15 3/5/2023 12:00 0.75 PROD1, DRILL SIPB T 11:19hrs observe 130psi increase in pump pressure and flow increase to 18%. Shut down pumps and rotary and close MPD chokes to access well bore condition. Observe casing pressure come up to 478psi and Drill Pipe pressure at 545psi. Check pits and calculate a 3bbl gain. 11.1ppg mud in the pits. Notify town with data gathered. 20,542.0 20,542.0 3/5/2023 12:00 3/5/2023 19:00 7.00 PROD1, DRILL CIRC T Establish circulation keeping casing pressure constant at 478psi while coming up with the pumps to 225gpm. Once at circulating rate maintain constant DP pressure of 2,350psi. Rotate pipe at 30rpm 15k Tq and reciprocate F/ 20,519' T/20,470'. Rot Wt 167klbs ECD12.8ppge Pump 25,136stks No gas on bottoms up. Collect sample of fluid and annylize with retort observe increase in oil content from 1% to 4% 20,519.0 20,470.0 3/5/2023 19:00 3/5/2023 20:30 1.50 PROD1, DRILL BKRM T BROOH F/ 20470' T/ 20367' MD W/ GPM=225, PSI=2360, RPM=40, TQ=10K, ECD=12.8, PPG, RTW=162K 20,470.0 20,367.0 3/5/2023 20:30 3/5/2023 21:00 0.50 PROD1, DRILL CLEN T Blow Down Top-Drive, Install Head Pin and High Pressure Hose. 20,367.0 20,367.0 3/5/2023 21:00 3/5/2023 22:00 1.00 PROD1, DRILL OWFF T Perform Exhale Test #1 Starting Pressure 623 psi Bleed Back 10 BBLS Via MPD Choke W/ 15% Open Bleed Time 52 min Ending Pressure 482 psi 20,367.0 20,367.0 3/5/2023 22:00 3/5/2023 22:30 0.50 PROD1, DRILL OWFF T Close MPD Choke Monitor Pressure Build for 30 Min Pressure Build F/ 482 psi to 548 psi 20,367.0 20,367.0 3/5/2023 22:30 3/5/2023 23:00 0.50 PROD1, DRILL OWFF T Perform Exhale Test #2 Starting Pressure 548 psi Bleed Back 10 BBLS Via MPD Choke W/ 15% Open Bleed Time 30 min Ending Pressure 393 psi 20,367.0 20,367.0 3/5/2023 23:00 3/5/2023 23:30 0.50 PROD1, DRILL OWFF T Close MPD Choke Monitor Pressure Build for 30 Min Pressure Build F/ 393 psi to 478 psi 20,367.0 20,367.0 3/5/2023 23:30 3/6/2023 00:00 0.50 PROD1, DRILL OWFF T Perform Exhale Test #3 Starting Pressure 478 psi Bleed Back 7.5 BBLS Via MPD Choke W/ 15% Open Bleed Time 30 min @ 0000 Hrs W/ 315 psi. Total Bleed Back 44 BBLS *Determined Well was Breathing* 20,367.0 20,367.0 3/6/2023 00:00 3/6/2023 00:15 0.25 PROD1, DRILL OWFF T Continue to perform Exhale test #3. Starting pressure 478psi bled 10bbls off down to 283psi. Used 15% chokes 20,367.0 20,367.0 3/6/2023 00:15 3/6/2023 00:45 0.50 PROD1, DRILL OWFF T Close MPD Choke and monitor build up in pressure on Annulus. Built from 283psi to 400psi 20,367.0 20,367.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 79/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/6/2023 00:45 3/6/2023 09:00 8.25 PROD1, DRILL CIRC T Circulate bottoms up to assess the Exhale test. Rotate and Reciprocate while circulating. Take returns through MGS. 225gpm 2,400psi 40 rpms 12k tq 12.8ppg ECD holding 487psi with MPD Pumped 25,400stks B/U Showed an increase in oil concentration Kuparuk Lab ran a GC and confirmed oil in sample was LVT. 20,367.0 20,367.0 3/6/2023 09:00 3/6/2023 09:30 0.50 PROD1, DRILL OWFF T Trap 580psi with an 11.1ppg for a 12.6ppge. Blow down Top Drive and rig up TIW and Head pin. Line up to take returns to TT#2 20,367.0 20,367.0 3/6/2023 09:30 3/6/2023 10:15 0.75 PROD1, DRILL OWFF T Conduct Exhale test #4 Start pressure at 555psi bleed back 20bbls with 21% open MPD choke. Ending pressure 186psi 20,367.0 20,367.0 3/6/2023 10:15 3/6/2023 10:45 0.50 PROD1, DRILL OWFF T Close MPD chokes and pressure up from 186psi to 360psi in 30min. 20,367.0 20,367.0 3/6/2023 10:45 3/6/2023 13:45 3.00 PROD1, DRILL OWFF T Conduct Exhale test #5. Starting pressure 360psi being with 21% choke and ended wide open opening chokes to continue to allow to flow. Monitor returns to the Trip Tank #2 flow diminished to less than 3bbl/hr. Final pressure on annulus 12psi with open choke. Final measurement was 3bph return rate 20,367.0 20,367.0 3/6/2023 13:45 3/6/2023 15:45 2.00 PROD1, DRILL OWFF T Close orbit and line up to RCD drain line and measure returns back with vis cup calculation. Start at 3bph and end at 1.78bbl/hr Total Barrels Bleed Back 44 BBLS 20,367.0 20,367.0 3/6/2023 15:45 3/6/2023 16:00 0.25 PROD1, DRILL SVRG T Rig Down Floor Equipment, Service Top -Drive, Prepare to Circulate 20,367.0 20,367.0 3/6/2023 16:00 3/6/2023 22:30 6.50 PROD1, DRILL CIRC T Circulate and Condition Mud while Rotating F/ 20362' To 20272' MD GPM- 225, PSI=1901, RPM=50, TQ=15K, F/O=2%,ECD=11.6, RTW=178K, 20500 Strokes pumped Total. 20,362.0 20,272.0 3/6/2023 22:30 3/7/2023 00:00 1.50 PROD1, DRILL WASH T Wash and Ream Down F/ 20362' MD T/ 20481' MD 20,362.0 20,481.0 3/7/2023 00:00 3/7/2023 00:30 0.50 PROD1, DRILL REAM T Wash &Ream Down F/20,481' MD T/20,542' MD, RTW=183K, RPM=50 ,TQ=17K, WOB=1, FLOW=4% ,GPM=252 ,PSI=2329 20,481.0 20,542.0 3/7/2023 00:30 3/7/2023 05:45 5.25 PROD1, DRILL DDRL P Drill 6 3/4" Production Hole and Log F/20,542' MD - T/20,645' MD 7137‘ TVD, WOB = 11K, GPM =250, PSI On =2408, PSI Off =2386, RPM = 120, TQ On = 24K, TQ Off = 17K, F/O =6%, ECD = 11.7PPG, P/U WT = 240K, S/O WT = 160K, RT WT = 183K 20,542.0 20,645.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 80/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/7/2023 05:45 3/7/2023 12:00 6.25 PROD1, DRILL DDRL P Drill 6 3/4" Production Hole F/20,645' MD - T/20,928' MD, 7,142‘ TVD, WOB = 2-4K GPM = 260, PSI = 2518, RPM = 150, TQ ON = 26K, F/O = 3%, ECD = 11.91 PPG P/U WT = 260K, S/O WT = 149K, RT WT = 179K, ADT = 5.55, Total Bit Hrs = 10.49 SPR’S @ 20,551’ MD, 7,135' TVD MW = 11.1PPG Time:0120 #2 MP – 20 SPM 665-PSI 30 SPM - 910 -PSI #3 MP – 20 SPM 615-PSI 30 SPM - 905 -PSI 20,645.0 20,928.0 3/7/2023 12:00 3/7/2023 18:00 6.00 PROD1, DRILL DDRL P Drill 6 3/4” Production Hole F/20,928' MD - T/21,048' MD 7,140‘ TVD, WOB = 1-3K GPM = 260, PSI = 2535, RPM = 150, TQ = 26K, F/O = 3%, ECD = 11.78 PPG, P/U WT = 260K, S/O WT = 149K, RT WT = 174K, ADT = 3.84, Total Bit Hrs = 14.33 20,928.0 21,048.0 3/7/2023 18:00 3/8/2023 00:00 6.00 PROD1, DRILL DDRL P Drill 6 3/4” Production Hole F/21,048’ MD - T/21,203’ MD 7141’ TVD, WOB = 4K, GPM = 260, PSI On = 2531, PSI Off =2527, RPM =150, TQ On = 26, TQ Off = 25, F/O = 3%, ECD =11.82 PPG, P/U WT =250K, S/O WT =131K, RT WT = 183K, ADT = 5.09, Total Bit Hrs =19.42, SPR’S @ 21,016’ MD, 7,142' TVD MW = 11.1PPG TIME:15:24 #2 MP – 20 SPM, 700 PSI, 30 SPM 1010 PSI #3 MP – 20 SPM 690 PSI, 30 SPM 960 PSI 3LB Metal F/ Ditch Magnets 21,048.0 21,203.0 3/8/2023 00:00 3/8/2023 06:00 6.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,203' to 21,244' MD 7142’ TVD, Control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Samples have continued to be predominantly mud additive and very few loose sand grains with very rare glauconite. WOB = 4K, GPM = 260 PSI On = 2531, PSI Off =2527, RPM =150, TQ On = 26, TQ Off = 25, F/O = 3%, ECD =11.82 PPG, P/U WT =250K, S/O WT =131K, RT WT = 183K, ADT = 5.09, Total Bit Hrs =25.40, 21,203.0 21,244.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 81/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/8/2023 06:00 3/8/2023 12:00 6.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,244' to 21,273' MD 7144’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Samples have continued to be predominantly mud additive and very few loose sand grains with very rare glauconite. WOB = 1-3K, GPM = 260 PSI On = 2501, RPM =80, TQ On = 24, F/O = 3%, ECD =11.71 PPG, P/U WT =234K, S/O WT =134K, RT WT = 180K, ADT = 6.07, Total Bit Hrs ,31.47 21,244.0 21,273.0 3/8/2023 12:00 3/8/2023 18:00 6.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,273' to 21,304' MD 7147’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings.. WOB = 1-2K, GPM = 260 PSI On = 2405, RPM =70, TQ On = 21, F/O = 3%, ECD =11.64 PPG, P/U WT =234K, S/O WT =134K, RT WT = 180K, ADT =4.83 , Total Bit Hrs 36.30 , 21,273.0 21,304.0 3/8/2023 18:00 3/8/2023 21:00 3.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,273' to 21,304' MD 7147’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings.. WOB = 1-2K, GPM = 260 PSI On = 2405, RPM =70, TQ On = 21, F/O = 3%, ECD =11.64 PPG, P/U WT =234K, S/O WT =134K, RT WT = 180K, ADT =3.21 , Total Bit Hrs 39.51 , 21,273.0 21,304.0 3/8/2023 21:00 3/9/2023 00:00 3.00 PROD1, DRILL DDRL P Circulate, Rotate, Recip, Troughing F/ 21306' MD T/ 21288' MD WOB = 1-2K, GPM = 260 PSI On = 2405, RPM =70, TQ On = 21, F/O = 3%, ECD =11.64 PPG, P/U WT =234K, S/O WT =134K, RT WT = 180K, , Total Bit Hrs 42.51 , 21,304.0 21,288.0 3/9/2023 00:00 3/9/2023 06:00 6.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,307' to 21,310' MD 7146’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB = 1K, GPM = 258, PSI On = 2400, RPM =80, TQ On = 23, F/O = 3%, ECD =11.66 PPG, RT WT = 188K, Total Bit Hrs 43.61, ADT= 4.10, 21,307.0 21,310.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 82/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/9/2023 06:00 3/9/2023 12:00 6.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,310' to 21,387' MD 7150’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB = 5K, GPM = 250, PSI On = 2341, RPM = 75, TQ On = 25, F/O = 3%, ECD =11.62 PPG, RT WT = 183K, Total Bit Hrs 49.42, ADT= 5.81. 21,310.0 21,387.0 3/9/2023 12:00 3/9/2023 21:00 9.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,387' to 21,560' MD 7,148’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB = 14K, GPM = 250, PSI On = 2332, RPM = 75, TQ On = 23, F/O = 3%, ECD =11.65 PPG, RT WT = 187K, Total Bit Hrs 54.56, ADT= 5.14@ 18:00 hrs 21,387.0 21,560.0 3/9/2023 21:00 3/10/2023 00:00 3.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,560' to 21,656' MD 7,151’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB = 5K, GPM = 260, PSI On = 2481, RPM = 75, TQ On = 27, F/O = 3%, ECD =11.70 PPG, RT WT = 187K, Total Bit Hrs 60.38, ADT= 5.82. 21,560.0 21,656.0 3/10/2023 00:00 3/10/2023 06:00 6.00 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 21,656' to 21,835' MD 7,155’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB = 2K, GPM = 260, PSI On = 2472, RPM = 90, TQ On = 27, F/O = 4%, ECD =11.77 PPG, RT WT = 187K, Total Bit Hrs 65.29, ADT= 4.9 Hrs. 21,656.0 21,835.0 3/10/2023 06:00 3/10/2023 12:00 6.00 PROD1, DRILL DRLG P Drill 6-3/4" production hole from 21,835' to 22,030' MD 7,158’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB =6K, GPM = 250, PSI On = 2365, RPM = 90, TQ On = 28, F/O = 4%, ECD =11.80 PPG, RT WT = 187K, Total Bit Hrs 70.35, ADT= 5.40 Hrs. 21,835.0 22,030.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 83/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/10/2023 12:00 3/10/2023 15:30 3.50 PROD1, DRILL DDRL P Drill 6-3/4" production hole from 22,030' to 22,130' MD 7,160’ TVD, Continue control drilling at reduced ROP in order to facilitate drop through hard siderite layer with 100% down. Material coming across shakers is primarily mud additive with rare to trace sandstone and siltstone cuttings. WOB =7K, GPM = 250, PSI On = 2376, RPM = 90, TQ On = 25, F/O = 4%, ECD =11.80 PPG, RT WT = 188K, Total Bit Hrs 73.39, ADT= 2.94 Hrs. 22,030.0 22,130.0 3/10/2023 15:30 3/10/2023 16:00 0.50 PROD1, DRILL SRVY T Obtain final survey prior to trip. 22,130.0 22,130.0 3/10/2023 16:00 3/10/2023 16:45 0.75 PROD1, DRILL CIRC T Circulate, rotate and reciprocate F/22,125' T/22,035' while preparing for displacement. RPM = 120, TQ = 27K, GPM = 250, PSI = 2350. 22,130.0 22,035.0 3/10/2023 16:45 3/11/2023 00:00 7.25 PROD1, DRILL DISP T PJSM. Pump 100 bbls 12.0 ppg Hi-Vis Spacer, displace well to12.0 ppg brine while rotating and reciprocating. F/22,125' T/22,035' MD, 100 = RPM, 25K = TQ, 250 = GPM, 1855 = PSI. 22,035.0 22,125.0 3/11/2023 00:00 3/11/2023 00:30 0.50 PROD1, DRILL DISP T Finish displacing well to12.0 ppg brine while rotating and reciprocating. F/22,125' T/22,035' MD, 100 = RPM, 24K = TQ, 250 = GPM, 1840 = PSI. Total strokes 26,285. 140 bbls inter phase. 22,125.0 22,035.0 3/11/2023 00:30 3/11/2023 01:00 0.50 PROD1, DRILL CIRC T Take SPR's and B/D top drive. 22,125.0 22,125.0 3/11/2023 01:00 3/11/2023 01:30 0.50 PROD1, DRILL OWFF T OWFF F/30 minutes - static. 22,125.0 22,125.0 3/11/2023 01:30 3/11/2023 02:00 0.50 PROD1, DRILL SMPD T SOOH F/22,125' T/21,795' MD maintaining MPD pressure 130 psi = 12.2 ECD and 80 psi on slips following Beyond tripping schedule. 22,125.0 21,795.0 3/11/2023 02:00 3/11/2023 04:45 2.75 PROD1, DRILL DLOG T Perform MADD pass F/21,795' T/21,685' as per DD at 100 fph. RPM = 40, GPM = 250, PSI = 1845, Flow = 4%, TQ = 25K, RTW = 185K. 21,795.0 21,685.0 3/11/2023 04:45 3/11/2023 05:30 0.75 PROD1, DRILL SMPD T SOOH F/21,685' T/21,172' MD maintaining MPD pressure 130 psi = 12.2 ECD and 80 psi on slips following Beyond tripping schedule. 21,685.0 21,185.0 3/11/2023 05:30 3/11/2023 06:00 0.50 PROD1, DRILL DLOG T Perform MADD pass F/21,185' T/21,172' as per DD at 100 fph. RPM = 40, GPM = 250, PSI = 1845, Flow = 4%, TQ = 25K, RTW = 185K. 21,185.0 21,172.0 3/11/2023 06:00 3/11/2023 09:30 3.50 PROD1, DRILL DLOG T Perform MADD pass F/21,172' T/21,105', F/21,065' T/20,935' as per DD at 100 fph. RPM = 40, GPM = 250, PSI = 1845, Flow = 4%, TQ = 25K, RTW = 182K. 21,172.0 21,065.0 3/11/2023 09:30 3/11/2023 11:00 1.50 PROD1, DRILL SMPD T SOOH F/20,935' T/20,138' MD maintaining MPD pressure 130 psi = 12.2 ECD and 80 psi on slips following Beyond tripping schedule. 21,065.0 20,138.0 3/11/2023 11:00 3/11/2023 11:30 0.50 PROD1, DRILL OWFF T OWFF F/30 minutes via 2" bleeder in cellar - static. 20,138.0 20,138.0 3/11/2023 11:30 3/11/2023 12:00 0.50 PROD1, DRILL MPDA T PJSM. Removing 5-7/8" MPD Bearing. 20,138.0 20,138.0 3/11/2023 12:00 3/11/2023 12:30 0.50 PROD1, DRILL MPDA T Continue removing 5-7/8" MPD Bearing. 20,138.0 20,138.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 84/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/11/2023 12:30 3/11/2023 12:45 0.25 PROD1, DRILL TRIP T POOH F/20,138 T/20,088' and stand back last stand 5-7/8" DP, Remove 5- 7/8" x 4-1/2" XO. 20,138.0 20,088.0 3/11/2023 12:45 3/11/2023 13:00 0.25 PROD1, DRILL RURD T Change out 5-7/8" elevators to 4-1/2". 20,088.0 20,088.0 3/11/2023 13:00 3/11/2023 18:00 5.00 PROD1, DRILL TRIP T POOH w/4-1/2" DP on elevators F/20,088' T/15,736' following Beyond tripping schedule. 20,088.0 15,736.0 3/11/2023 18:00 3/12/2023 00:00 6.00 PROD1, DRILL TRIP T POOH w/4-1/2" DP on elevators F/15,736' T/5,138' following Beyond tripping schedule. 15,736.0 5,138.0 3/12/2023 00:00 3/12/2023 02:00 2.00 PROD1, DRILL TRIP T POOH w/4-1/2" DP on elevators F/5,138' T/1,344' following Beyond tripping schedule. P/U = 85K, S/O = 80K. 5,138.0 1,344.0 3/12/2023 02:00 3/12/2023 03:00 1.00 PROD1, DRILL OTHR T Daylight Savings Time Change. 1,344.0 1,344.0 3/12/2023 03:00 3/12/2023 03:30 0.50 PROD1, DRILL TRIP T POOH w/4-1/2" DP on elevators F/1,344' T/212' following Beyond tripping schedule. P/U = 85K, S/O = 80K. 1,344.0 212.0 3/12/2023 03:30 3/12/2023 04:00 0.50 PROD1, DRILL OWFF T OWFF - static. SIMOPS: PJSM F/ L/D BHA. 212.0 212.0 3/12/2023 04:00 3/12/2023 06:00 2.00 PROD1, DRILL BHAH T L/D 6-3/4" BHA #7 as per SLB DD F/212' T/153'. Monitor hole on trip tank. 212.0 153.0 3/12/2023 06:00 3/12/2023 08:30 2.50 PROD1, DRILL BHAH T Continue L/D BHA #7 F/153' T/Surface. 153.0 0.0 3/12/2023 08:30 3/12/2023 09:15 0.75 PROD1, DRILL CLEN T Clean and clear rig floor. L/D BHA componets out beavers slide. Changed out elevators to 5". 0.0 0.0 3/12/2023 09:15 3/12/2023 10:00 0.75 PROD1, WHDBOP RURD T P/U 2 jts 5" DP and wear bushing puller. M/U 4-1/2" and 5-7/8' Dart Valves. 0.0 0.0 3/12/2023 10:00 3/12/2023 12:00 2.00 PROD1, WHDBOP RURD T Drain BOP, RIH and pull wear bushing, L/D same. 0.0 0.0 3/12/2023 12:00 3/12/2023 13:30 1.50 PROD1, WHDBOP WWWH T P/U 1 stand 5-7/8" DP, XO and wash tool. Wash BOP, Riser and wellhead area to top Annular. Spaced out and function annular, UPR's and LPR's. L/D wash tool and rack back stand DP. B/D top drive. 0.0 0.0 3/12/2023 13:30 3/12/2023 14:30 1.00 PROD1, WHDBOP MPDA T Remove master bushing. C/O air boot on riser. Fill and check for leaks - ok. 0.0 0.0 3/12/2023 14:30 3/12/2023 15:00 0.50 PROD1, WHDBOP RURD T RIH with 2 stands 5-7/8" DP to hang below test plug. 0.0 180.0 3/12/2023 15:00 3/12/2023 15:30 0.50 PROD1, WHDBOP RURD T Grease upper and lower IBOP's, C/O elevators to 5". 180.0 180.0 3/12/2023 15:30 3/12/2023 16:30 1.00 PROD1, WHDBOP RURD T M/U test joint, pup joints and Cameron test plug. RIH and set test plug. 180.0 225.0 3/12/2023 16:30 3/12/2023 18:00 1.50 PROD1, WHDBOP BOPE T Fill BOP with water, R/U top drive and test joint. Purge air out of lines. PJSM for testing BOP. Test gas alarms. 225.0 225.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 85/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/12/2023 18:00 3/13/2023 00:00 6.00 PROD1, WHDBOP BOPE T Perform BOPE Tests W/ 4 1/2" test joint, Annular 250 psi F/ 5 min, 2,500 psi F/ 10 min. Remaining Test 250 F/ 5 min, 4,000 F/ 10 min. Upper 4-1/2" X 7-5/8" VBRS, Lower 3-1/2" x 6-5/8" VBRS, CMV #1-2, #4-16 Manual & HCR Choke/KIll and Kill Valve #3, Upper and Lower IBOPS, 4-1/2" and 5-7/8" TIW and Dart Valves, Charted all test. Test PVT Gain /Loss and Flow out Alarms. Test LEL and H2S alarms. AOGCC Brian Bixby waived witness BOP test on 3-10-2023 @ 15:42 hrs. BLM Quinn Sawyer waived witness BOP test on 3-10-2023 @ 16:08 hrs. 225.0 225.0 3/13/2023 00:00 3/13/2023 04:00 4.00 PROD1, WHDBOP BOPE T Perform BOPE Tests W/ 4 1/2" & 5-7/8" test joints, Annular 250 psi F/ 5 min, 2,500 psi F/ 10 min. Remaining Test 250 F/ 5 min, 4,000 F/ 10 min. Upper 4-1/2" X 7-5/8" VBRS, Lower 3-1/2" x 6-5/8" VBRS, CMV #3, Blind Shears, Manual and electric super choke. Charted all test. Conducted Koomey drawdown, Accumulator = 3,050 psi, Manifold = 1,550 psi, Accumulator = 1,625 psi after all functions on bottles, 11 seconds for 200 psi build with 2 electric pumps. 84 seconds to full system pressure with 2 electric pumps and 6 air pumps. Closing times: Annular = 22 sec, UPR = 17 sec, Blind/Shear rams = 17 sec, LPR = 16 sec, Choke HCR = 2 sec, Kill HCR = 2 sec. Nitrogen back up 10 bottle average = 3,600 psi. AOGCC Brian Bixby waived witness BOP test on 3-10-2023 @ 15:42 hrs. BLM Quinn Sawyer waived witness BOP test on 3-10-2023 @ 16:08 hrs. 225.0 255.0 3/13/2023 04:00 3/13/2023 06:00 2.00 PROD1, WHDBOP RURD T Pull Cameron test plug, L/D 5-7/8" test joint, rack back 2 stands 5-7/8" DP in derrick. 255.0 0.0 3/13/2023 06:00 3/13/2023 07:00 1.00 PROD1, WHDBOP RURD T P/U 2 joints 5" DP, M/U Cameron wear bushing on running tool and set same. L/D 5" DP and running tool. 0.0 0.0 3/13/2023 07:00 3/13/2023 08:30 1.50 PROD1, DRILL RURD T C/O elevators to 4-1/2". Clean and inspect saver sub and pipe handler. P/U BHA components via beavers slide to floor. 0.0 0.0 3/13/2023 08:30 3/13/2023 09:30 1.00 PROD1, DRILL WAIT T SLB confirming DigiScope tool checks. SIMOPS: C/O lower IBOP grease plug, service ST-120 and C/O dies. 0.0 0.0 3/13/2023 09:30 3/13/2023 10:00 0.50 PROD1, DRILL RURD T Install strip-o-matic over hole and test. Swapped air hoses. 0.0 0.0 3/13/2023 10:00 3/13/2023 12:00 2.00 PROD1, DRILL BHAH T M/U BHA #8 T/124' as per SLB DD. M/U remainder of BHA on bottom of single 4- 1/2" DP in mousehole. 0.0 124.0 3/13/2023 12:00 3/13/2023 13:00 1.00 PROD1, DRILL BHAH T PJSM. Load source in ADN. Continue M/U BHA T/182' from mousehole as per SLB DD. L/D single 4-12" DP and XO. 124.0 182.0 3/13/2023 13:00 3/13/2023 13:45 0.75 PROD1, DRILL TRIP T RIH with BHA #8 F/182' T/1,500' on 4- 1/2" DP. Monitoring returns on trip tank. Identified improper make up torques used. 182.0 1,500.0 3/13/2023 13:45 3/13/2023 14:45 1.00 PROD1, DRILL TRIP T POOH on elevators F/1,500' T/276' on 4-1/2" DP checking connection torques. Monitoring displacement on trip tank. 1,500.0 276.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 86/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/13/2023 14:45 3/13/2023 16:00 1.25 PROD1, DRILL TRIP T RIH with BHA #8 F/276' T/3,006' on 4- 1/2" DP. Monitoring returns on trip tank. P/U = 123K, S/O= 121K. Bit at 1,500' at 15:30 hrs. 276.0 3,006.0 3/13/2023 16:00 3/13/2023 16:30 0.50 PROD1, DRILL CIRC T Fill pipe with 40 bbls 12.0 ppg Brine. Shalow Hole Test SLB tools @ 225 gpm, 1000 psi. Good test. 3,006.0 3,006.0 3/13/2023 16:30 3/13/2023 16:45 0.25 PROD1, DRILL RURD T Remove XO and B/D top drive. 3,006.0 3,006.0 3/13/2023 16:45 3/13/2023 18:00 1.25 PROD1, DRILL TRIP T RIH with BHA #8 F/3,006' T/5,179' on 4- 1/2" DP. Monitoring returns on trip tank. Filling every 30 stands. 3,006.0 5,179.0 3/13/2023 18:00 3/14/2023 00:00 6.00 PROD1, DRILL TRIP T RIH with BHA #8 F/5,179' T/13,234' on 4 -1/2" DP. Monitoring returns on trip tank. Filling every 30 stands. Tested SLB tools at 11,511' w/231 gpm, 1,244 psi, P/U = 200K, S/O = 100K. 5,179.0 13,234.0 3/14/2023 00:00 3/14/2023 06:15 6.25 PROD1, DRILL TRIP T RIH with BHA #8 F/13,234' T/19,055' on 4-1/2" DP. Monitoring returns on trip tank. Filling every 10 stands. Lost ablity to S/O at 19,055'. P/U = 290K, S/O = 100K. 13,234.0 19,055.0 3/14/2023 06:15 3/14/2023 06:30 0.25 PROD1, DRILL TRIP T Attempt to RIH w/4-1/2' DP on elevators F/19,055'. Lost ablility to S/O without rotation. 19,055.0 19,055.0 3/14/2023 06:30 3/14/2023 11:00 4.50 PROD1, DRILL REAM T M/U 5-7/8" x 4-1/2" XO to top drive. Wash and ream F/19,055' T/20,097'. 20 RPM, 84 GPM, 220 PSI, ROT = 180k. 19,055.0 20,097.0 3/14/2023 11:00 3/14/2023 11:30 0.50 PROD1, DRILL REAM T C/O elevators to 5-7/8". Wash and ream on 5-7/8' DP F/20,097' T/20,192'. 20 RPM, 84 GPM, 220 PSI, ROT = 180K. 20,097.0 20,192.0 3/14/2023 11:30 3/14/2023 12:00 0.50 PROD1, DRILL RURD T B/D top drive. PJSM for slip and cut drlg line. 20,192.0 20,192.0 3/14/2023 12:00 3/14/2023 15:15 3.25 PROD1, DRILL SLPC T Hang blocks, remove covers F/draworks and inspect brakes. Slip and cut 75' drlg line. Install draworks covers and unhang blocks. Perform empty block calibrations. Service top drive and blocks. 20,192.0 20,192.0 3/14/2023 15:15 3/14/2023 15:30 0.25 PROD1, DRILL REAM T Wash and ream F/20,192' T/20,220'. 20 RPM, 84 GPM, 193 PSI, P/U = 280K, ROT S/O = 150K. Cannot S/O without rotation. 20,192.0 20,220.0 3/14/2023 15:30 3/14/2023 17:00 1.50 PROD1, DRILL MPDA T B/D top drive. PJSM. Install 5-7/8" RCD bearing as per Beyond rep. 20,220.0 20,220.0 3/14/2023 17:00 3/14/2023 17:30 0.50 PROD1, DRILL REAM T Wash and ream testing Novos system F/20,220' T/20,435'. 20 = RPM, 84 = GPM, 193 PSI, P/U = 280K, ROT S/O = 146K. 20,220.0 20,435.0 3/14/2023 17:30 3/14/2023 21:45 4.25 PROD1, DRILL REAM T Wash and ream F/20,435' T/21,121'. 20 RPM, 85 GPM, 189 PSI, P/U = 289K, ROT = 184K, ROT S/O = 149K. Cannot S/O without rotation. 20,435.0 21,121.0 3/14/2023 21:45 3/14/2023 23:30 1.75 PROD1, DRILL REAM T MADD pass F/21,121' T/21,302' (bit depths) at 100 FPH. 252 GPM, 1819 PSI, Flow Out 4%, RPM 50, TQ 20K, ECD 12.1 ppg, P/U = 289K, ROT S/O = 179K R/OT = 186K. 21,121.0 21,302.0 3/14/2023 23:30 3/15/2023 00:00 0.50 PROD1, DRILL REAM T Wash and ream F/21,302' T/21,488'. 40 RPM, 22K = TQ, 82 GPM, 183 PSI, P/U = 292K, ROT = 186K, ROT S/O = 160K. Cannot S/O without rotation. 21,302.0 21,488.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 87/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/15/2023 00:00 3/15/2023 02:45 2.75 PROD1, DRILL REAM T Wash and ream F/21,488' T/22,175' (tag bottom w/5K- DPM). 40 RPM, TQ = 22K, 82 GPM, 183 PSI, P/U = 300K, ROT = 194K, ROT S/O = 160K. Cannot S/O without rotation. 21,488.0 22,175.0 3/15/2023 02:45 3/15/2023 03:15 0.50 PROD1, DRILL CIRC T P/U to 22,140' and rack back stand. Drop 1.75" OD SS ball to open well commander. 22,175.0 22,140.0 3/15/2023 03:15 3/15/2023 04:00 0.75 PROD1, DRILL CIRC T Circulate, rotate and reciprocate while pumping down ball as per SLB DD. 210 GPM, 1,230 PSI, RPM = 50, TQ = 26K. At 1570 stks (155 bbls) slowed rate to 83 GPM, 195 PSI, RPM = 50, TQ = 26K. Ball on seat at 1943 stks (191.7 bbls). Observed well commander shifting open at 1,438 psi. Prior to opening: 210 GPM @ 1,250 PSI, After opening: 210 GPM @ 450 PSI. 22,140.0 22,070.0 3/15/2023 04:00 3/15/2023 09:00 5.00 PROD1, DRILL CIRC T Displaced 12.0 ppg brine with 11.1 ppg FloPro mud. Pumped 115 bbls (1170 stks) 13.8 ppg spacer followed with 11.1 ppg FloPro mud staging up to 445 GPM, 2,277 PSI, RPM = 60-120, TQ = 23K while reciprocating string. P/U = 300K, RS/O = 178K, ROT = 195K. Total pumped 29,000 stks (2682.3 bbls). 150 bbls interface during displacement. 95% material over shakers appeared to be Calcium Carbonate when weighted spacer at surface. Full returns during job. 22,070.0 22,140.0 3/15/2023 09:00 3/15/2023 10:30 1.50 PROD1, DRILL CIRC T Drop 1.75" SS OD ball to close well commander while reciprocating and rotating string. Pump down at 208 GPM, 764 PSI, 30 RPM, 22K TQ. Slowed rate to 2 BPM at 1500 stks (148 bbls). Ball on seat at 2000 stks (197.4 bbls). Staged up pressure to 3,100 psi to close well commander. Confirmed SLB tools working at 230 GPM, 1,750 PSI. Note: 2 total balls in well commander. 22,140.0 22,140.0 3/15/2023 10:30 3/15/2023 11:00 0.50 PROD1, DRILL CIRC T Obtain SPR's. SPR's at 22,143' MD, 7,200'TVD MW = 11.1 ppg @ 10.35 hrs #1 MP 20 SPM @ 580 psi, 30 SPM @ 803 psi #2 MP 20 SPM @ 561 psi. 30 SPM @ 794 psi. 22,140.0 22,140.0 3/15/2023 11:00 3/15/2023 11:15 0.25 PROD1, DRILL REAM T Wash and ream F/22,132' T/22,178. 260 GPM, 2,200 PSI, RPM = 75, TQ = 20K 22,140.0 22,171.0 3/15/2023 11:15 3/15/2023 12:00 0.75 PROD1, DRILL DDRL P Control drill 6-3/4" production hole F/22,171' T/22,178'MD, 7,162'TVD. WOB =15K, GPM = 260, PSI = 2,295, RPM = 95, TQ = 27K, ECD = 11.82, P/U = 300K, RS/O = 190K, ROT = 193K. 22,171.0 22,178.0 3/15/2023 12:00 3/15/2023 18:00 6.00 PROD1, DRILL DDRL P Control drill 6-3/4" production hole F/22,178' T/22,207'MD, 7,162'TVD. WOB =5-15K, GPM = 250, PSI = 2,181, RPM = 100, TQ = 27K, ECD = 11.86, P/U = 300K, RS/O = 190K, ROT = 193K. 22,178.0 22,207.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 88/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/15/2023 18:00 3/16/2023 00:00 6.00 PROD1, DRILL DDRL P Control drill 6-3/4" production hole F/22,207' T/22,253'MD, 7,164'TVD. WOB =5-15K, GPM = 250, PSI = 2,181, RPM = 100, TQ = 28K, ECD = 11.86, P/U = 300K, RS/O = 190K, ROT = 193K. Closing choke on MPD on connections - no pressure observed. 22,207.0 22,253.0 3/16/2023 00:00 3/16/2023 12:00 12.00 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,253' T/22,328' Closing choke on MPD on connections - no pressure observed . 250 GPM 2000 PSI 60-140 RPM 28K TQ on 25K off 10-22K WOB 11.69 ECD P/U = 266K S/O ROT = 168K ROT= 192K 230 Units Max Gas ADT= 10.95 Bit HRS= 21.96 22,253.0 22,328.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 89/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/16/2023 12:00 3/17/2023 00:00 12.00 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,328' T/22,426' Closing choke on MPD on connections - no pressure observed . 220 - 270 GPM 1680 - 2195 PSI 60 - 140 RPM 30K TQ on 28K off 10-25K WOB 11.70 ECD P/U = 270K S/O ROT = 172K ROT= 186K 154 Units Max Gas ADT= 10.66 Bit HRS = 32.62 At 17:20 HRS F/22,394' T/22,410' perform Drill off test at the following parameters at 5 min steps starting at 15K WOB and 220 GPM 60 RPM - 4.92 FPH 80 RPM - 2.88 FPH 100 RPM - 8.88 FPH 120 RPM - 6.84 FPH 140 RPM - 7.32 FPH , keep rotary at 100 RPM and 220 GPM for the following test with WOB 13K WOB - 1.92 FPH 16K WOB - 13.20 FPH 19K WOB - 13.80 FPH 22K WOB - 10.92 FPH 25K WOB - 14.4 FPH 28K WOB - 9.12 FPH 30K WOB - 12.24 FPH 220 GPM - 6.36 FPH 230 GPM - 5.16 FPH 240 GPM - 4.32 FPH 250 GPM - 6.24 FPH 260 GPM - 6.48 FPH 270 GPM - 9.36 FPH keep rotary at 100 RPM and 25K WOB for GPM test Decide to drill ahead with 100 RPM, 25K WOB and 270 GPM 22,328.0 22,426.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 90/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/17/2023 00:00 3/17/2023 12:00 12.00 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,426' T/22,538' Closing choke on MPD on connections - no pressure observed . 280 GPM 2240 PSI 100 - 120 RPM 32K TQ on 29K off 10-27K WOB 11.70 ECD P/U = 312K S/O ROT = 160K ROT= 198K 272 Units Max Gas ADT= 9.99 Bit HRS = 42.61 At 22,509' backed reamed the stand twice at full drilling parameters, perform TQ and drag with no pumps on 312K UP, S/O while Rot at 30 RPM 160K, Rot WT 198K , TQ 25K, observed 732 units gas on bottoms up 22,426.0 22,538.0 3/17/2023 12:00 3/18/2023 00:00 12.00 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,538' T/22,628' Closing choke on MPD on connections - observed 116 PSI on connection at 22,600'. 265 GPM 2170 PSI 100 - 120 RPM 26K TQ on 17K off 10-27K WOB 11.71 ECD P/U = 312K S/O ROT = 160K ROT= 191K 732 Units Max Gas ADT= 10.14 Bit HRS = 52.75 Start adding lube 776 at 22,530' to get system up to 1% Had CD2 pad operator shut in CD2-35 at 20:15 HRS 22,538.0 22,628.0 3/18/2023 00:00 3/18/2023 00:30 0.50 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,628' T/22,641' Closing choke on MPD on connections 265 GPM 2170 PSI 100 RPM 26K TQ on 17K off 12-18K WOB 11.71 ECD P/U = 312K S/O ROT = 160K ROT= 191K 138 Units Max Gas Bit HRS = 52.75 22,628.0 22,641.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 91/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/18/2023 00:30 3/18/2023 01:30 1.00 PROD1, DRILL CIRC P Notice MPD flow out increasing, P/U off bottom, shut down pumps close MPD chokes F/5 min observe 250 PSI on MPD chokes. Bring pumps back on line, finish circulating connection gas out from connection at 22,600'. No gain, no losses in pit volume Max gas units = 2056 Circulate at 265 GPM 2195 PSI 22,641.0 22,641.0 3/18/2023 01:30 3/18/2023 10:45 9.25 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,641' T/22,880' Closing choke on MPD on connections, obsreved 130 PSI on connection at 22,694', hold 11.7 PPG EMW on connection 265 GPM 2170 PSI 100-140RPM 15-18K TQ on 12-14K off 5-18K WOB 11.81 ECD P/U = 255K S/O = 141K ROT= 194K 1090 Units Max Gas from connection at 22,694' ADT = 6.16 Bit HRS = 59.29 At 3:35 AM at 22,694' shut down pumps, close MPD chokes montior PSI, build to 122 PSI in 10 min 22,641.0 22,880.0 3/18/2023 10:45 3/18/2023 12:15 1.50 PROD1, DRILL CIRC P CBU after drawdown test at @ 265 GPM 2088 PSI, 100 RPM 13-16K TQ 195K Rot WT 11.75 ECD Max gas = 635 units from draw down test 22,880.0 22,880.0 3/18/2023 12:15 3/18/2023 13:00 0.75 PROD1, DRILL OWFF P Shut down mud pumps, close MPD choke, montior PSI for 30 min build to 141 PSI 10 RPM 9-11K TQ Line up pump #4 for MPD on back side for connections 22,880.0 22,880.0 3/18/2023 13:00 3/18/2023 13:15 0.25 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,880' T/22,891' Closing choke on MPD on connections, Hold 11.7 PPG EMW on connection 265 GPM 2140 PSI 100 RPM 15-18K TQ on 12-14K off 6-8K WOB 11.72 ECD P/U = 255K S/O = 141K ROT= 194K 1090 Units Max Gas from connection at 22,694' ADT = .23 Bit HRS = 59.52 22,880.0 22,891.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 92/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/18/2023 13:15 3/18/2023 22:00 8.75 PROD1, DRILL CIRC T CBU at 250 GPM 1998 PSI, 75 RPM 11- 16 TQ, 40 RPM 10-12K TQ 195K ROT WT 11.75 ECD Max gas = 1260 units Circulate until gas down to 105 units to have a clean mud column in the annuals for draw down test 22,891.0 22,891.0 3/18/2023 22:00 3/18/2023 22:15 0.25 PROD1, DRILL OWFF T Shut down mud pumps, trap 230 PSI with MPD chokes. Blow down top drive and screw back in to string. Line up and get volume marks on trip tank #2 for draw down test. MPD PSI bleed down from 235 PSI to 193 PSI in 20 min 22,891.0 22,891.0 3/18/2023 22:15 3/19/2023 00:00 1.75 PROD1, DRILL OWFF T Perform static draw down test, rotate at 10 RPM 9K TQ 194K Rot WT Start with 193 PSI on MPD. Trip tank volume = 20.5 BBLS All step are choke 50% open for 10 seconds and monitor for 5 min #1 draw down - PSI from 193 to 123 in 5 min = 70 PSI drop, Pit gain 1.7 BBLS, 1.7 BBLS total #2 draw down - PSI from 123 to 95 in 5 min = 28 PSI drop. Pit gain 1.1 BBLS, 2.8 BBLS total #3 draw down - PSI from 95 to 87 in 5 min = 8 PSI drop. Pit gain .5 BBLS, 3.3 BBLS total #4 draw down - PSI from 87 to 80 in 5 min = 7 PSI drop. Pit gain .9 BBLS, 4.2 BBLS total #5 draw down - PSI from 80 to 74 in 5 min = 6 PSI drop. Pit gain .7 BBLS, 4.9 BBLS total #6 draw down - PSI from 74 to 70 in 5 min = 4 PSI drop. Pit gain .9 BBLS, 5.8 BBLS total #7 draw down - PSI from 70 to 65 in 5 min = 5 PSI drop. Pit gain .7 BBLS, 6.5 BBLS total to pits Calculated volume bled back to pits 3.7 BBLS from step #3 to #7 23:05 HRS leave shut in and monitor PSI build Build from 65 PSI T/118 PSI in 30 min, build to 126 PSI in 45 min Bump drill pipe floats at 63 PSI on drill pipe 22,891.0 22,891.0 3/19/2023 00:00 3/19/2023 11:00 11.00 PROD1, DRILL CIRC T CBU after draw down test at 22,891' 265 GPM 2205 PSI 40 RPM 10 - 13K TQ 194K Rot WT ECD = 11.88 Max gas seen = 2353 Units Stand one stand back to 22,786' , hold 230 PSI with MPD on connection Wash DN from 22,695' T/22,891' at 260 GPM 2176 PSI 60 RPM 11K TQ 22,891.0 22,891.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 93/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/19/2023 11:00 3/20/2023 00:00 13.00 PROD1, DRILL DDRL P Drill 6 3/4" hole F/22,891 T/23,691' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2345 PSI 120 RPM 24K TQ on 17K off 14K WOB 12.11 ECD P/U - 256K S/O - 150K ROT- 195K 129 Units Max Gas AVG = 61.5 FPH W/connections ADT= 9.57 Bit HRS= 69.09 22,891.0 23,691.0 3/20/2023 00:00 3/20/2023 05:00 5.00 PROD1, DRILL DDRL P Drill 6 3/4" hole F/23,691 T/23,877' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2325 PSI 100-130RPM 18-27K TQ on 15-17K off 3-15K WOB 11.97 ECD P/U - 266K S/O - 146K ROT- 196K 136 Units Max Gas 23,691.0 23,877.0 3/20/2023 05:00 3/20/2023 12:00 7.00 PROD1, EVALWB DDRL P Drill 6 3/4" hole F/23,877 T/24,080' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2325 PSI 100-130RPM 18-27K TQ on 15-17K off 3-15K WOB 11.97 ECD P/U - 266K S/O - 146K ROT- 196K 136 Units Max Gas 23,877.0 24,080.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 94/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/20/2023 12:00 3/21/2023 00:00 12.00 PROD1, EVALWB DDRL P Drill 6 3/4" hole F/24,080' T/24,475' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2315 PSI 120 RPM 20K TQ on 15K off 5-9K WOB 12.08 ECD P/U - 265K S/O - 147K ROT- 206K 133 Units Max Gas AVG = 33 FPH W/connections ADT= 9.53 Bit HRS= 87.73 24,080.0 24,475.0 3/21/2023 00:00 3/21/2023 12:00 12.00 PROD1, EVALWB DDRL P Drill 6 3/4" hole F/24,475' T/24,896' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2340 PSI 120 RPM 21K TQ on 18K off 7-10K WOB 12.09 ECD P/U - 270K S/O - 147K ROT- 206K 133 Units Max Gas AVG = 35 FPH W/connections ADT= 10.91 Bit HRS= 98.64 24,475.0 24,896.0 3/21/2023 12:00 3/22/2023 00:00 12.00 PROD1, EVALWB DDRL P Drill 6 3/4" hole F/24,896' T/25,478' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2340 PSI 120 RPM 23K TQ on 17K off 17-22K WOB 12.14 ECD P/U - 272K S/O - 148K @ 24,922' ROT- 198K 177 Units Max Gas AVG = 48.5 FPH W/connections ADT= 9.84 Bit HRS= 108.48 Lost slack off WT after 24,922' - TQ and drag at 25,385' slack off lost 24,896.0 25,478.0 3/22/2023 00:00 3/22/2023 01:00 1.00 PROD1, EVALWB CIRC P At 25,476' gamma climb to 130 API Circ at 265 GPM 2350 PSI 110 RPM 17K TQ While discussing with town on direction to drill 25,478.0 25,478.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 95/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/22/2023 01:00 3/22/2023 16:45 15.75 PROD1, EVALWB DDRL P Drill 6 3/4" hole F/25,478' T/25,966' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2300 PSI 75-150 RPM 25K TQ on 17K off 5-20K WOB 12.14 ECD P/U - 278K S/O - N/A ROT- 198K 177 Units Max Gas AVG = 31 FPH W/connections ADT= 13.42 Bit HRS= 121.90 25,478.0 25,966.0 3/22/2023 16:45 3/22/2023 18:00 1.25 PROD1, EVALWB CIRC T Circ at 250 GPM 2140 PSI , 100 RPM 17-22K TQ 11.93 ECD 198K Rot WT 25,966.0 25,853.0 3/22/2023 18:00 3/23/2023 00:00 6.00 PROD1, EVALWB BKRM T BROOH F/25,851' T/25,387' 265 GPM 2300 PSI 100 RPM 17-20K TQ ECD = 11.98 198K ROT WT Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections Log lower Kalubik shale at 60 RPM 265 GPM 120 FPH, F/25,728' T/25,469' 25,853.0 25,387.0 3/23/2023 00:00 3/23/2023 02:30 2.50 PROD1, EVALWB BKRM T BROOH F/25,387' T/24,639' 205 GPM 1820 PSI 80 RPM 20K TQ ECD = 11.81 203K ROT WT Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections 25,387.0 24,639.0 3/23/2023 02:30 3/23/2023 04:00 1.50 PROD1, EVALWB SMPD T Pump out of hole at 1 BPM F/24,639' T/24,172' 1 BPM 555 PSI 270 K UP Holding 190 PSI with MPD dynamic and 230 PSI in slips maintaining 11.7 PPG EMW at 7 5/8" shoe Notice pump PSI start to climb 20 - 40 PSI at 24,181' 24,639.0 24,172.0 3/23/2023 04:00 3/23/2023 05:15 1.25 PROD1, EVALWB BKRM T BROOH F/24,172' T/24,080' 220 GPM 1770 PSI 80 RPM 15K TQ ECD = 11.79 203K ROT WT Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections Observe pump PSI climb to 2650 PSI with full returns, no losses. PSI slowly drop back down to 1770 PSI, seemed the PSI came from inside the drill string 24,172.0 24,080.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 96/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/23/2023 05:15 3/23/2023 07:00 1.75 PROD1, EVALWB CIRC T Circulate at 265 GPM 2240 PSI, 80 RPM 16K TQ 11.79 ECD 204K Rot WT 24,080.0 24,080.0 3/23/2023 07:00 3/23/2023 09:00 2.00 PROD1, EVALWB BKRM T BROOH F/24,080' T/23,840' 260 GPM 2250 PSI 80 RPM 15K TQ ECD = 11.83 204K ROT WT Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections Confirm inclination for possible side track points F/23,900' T/23,850' 24,080.0 23,840.0 3/23/2023 09:00 3/23/2023 09:30 0.50 PROD1, EVALWB CIRC T Circ at 265 GPM 2185 PSI, 80 RPM 15K TQ 202K Rot WT 23,840.0 23,840.0 3/23/2023 09:30 3/23/2023 15:00 5.50 PROD1, EVALWB REAM T Wash and ream F/23,840' T/25,385' 265 GPM 2250 PSI 50 RPM 13-16K TQ 11.86 ECD 23,840.0 25,385.0 3/23/2023 15:00 3/23/2023 15:30 0.50 PROD1, EVALWB CIRC T Circ at 265 GPM 2270 PSI, 50 RPM 15K TQ 207K Rot WT 25,385.0 25,385.0 3/23/2023 15:30 3/23/2023 22:30 7.00 PROD1, EVALWB BKRM T BROOH F/25,385' T/23,837' 240 GPM 1940 PSI 60 RPM 15K TQ ECD = 11.83 204K ROT WT Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections Pump 40 BBL anti jamming pill at 24,900' 25,385.0 23,837.0 3/23/2023 22:30 3/24/2023 00:00 1.50 PROD1, EVALWB KOST T Space out for troughing, send down link to BHA for tool face for side track. Observe max out values from power drive and inconstancy in readings from power drive. 23,837.0 23,837.0 3/24/2023 00:00 3/24/2023 08:00 8.00 PROD1, EVALWB CIRC T Trouble shoot jammed power drive Pump anti jamming sweeps x4 for lower torquer arms and a high possum number for demand on upper torquer arms Circ at 225-285 GPM 2450 PSI, 40-140 RPM 17K TQ 23,837.0 23,837.0 3/24/2023 08:00 3/24/2023 12:00 4.00 PROD1, EVALWB BKRM T BROOH F/23,837' T/22,790' 265 GPM 2030 PSI 60 RPM 15K TQ ECD = 11.78 201K ROT WT Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections Pump 80 BBL anti jamming sweep 23,837.0 22,790.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 97/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/24/2023 12:00 3/24/2023 15:15 3.25 PROD1, EVALWB REAM T Wash and ream F/22,790' T/23,821' 225 GPM 1700 PSI 60 RPM 13K TQ 11.72 ECD Max gas = 98 units Pump 20 BBLS low vis 20 BBL Hivis anti jamming sweep @ 23,137' Hold 11.7 EMW at the 7 5/8" shoe with MPD on connections 22,790.0 23,821.0 3/24/2023 15:15 3/24/2023 19:45 4.50 PROD1, STK KOST X Troughing as per SLBG schedule F/23,821' T/23,855' 225 GPM 1670 PSI 60 RPM 13K TQ 208K Rot WT Max Gas = 275 units Trough F/23,820' T/23,855' x3, F/23,830' T/23,855' x3, F/23,840' T/23,855' x5 23,821.0 23,855.0 3/24/2023 19:45 3/24/2023 20:45 1.00 PROD1, STK KOST X Circ and rotate as per kick off schedule for 1 HR 225 GPM 1675 PSI 60 RPM 13K TQ 205K Rot WT Max gas = 342 units Pump 40 BBL anti jamming sweep 23,855.0 23,855.0 3/24/2023 20:45 3/24/2023 21:00 0.25 PROD1, STK KOST X Cont troughing as per schedule F/23,840' T/23,855' 225 GPM 1672 PSI 60 RPM 13K TQ Max Gas = 341 units Pick up one foot T/23,854' for time drilling 23,840.0 23,854.0 3/24/2023 21:00 3/25/2023 00:00 3.00 PROD1, STK KOST X Time drill as per SLB schedule F/23,854' T/23,856' 265 GPM 2030 PSI 60 RPM 14K TQ 11.73 ECD Max gas = 365 units 23,854.0 23,856.0 3/25/2023 00:00 3/25/2023 10:15 10.25 PROD1, STK KOST X Time drill as per SLB schedule F/23,856' T/23,863' 225 GPM 1700 PSI 60 RPM 14K TQ 11.73 ECD Max gas = 95 units Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 23,856.0 23,863.0 3/25/2023 10:15 3/25/2023 13:15 3.00 PROD1, STK KOST X While increasing ROP to 2' per hour, notice sudden loss of WOB and increase in inclination. Pick up to trough F/23,847' T/23,862', trough as per SLB DD at 1 FPH while slacking off 245 GPM 1950 PSI 60 RPM 14K TQ ECD = 11.80 208K Rot WT 23,863.0 23,862.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 98/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/25/2023 13:15 3/26/2023 00:00 10.75 PROD1, STK KOST X Time drill as per SLB schedule F/23,862' T/23,869', as per SLB start seeing WOB at 23,864' 245 GPM 1945 PSI 60 RPM 14K TQ 11.82 ECD Max gas = 46 units Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 23,862.0 23,869.0 3/26/2023 00:00 3/26/2023 04:00 4.00 PROD1, STK KOST X Time drill as per SLB schedule F/23,869' T/23,877' 265 GPM 2290 PSI 60 RPM 15K TQ 11.82 ECD Max gas = 64 units Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 23,869.0 23,877.0 3/26/2023 04:00 3/26/2023 14:15 10.25 PROD1, STK DDRL X Drill 6 3/4" hole F/23,877' T/24,135' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2390 PSI 100 RPM 26K TQ on 13K off 12-14K WOB 11.99 ECD P/U - 271K S/O - 146K ROT- 201K 42 Units Max Gas ADT= 7.24 Bit HRS= 131.64 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 23,877.0 24,273.0 3/26/2023 14:15 3/26/2023 16:00 1.75 PROD1, STK MPDA X PJSM for change out MPD bearing under PSI Close bag apply 230 PSI under for 11.7 PPG EMW at 7 5/8" casing shoe, adjusting as needed for removing and installing bearings Equalize pressure between bearing and bag before opening 24,273.0 24,273.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 99/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/26/2023 16:00 3/27/2023 00:00 8.00 PROD1, STK DDRL X Drill 6 3/4" hole F/24,273' T/24,515' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2415 PSI 100 RPM 22K TQ on 19K off 7-14K WOB 12.02 ECD P/U - 276K S/O - 146K ROT- 201K 466 Units Max Gas on bottoms up from changing out bearing AVG = 30 FPH W/connections ADT= 6.32 Bit HRS= 137.96 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 24,273.0 24,515.0 3/27/2023 00:00 3/27/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/24,515' T/24,735' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2415 PSI 100 RPM 23K TQ on 20K off 13K WOB 12.08 ECD P/U - 276K S/O - 141K ROT- 200K 66 Units Max Gas AVG = 37 FPH W/connections ADT= 5.46 Bit HRS= 143.42 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 24,515.0 24,735.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 100/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/27/2023 06:00 3/27/2023 06:30 0.50 PROD1, STK DDRL X Drill 6 3/4" hole F/24,735' T/24,742' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2491 PSI 100 RPM 23K TQ on 19K off 13K WOB 12.15 ECD P/U - 279K S/O - 138K ROT- 205K 25 Units Max Gas AVG = 14 FPH W/connections ADT= .18 Bit HRS= 143.6 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 24,735.0 24,742.0 3/27/2023 06:30 3/27/2023 07:45 1.25 PROD1, STK DDRL XT Troubleshoot power drive as per SLB DD. Rack back stand #262, circ, recip f/ 24,731' t/ 24,646', 60 RPM, 18K TQ, 265 GPM, 2452 PSI, 12.08 ECD, Pump 60 bbl low vis and 60 bbl high vis anti jamming sweeps, wash back to bottom 24,742.0 24,742.0 3/27/2023 07:45 3/27/2023 12:00 4.25 PROD1, STK DDRL X Drill 6 3/4" hole F/24,742' T/25,014' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2521 PSI 120 RPM 28K TQ on 18K off 15K WOB 12.19 ECD P/U - 281K S/O - 139K ROT- 206K 40 Units Max Gas AVG = 64 FPH W/connections ADT= 3.61 Bit HRS= 147.21 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 24,742.0 25,014.0 3/27/2023 12:00 3/27/2023 12:30 0.50 PROD1, STK SVRG X Service rig - Tighten bolts and replace tie wire on top drive shot pin assembly 25,014.0 25,014.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 101/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/27/2023 12:30 3/27/2023 18:00 5.50 PROD1, STK DDRL X Drill 6 3/4" hole F/25,014' T/25,360' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2502 PSI 120 RPM 27K TQ on 19K off 14K WOB 12.26 ECD P/U - 282K S/O - 138K ROT- 207K 67 Units Max Gas AVG = 63 FPH W/connections ADT= 4.66 Bit HRS= 151.87 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 25,014.0 25,360.0 3/27/2023 18:00 3/28/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/25,360' T/25,665' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2390 PSI 110 RPM 27K TQ on 20K off 12K WOB 12.12 ECD P/U - 287K S/O - 136K ROT- 205K 124 Units Max Gas AVG = 51 FPH W/connections ADT= 4.73 Bit HRS= 156.6 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 25,360.0 25,665.0 3/28/2023 00:00 3/28/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/25,665' T/26,027' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2390 PSI 110 RPM 27K TQ on 20K off 12K WOB 12.15 ECD P/U - 294K S/O - 124K ROT- 203K 146 Units Max Gas AVG = 60 FPH W/connections ADT= 4.95 Bit HRS= 161.55 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 25,665.0 26,027.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 102/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/28/2023 06:00 3/28/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/26,027' T/26,406' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2395 PSI 120 RPM 30K TQ on 18K off 14K WOB 12.19 ECD P/U - 302K S/O - 119K ROT- 209K 146 Units Max Gas AVG = 63 FPH W/connections ADT= 4.96 Bit HRS= 166.5 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 26,027.0 26,406.0 3/28/2023 12:00 3/28/2023 18:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/26,406' T/26,778' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2353 PSI 120 RPM 28K TQ on 18K off 6K WOB 12.17 ECD P/U - 303K S/O - 118K ROT- 206K 137 Units Max Gas AVG = 62 FPH W/connections ADT= 4.89 Bit HRS= 171.39 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 26,406.0 26,778.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 103/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/28/2023 18:00 3/29/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/26,778' T/27,111' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2285 PSI 120 RPM 25K TQ on 20K off 2K WOB 12.02 ECD P/U - 312K S/O - N/A ROT- 205K 1405 Units Max Gas, gas from cutting Kup C sand AVG = 55.5 FPH W/connections ADT= 4.54 Bit HRS= 175.93 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 26,778.0 27,111.0 3/29/2023 00:00 3/29/2023 01:00 1.00 PROD1, STK DDRL X Drill 6 3/4" hole F/27,111' T/27,146' while maintaining 11.7 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2310 PSI 120 RPM 25K TQ on 20K off 12K WOB 12.02 ECD P/U - 312K S/O - N/A ROT- 205K 2344 Units Max Gas, gas from TQ/drag at 26,865' ADT= .97 Bit HRS= 176.90 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 27,111.0 27,146.0 3/29/2023 01:00 3/29/2023 03:45 2.75 PROD1, STK CIRC X Circulate thru gas buster while monitoring gas units and cuttings at shakers 265 GPM 2310 PSI 60 RPM 20K TQ Max units 834 units 12.13 - 12.03 ECD 27,146.0 27,146.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 104/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/29/2023 03:45 3/29/2023 05:15 1.50 PROD1, STK DDRL X Drill 6 3/4" hole F/27,146' T/27,240' while maintaining 12.1 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM 2310 PSI 120 RPM 25K TQ on 20K off 5K WOB 12.12 ECD P/U - 312K S/O - N/A ROT- 205K 2344 Units Max Gas, gas from TQ/drag at 26,865' ADT= 1.26 Bit HRS= 178.16 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 27,146.0 27,240.0 3/29/2023 05:15 3/29/2023 12:30 7.25 PROD1, STK CIRC XT Circulate thru gas buster at 265 GPM 2375 PS, 60 RPM 20K TQ, 205K ROT, 12.13 ECD, 1150 units max gas. 11.1 MW 27,240.0 27,240.0 3/29/2023 12:30 3/29/2023 14:30 2.00 PROD1, STK OWFF XT Perform drawdown via MPD choke. Shut down pump, trap 12.2 ppg EMW, perform 10ea ~40 psi step down bleed offs, monitor psi for 5 min after each cycle, monitor final shut 25 min. Final pressue= 372 psi RCD, 327 psi DP. 14 bbls total pit gain 27,240.0 27,240.0 3/29/2023 14:30 3/29/2023 22:00 7.50 PROD1, STK CIRC XT CBU through gas buster after draw down test at 27,240' 265 GPM 2205 PSI 60 RPM 18K TQ 206K Rot WT ECD = 12.25 Max gas seen = 1180 Units 27,240.0 27,240.0 3/29/2023 22:00 3/30/2023 00:00 2.00 PROD1, STK CIRC XT Circulate thru MGS while build 12.6 sodium bromide vis brine 265 GPM 2205 PSI 60 RPM 18K TQ 206K Rot WT ECD = 12.25 Max gas seen = 586 Units 27,240.0 27,240.0 3/30/2023 00:00 3/30/2023 02:45 2.75 PROD1, STK CIRC XT Circulate while building 12.6 PPG sodium bromide vis brine 265 GPM 2075 PSI 60 RPM 18K TQ 203K Rot WT ECD = 12.34 Max gas seen = 281 Units Off MGS at 0240 Hrs 27,240.0 27,240.0 3/30/2023 02:45 3/30/2023 12:00 9.25 PROD1, STK CIRC XT Circulate while building 12.6 PPG sodium bromide vis brine 265 GPM 2060 PSI 60 RPM 18K TQ 203K Rot WT ECD = 12.32 Max gas seen = 125 Units 27,240.0 27,240.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 105/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/30/2023 12:00 3/30/2023 14:30 2.50 PROD1, STK CIRC XT Circulate while building 12.6 PPG sodium bromide vis brine 265 GPM 2009 PSI 60 RPM 18K TQ 203K Rot WT ECD = 12.31 Max gas seen = 131 Units 27,240.0 27,240.0 3/30/2023 14:30 3/30/2023 18:00 3.50 PROD1, STK BKRM XT BROOH F27,235 T/26,150' 265 GPM 1993 PSI 60 RPM 15K TQ ECD = 12.36 203K ROT WT Hold 12.3 EMW with MPD on connections 27,240.0 26,150.0 3/30/2023 18:00 3/31/2023 00:00 6.00 PROD1, STK BKRM XT BROOH F/26,150' T/24,924' - Hold 12.3 EMW with MPD on connections 265 GPM 2050 PSI 60 RPM 15K TQ ECD = 12.46 206K ROT WT Max gas = 329 units 26,150.0 24,924.0 3/31/2023 00:00 3/31/2023 06:45 6.75 PROD1, STK BKRM XT BROOH F/24,924' T/23,250' - Hold 12.3 EMW with MPD on connections 265 GPM 2000 PSI 60 RPM 17K TQ ECD = 12.51 201K ROT WT Max gas = 1011 units 24,924.0 23,250.0 3/31/2023 06:45 3/31/2023 12:00 5.25 PROD1, STK CIRC XT Circulate while weighing up in .3 PPG increments from 11.1 PPG T/11.4 PPG with micro bar 265 GPM 1900 PSI 60 RPM 14K TQ 12.50 ECD 197K Rot WT Max gas = 108 units 23,250.0 23,250.0 3/31/2023 12:00 3/31/2023 18:00 6.00 PROD1, STK CIRC XT Circulate while weighing up in .3 PPG increments from 11.4 PPG T/11.7 PPG with micro bar 265 GPM 1900 PSI 60 RPM 14K TQ 12.60 ECD 197K Rot WT Max gas = 53 units 23,250.0 23,250.0 3/31/2023 18:00 4/1/2023 00:00 6.00 PROD1, STK CIRC XT Circulate while weighing up in .3 PPG increments from 11.7 PPG T/12.0 PPG with micro bar 265 GPM 1893 PSI 60 RPM 14K TQ 12.60 ECD 197K Rot WT Max gas = 149 units 23,250.0 23,250.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 106/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/1/2023 00:00 4/1/2023 06:00 6.00 PROD1, STK CIRC XT Circulate while weighing up F/12.0 PPG T/12.6 PPG with 15.0 ppg spike fluid 265 GPM 1908 PSI 60 RPM 14K TQ 12.98 ECD 200K Rot WT Max gas = 45 units 23,250.0 23,250.0 4/1/2023 06:00 4/1/2023 12:00 6.00 PROD1, STK CIRC XT Circulate while weighing up F/12.0 PPG T/12.6 PPG with 15.0 ppg spike fluid 110 GPM 760 PSI 60 RPM 15K TQ 13.2 ECD modeled 199K Rot WT Max gas = 41 units Slow pump rate down as needed to keep ECD under 13.2 PPG - then follow beyond pump schedule 23,250.0 23,250.0 4/1/2023 12:00 4/1/2023 13:30 1.50 PROD1, STK CIRC XT Circulate while weighing up F/12.0 PPG T/12.6 PPG with 15.0 ppg spike fluid 110 GPM 760 PSI 60 RPM 15K TQ 13.2 ECD modeled 199K Rot WT Max gas = 41 units 12.6 ppg in and out Slow pump rate down as needed to keep ECD under 13.2 PPG 23,250.0 23,250.0 4/1/2023 13:30 4/1/2023 14:15 0.75 PROD1, STK OWFF XT Blow down TD, flow check w/rot 20 rpm 23,250.0 23,250.0 4/1/2023 14:15 4/1/2023 19:30 5.25 PROD1, STK SMPD X SOOH F/23,250' T/20,187' w/MPD per schedule to offset swab to last std 5-7/8" DP. 23,250.0 20,187.0 4/1/2023 19:30 4/1/2023 21:00 1.50 PROD1, STK OWFF X Flow check. 1 hr to go static. OWFF 30 min static 20,187.0 20,187.0 4/1/2023 21:00 4/1/2023 22:30 1.50 PROD1, STK MPDA X Swap MPD bearing/element F/ 5-7/8" T/ 4-1/2" 20,187.0 20,187.0 4/1/2023 22:30 4/2/2023 00:00 1.50 PROD1, STK SMPD X SOOH F/20,187' T/20,19,057' w/MPD per schedule to offset swab 20,187.0 19,057.0 4/2/2023 00:00 4/2/2023 01:30 1.50 PROD1, STK SMPD X SOOH F/19,057' T/17,918' w/MPD holding 12.6 PPG EMW per schedule to offset swab 218K UP 19,057.0 17,918.0 4/2/2023 01:30 4/2/2023 07:30 6.00 PROD1, STK CIRC X CBU to make sure mud correct mud weight, stage pumps up to 265 GPM 1800 PSI, 60 RPM 12K TQ 168K Rot WT 17,918.0 17,918.0 4/2/2023 07:30 4/2/2023 10:30 3.00 PROD1, STK OWFF X Blow down top drive, flow check until static 17,918.0 17,918.0 4/2/2023 10:30 4/2/2023 15:30 5.00 PROD1, STK SMPD X SOOH F/17,918' T/10,472' w/MPD holding 12.6 PPG EMW per schedule to offset swab 168K UP 17,918.0 10,472.0 4/2/2023 15:30 4/2/2023 16:00 0.50 PROD1, STK SVRG X Service top drive and blocks 10,472.0 10,472.0 4/2/2023 16:00 4/2/2023 16:45 0.75 PROD1, STK RGRP XT Replace spinner hose on ST120 10,472.0 10,472.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 107/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/2/2023 16:45 4/2/2023 20:00 3.25 PROD1, STK SMPD X SOOH F/10,472' T/5,938' w/MPD holding 12.6 PPG EMW per schedule to offset swab 161K UP 10,472.0 5,938.0 4/2/2023 20:00 4/2/2023 23:00 3.00 PROD1, STK OWFF X Flow check - Static in 2 1/2 HRS - monitor 30 min after static SimOps - PJSM for blowing down MPD lines and pulling 4 1/2" RCD 5,938.0 5,938.0 4/2/2023 23:00 4/3/2023 00:00 1.00 PROD1, STK MPDA X Pull 4 1/2" RCD as per MPD advisor 5,938.0 5,938.0 4/3/2023 00:00 4/3/2023 00:45 0.75 PROD1, STK CIRC X Pump dry job, blow down top drive 5,938.0 5,938.0 4/3/2023 00:45 4/3/2023 03:00 2.25 PROD1, STK TRIP X POOH F/5,938' T/1,711' 5,938.0 1,711.0 4/3/2023 03:00 4/3/2023 03:30 0.50 PROD1, STK OWFF X Observed inproper hole fill last 10 stands Shut down, flow check, slight drop in fluid 1,711.0 1,711.0 4/3/2023 03:30 4/3/2023 04:15 0.75 PROD1, STK TRIP X POOH F/1,711' T/653' 1,711.0 653.0 4/3/2023 04:15 4/3/2023 04:45 0.50 PROD1, STK OWFF X Flow check - slight drop PJSM L/D BHA #8 653.0 653.0 4/3/2023 04:45 4/3/2023 05:00 0.25 PROD1, STK TRIP X POOH F/653' T/182' 653.0 182.0 4/3/2023 05:00 4/3/2023 08:00 3.00 PROD1, STK BHAH X L/D BHA # 8 as per SLB DD Stabilzer's on the NM stab, ADN and the microscope were worn off Periscope reciever window was loose Power drive all pads were there but worn down, control stab was worn off 182.0 0.0 4/3/2023 08:00 4/3/2023 10:15 2.25 PROD1, STK BHAH X Shut blind rams, Clean and clear floor, LD BHA #8, PU BHA #9 SIMOPS: C/O KR valve, Replace upper air boot on BOP riser, prep for BOP test 0.0 0.0 4/3/2023 10:15 4/3/2023 11:00 0.75 PROD1, WHDBOP WWWH X Function preventers, MU stack wash tool to 1 std 5-7/8" DP, wash stack at max pump rate until shakers clean 0.0 0.0 4/3/2023 11:00 4/3/2023 12:00 1.00 PROD1, WHDBOP RURD X Drain stack, blow down choke, kill, mud line and TD. MU WR running tool w/ 2 Jts 5" DP and pull wear ring. 0.0 0.0 4/3/2023 12:00 4/3/2023 12:45 0.75 PROD1, WHDBOP RURD X Set test plug per SOP w/ 4-1/2" test joint, hang stand of 5-7/8" DP below test plug 0.0 0.0 4/3/2023 12:45 4/3/2023 13:30 0.75 PROD1, WHDBOP RURD X Flood BOP, kill line choke line and choke manifold with water, conduct shell test ok 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 108/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/3/2023 13:30 4/3/2023 18:00 4.50 PROD1, WHDBOP BOPE X Perform BOPE Tests W/ 4 1/2" test joint, Annular 250 psi F/ 5 min, 2,500 psi F/ 10 min. Remaining Test 250 F/ 5 min, 4,000 F/ 10 min. Upper 4-1/2" X 7-5/8" VBRS, Lower 3-1/2" x 6-5/8" VBRS, CMV #1-#16 Manual & HCR Choke/KIll and Kill Valve #3, Upper and Lower IBOPS, 4-1/2" and 5-7/8" TIW and Dart Valves, Charted all tests. Test PVT Gain /Loss and Flow out Alarms. Test LEL and H2S alarms. AOGCC Kam StJohn waived witness BOP test on 3- 31-2023 @ 06:28 hrs. BLM Quinn Sawyer waived witness BOP test on 3- 30-2023 @ 13:05 hrs. 0.0 0.0 4/3/2023 18:00 4/3/2023 21:30 3.50 PROD1, WHDBOP BOPE X Perform BOPE Tests W/ 4 1/2" & 5-7/8" test joints, Test T/ 250 F/ 5 min, 4,000 F/ 10 min. Upper 4-1/2" X 7-5/8" VBRS, Lower 3-1/2" x 6-5/8" VBRS, CMV #3, Blind Shears, Manual choke B and electric super choke A. Charted all test. Conducted Koomey drawdown, Accumulator = 2,900 psi, Manifold = 1,480 psi, Accumulator = 1,650 psi after all functions on bottles, 17 seconds for 200 psi build with 2 electric pumps. 93 seconds to full system pressure with 2 electric pumps and 6 air pumps. Closing times: Annular = 24 sec, UPR = 15 sec, Blind/Shear rams = 16 sec, LPR = 15 sec, Choke HCR = 2 sec, Kill HCR = 2 sec. Nitrogen back up 10 bottle average = 3,950 psi. Test PVT gain/loss & flow out alarms. AOGCC Kam StJohn waived witness BOP test on 3-31-2023 @ 06:28 hrs. BLM Quinn Sawyer waived witness BOP test on 3-30-2023 @ 13:05 hrs. 0.0 0.0 4/3/2023 21:30 4/3/2023 23:00 1.50 PROD1, WHDBOP RURD X Pull test plug as per SOP w/ 5-7/8" test Jt, rack back std 5-7/8" DP in derrick 0.0 0.0 4/3/2023 23:00 4/4/2023 00:00 1.00 PROD1, WHDBOP RURD X Blow down all surface lines, RD testing equipment, clean clear floor 0.0 0.0 4/4/2023 00:00 4/4/2023 00:30 0.50 PROD1, WHDBOP RURD X Clean and clear rig floor, P/U 2 JTS 5" DP and wear ring setting tool SimOps - work on ST120 0.0 0.0 4/4/2023 00:30 4/4/2023 01:00 0.50 PROD1, WHDBOP SVRG X Clean and service pipe stripper 0.0 0.0 4/4/2023 01:00 4/4/2023 02:00 1.00 PROD1, WHDBOP RGRP XT Repair ST-120 Iron roughneck 0.0 0.0 4/4/2023 02:00 4/4/2023 03:00 1.00 PROD1, WHDBOP RURD X Set W/R, check lockdown measurements, L/D setting tool and 2 JTS 5" DP, fill stack 22 bbls 0.0 0.0 4/4/2023 03:00 4/4/2023 07:00 4.00 PROD1, STK BHAH X PJSM, M/U BHA #9 as per SLB DD T/181' 0.0 181.0 4/4/2023 07:00 4/4/2023 08:45 1.75 PROD1, STK TRIP X RIH F/182' T/3,006' 104K DN Single in the first 8 STDS of 4 1/2" DP 181.0 3,006.0 4/4/2023 08:45 4/4/2023 09:45 1.00 PROD1, STK CIRC X Shallow test MWD tools 260 GPM 1556 PSI 3,006.0 3,006.0 4/4/2023 09:45 4/4/2023 18:30 8.75 PROD1, STK TRIP X RIH F/3,006' T/17,955' 118K DN Filling pipe every 30 STDS 3,006.0 17,955.0 4/4/2023 18:30 4/4/2023 19:30 1.00 PROD1, STK MPDA X PJSM, install 4-1/2" RCD bearing/element per MPD advisor/SOP 17,955.0 17,955.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 109/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/4/2023 19:30 4/4/2023 21:30 2.00 PROD1, STK RURD X C/O TD saver sub, inspect grabber dies. SIMOPS: Prep for slip and cut 17,955.0 17,955.0 4/4/2023 21:30 4/4/2023 22:30 1.00 PROD1, STK SLPC X MU 10', 5-7/8" pup, hang blocks, remove drawworks covers 17,955.0 17,955.0 4/4/2023 22:30 4/5/2023 00:00 1.50 PROD1, STK SLPC X Slip and cut 85' of drill line. SIMOPS: Begin circ/ reduce MW to 12.3 ppg mud. 120 gpm, 820 psi 17,955.0 17,955.0 4/5/2023 00:00 4/5/2023 00:30 0.50 PROD1, STK SLPC X Install drawworks covers, unhang blocks 17,955.0 17,955.0 4/5/2023 00:30 4/5/2023 05:00 4.50 PROD1, STK DISP X Circ 12.3 PPG mud in and out @ 250 GPM 2150 PSI 17,955.0 17,955.0 4/5/2023 05:00 4/5/2023 05:30 0.50 PROD1, STK OTHR X Blow down top drive, get empty block calibration for TQ/Drag 17,955.0 17,955.0 4/5/2023 05:30 4/5/2023 07:15 1.75 PROD1, STK SMPD X Strip in the hole with 4 1/2" DP F/17,955' T/20,097' As per Beyond schedule, holding 12.5 PPG EMW at toe 120K DN 17,955.0 20,097.0 4/5/2023 07:15 4/5/2023 07:45 0.50 PROD1, STK OWFF X Obtain rotating weight with just 4 1/2" DP after pipe full 30 RPM 12K 172K Rot WT Flow check - 15 min 20,097.0 20,097.0 4/5/2023 07:45 4/5/2023 09:15 1.50 PROD1, STK MPDA X PJSM, pull 4 1/2" bearing and install 5 7/8" bearing Pump 100 GPM 950 PSI 215K UP 140K DN 20,097.0 20,097.0 4/5/2023 09:15 4/5/2023 09:45 0.50 PROD1, STK SMPD X Strip in the hole with 5 7/8" DP F/20,097' T/20,392' As per Beyond schedule, holding 12.5 PPG EMW at toe 121K DN 20,097.0 20,392.0 4/5/2023 09:45 4/5/2023 10:45 1.00 PROD1, STK OTHR X Perform NOVOS TQ test for calibration prior exit liner 20,392.0 20,392.0 4/5/2023 10:45 4/5/2023 13:30 2.75 PROD1, STK SMPD X Strip in the hole with 5 7/8" DP F/20,392' T/22,568', taking weight As per Beyond schedule, holding 12.5 PPG EMW at toe 121K DN 20,392.0 22,568.0 4/5/2023 13:30 4/5/2023 15:00 1.50 PROD1, STK CIRC X Stacked out at 22,568', attempt to work thru w/o success, fill pipe, start pump/rotary staging up pump rate to 200 gpm, was not getting full returns, reduced flow rate to 50 gpm/ 782 psi to get full returns. 20 rpm/9K Tq 22,568.0 22,568.0 4/5/2023 15:00 4/5/2023 16:45 1.75 PROD1, STK BKRM X BROOH F/22,568' T/22,239' 75 gpm at 831 psi 20 rpm at 12K Tq 186K ROT 22,568.0 22,239.0 4/5/2023 16:45 4/5/2023 18:00 1.25 PROD1, STK CIRC X Stage up pump rate to 120 gpm, 1021 psi. 30 RPM, 11K tq No losses 22,239.0 22,239.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 110/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/5/2023 18:00 4/6/2023 00:00 6.00 PROD1, STK CIRC X Continue stage pump rate up to 250 gpm, 2346 psi, 30 RPM, 10K Tq, ECD 13.0. Max gas 74 units. Circ out heavy mud, 12.6 max out No losses 22,239.0 22,239.0 4/6/2023 00:00 4/6/2023 06:00 6.00 PROD1, STK REAM X Ream in hole F/22,239' T/22,250' 240 GPM, 2223 psi 60 RPM, 16K Tq 192K Rot Wt Maintaining 13.0 ECD 22,239.0 23,252.0 4/6/2023 06:00 4/6/2023 14:45 8.75 PROD1, STK DISP X Circ and reciprocate. 40 RPM, 14K Tq. PJSM, Displace well over to 11.1 ppg FloPro mud as per Mud Engineer and Beyond schedule. Pump 100 bbls 14.6 ppg spacer followed by 11.1 ppg FloPro to surface. ECD 12.6 to13.11, 210 to 260 GPM, 2070 to 2450 psi 23,252.0 23,252.0 4/6/2023 14:45 4/6/2023 15:00 0.25 PROD1, STK DISP X Obtain SPR's and rotating weight 20 RPM, 11K Tq 190K Rot Wt 23,252.0 23,252.0 4/6/2023 15:00 4/7/2023 00:00 9.00 PROD1, STK REAM X Ream in hole F/23,252' T/26,405' 240 GPM, 2269 psi 30 RPM, 14K Tq 192K Rot Wt Holding 12.5 EMW Max gas 20 units 23,252.0 26,405.0 4/7/2023 00:00 4/7/2023 04:15 4.25 PROD1, STK REAM X Ream in hole F/26,405' T/27,240' 240 GPM, 2269 psi 30 RPM, 14K Tq 192K Rot Wt Holding 12.6 EMW Max gas 20 units 26,405.0 27,240.0 4/7/2023 04:15 4/7/2023 06:00 1.75 PROD1, STK DDRL X Obtain T&D, SPR's. Drill 6 3/4" hole F/27,240' T/27,311' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 264 GPM 2603 PSI 100 RPM 29K TQ on 29K off 5K WOB 12.58 ECD P/U - 296K S/O - N/A ROT- 206K 49 Units Max Gas AVG = 41 FPH W/connections ADT= 1.68 Bit HRS= 1.68 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 27,240.0 27,311.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 111/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/7/2023 06:00 4/7/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/27,311' T/27,426' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 264 GPM 2662 PSI 100 RPM 31K TQ on 31K off 5K WOB 12.76 ECD P/U - 296K S/O - N/A ROT- 206K 294 Units Max Gas AVG = 19.2 FPH W/connections ADT= 3.52 Bit HRS= 5.2 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 27,311.0 27,426.0 4/7/2023 12:00 4/7/2023 18:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/27,426' T/27,706' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 260 GPM 2652 PSI 100 RPM 29K TQ on 29K off 7.5K WOB 12.7 ECD P/U - 301K S/O - N/A ROT- 207K 99 Units Max Gas AVG = 46.7 FPH W/connections ADT= 4.14 Bit HRS= 9.45 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 27,426.0 27,706.0 4/7/2023 18:00 4/8/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/27,706' T/28,161' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 264 GPM 2718 PSI 100 RPM 30K TQ on 28K off 14K WOB 12.73 ECD P/U - 300K S/O - N/A ROT- 210K 173 Units Max Gas AVG = 75.8 FPH W/connections ADT= 4.4 Bit HRS= 13.85 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 27,706.0 28,161.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 112/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/8/2023 00:00 4/8/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/28,161' T/28,446' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM, 2798 PSI 100 RPM 28K TQ on 26K off 10K WOB 12.82 ECD P/U - 300K, S/O - N/A, ROT- 210K 180 Units Max Gas AVG = 47.5 FPH W/connections ADT= 4.53 Bit HRS= 18.38 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 28,161.0 28,446.0 4/8/2023 06:00 4/8/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/28,446' T/28,816' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2736 PSI 90-100 RPM 27K TQ on 23K off 5-20K WOB 12.84 ECD P/U - 298K, S/O - N/A, ROT- 211K 238 Units Max Gas AVG = 61.7 FPH W/connections ADT= 4.41 Bit HRS= 22.77 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 28,446.0 28,816.0 4/8/2023 12:00 4/8/2023 14:00 2.00 PROD1, STK DDRL X Drill 6 3/4" hole F/28,816' T/28,947' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2729 PSI 100 RPM 26-29K TQ on 26K off 4-8K WOB 12.85 ECD P/U - 298K, S/O - N/A, ROT- 211K 147 Units Max Gas AVG = 65.5 FPH W/connections ADT= 1.7 Bit HRS= 24.47 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 28,816.0 28,947.0 4/8/2023 14:00 4/8/2023 15:00 1.00 PROD1, STK CIRC X Circulate and reciprocate while discuss geologic steering 200 gpm, 1830 psi 30 rpm, 15-17K Tq 207K PUW, 192K Rot Wt 28,947.0 28,947.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 113/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/8/2023 15:00 4/8/2023 18:00 3.00 PROD1, STK DDRL X Drill 6 3/4" hole F/28,947' T/29,030' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2729 PSI 100 RPM 26-29K TQ on 26K off 4-8K WOB 12.85 ECD P/U - 298K, S/O - N/A, ROT- 211K 147 Units Max Gas AVG = 27.7 FPH W/connections ADT= 2.54 Bit HRS= 27.01 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 28,947.0 29,030.0 4/8/2023 18:00 4/9/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/29,.030' T/29,269' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2802 PSI 90-100 RPM 26-30K TQ on 26K off 12K WOB 12.83 ECD P/U - 298K, S/O - N/A, ROT- 211K 35 Units Max Gas AVG = 39.8 FPH W/connections ADT= 5.23 Bit HRS= 32.24 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 29,030.0 29,269.0 4/9/2023 00:00 4/9/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/29.269' T/29,540' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2850 PSI 120 RPM 32K TQ on 28K off 18K WOB 12.96 ECD P/U - 300K, S/O - N/A, ROT- 205K 35 Units Max Gas AVG = 45.2 FPH W/connections ADT= 4.77 Bit HRS= 37.01 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 29,269.0 29,540.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 114/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/9/2023 06:00 4/9/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" hole F/29.540' T/29,720' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2862 PSI 110 RPM 30K TQ on 28K off 11K WOB 12.94 ECD P/U - 322K, S/O - N/A, ROT- 215K 25 Units Max Gas AVG = 30 FPH W/connections ADT= 4.59 Bit HRS= 41.78 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 29,540.0 29,720.0 4/9/2023 12:00 4/9/2023 18:45 6.75 PROD1, STK DDRL X Drill 6 3/4" hole F/29.720' T/29,930' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2846 PSI 110 RPM 30K TQ on 28K off 11K WOB 13.0 ECD P/U - 322K, S/O - N/A, ROT- 215K 25 Units Max Gas AVG = 31.1 FPH W/connections ADT= 6.1 Bit HRS= 47.88 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 29,720.0 29,930.0 4/9/2023 18:45 4/9/2023 19:15 0.50 PROD1, STK SVRG X Service rig. Grease/inspect traveling blocks, Top Drive, upper/lower IBOP, grease washpipe. 29,930.0 29,930.0 4/9/2023 19:15 4/10/2023 00:00 4.75 PROD1, STK DDRL X Drill 6 3/4" hole F/29.930' T/30,214' while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 GPM , 2886 PSI 110 RPM 30K TQ on 28K off 4K WOB 12.96 ECD P/U - 318K, S/O - N/A, ROT- 211K 23 Units Max Gas AVG = 59.8 FPH W/connections ADT= 4.47 Bit HRS= 51.6 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low 29,930.0 30,214.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 115/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/10/2023 00:00 4/10/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 30,214'- 30,502' MD, 7207' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 3020 psi on 110 rpm 31K TQ on, 28K off 10K WOB 13.17 ECD P/U - 322K, S/O - N/A, ROT- 214K 303 Units Max Gas AVG = 48 FPH W/connections ADT= 4.51 Bit HRS= 56.11 Pump 40 BBL anti-jamming sweeps every 6 HRS, to keep possum numbers low. 30,214.0 30,502.0 4/10/2023 06:00 4/10/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 30,502'- 30,672' MD, 7204' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 3015 psi on 100 rpm 31K TQ on, 28K off 10K WOB 13.09 ECD P/U - 322K, S/O - N/A, ROT- 214K 294 Units Max Gas AVG = 28.3 FPH W/connections ADT= 5.61 Bit HRS= 61.72 Pump 40 BBL anti-jamming sweeps every 6 HRS, to keep possum numbers low. 30,502.0 30,672.0 4/10/2023 12:00 4/10/2023 18:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 30,672'- 30,982' MD, 7196' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2977 psi on 90-110 rpm 35K TQ on, 32K off 10K WOB 13.12 ECD P/U - 326K, S/O - N/A, ROT- 214K 74 Units Max Gas AVG = 51.6 FPH W/connections ADT= 4.66 Bit HRS= 66.38 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low. Perform 200 bbls dump and dilute at 30,950' MD. 30,672.0 30,982.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 116/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/10/2023 18:00 4/11/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 30,982'- 31,204' MD, 7192' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 263 gpm , 2934 psi on 100 rpm 34K TQ on, 30K off 15K WOB 13.07 ECD P/U - 326K, S/O - N/A, ROT- 214K 74 Units Max Gas AVG = 37 FPH W/connections ADT= 4.76 Bit HRS= 71.14 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low. Perform 275 bbls dump and 345 bbls dilute at 31,138' MD. 30,982.0 31,204.0 4/11/2023 00:00 4/11/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 31,204' - 31,530' MD, 7186' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2934 psi on 100 rpm 34K TQ on, 30K off 15K WOB 13.16 ECD P/U - 325K, S/O - N/A, ROT- 209K 930 Units Max Gas AVG = 54.3 FPH W/connections ADT= 4.66 Bit HRS= 75.80 Pump 40 BBL anti jamming sweeps every 6 HRS, to keep possum numbers low. 31,204.0 31,530.0 4/11/2023 06:00 4/11/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 31,530' - 31,828' MD, 7179' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2988 psi on 100 rpm 35K TQ on, 32K off 8K WOB 13.17 ECD P/U - 325K, S/O - N/A, ROT- 209K 1521 Units Max Gas AVG = 49.6 FPH W/connections ADT= 4.95 Bit HRS= 80.75 Pump 40 BBL anti jamming sweep every 6 HRS, to keep possum numbers low. 31,530.0 31,828.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 117/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/11/2023 12:00 4/11/2023 18:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 31,828' - 32,007' MD, 7185' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2965 psi on 100 rpm 33K TQ on, 30K off 10K WOB 13.15 ECD P/U - 326K, S/O - N/A, ROT- 216K 1904 Units Max Gas AVG = 29.8 FPH W/connections ADT= 5.19 Bit HRS= 85.94 Pump 40 BBL anti jamming sweep every 6 HRS, to keep possum numbers low. 31,828.0 32,007.0 4/11/2023 18:00 4/12/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 32,007' - 32,067' MD, 7185' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2947 psi on 100 rpm 33K TQ on, 30K off 6.5K WOB 13.13 ECD P/U - 326K, S/O - N/A, ROT- 216K 50 Units Max Gas AVG = 10 FPH W/connections ADT= 5.79 Bit HRS= 91.73 Pump 40 BBL anti jamming sweep every 6 HRS, to keep possum numbers low. 32,007.0 32,067.0 4/12/2023 00:00 4/12/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 32,067' - 32,346' MD, 7193' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2911 psi on 100 rpm 37K TQ on, 34K off 10K WOB 13.19 ECD P/U - 326K, S/O - N/A, ROT- 216K 95 Units Max Gas AVG = 46.5 FPH W/connections ADT= 5.16 Bit HRS= 96.89 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 32,067.0 32,346.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 118/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/12/2023 06:00 4/12/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 32,346' - 32,717' MD, 7199' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2900 psi on 100 rpm 36K TQ on, 32K off 5-8K WOB 13.22 ECD P/U - 327K, S/O - N/A, ROT- 213K 246 Units Max Gas AVG = 61.8 FPH W/connections ADT= 4.30 Bit HRS= 101.19 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 32,346.0 32,717.0 4/12/2023 12:00 4/12/2023 18:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 32,717' - 33,107' MD, 7193' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2932 psi on 100 rpm 38K TQ on, 36K off 5-8K WOB 13.34 ECD P/U - 336K, S/O - N/A, ROT- 216K 257 Units Max Gas AVG = 65 FPH W/connections ADT= 4.61 Bit HRS= 105.8 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 32,717.0 33,107.0 4/12/2023 18:00 4/13/2023 00:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 33,107' - 33,352' MD, 7187' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2976 psi on 100 rpm 37K TQ on, 34K off 6K WOB 13.29 ECD P/U - 336K, S/O - N/A, ROT- 216K 276 Units Max Gas AVG = 40.8 FPH W/connections ADT= 5.39 Bit HRS= 111.19 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 33,107.0 33,352.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 119/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/13/2023 00:00 4/13/2023 06:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 33,352' - 33,671' MD, 7198' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2985 psi on 100 rpm 36K TQ on, 34K off 8K WOB 13.4 ECD P/U - 334K, S/O - N/A, ROT- 217K 107 Units Max Gas AVG = 53.2 FPH W/connections ADT= 3.89 Bit HRS= 115.08 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 33,352.0 33,671.0 4/13/2023 06:00 4/13/2023 12:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 33,671' - 34,053' MD, 7192' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 2995 psi on 92 rpm 39K TQ on, 36K off 10K WOB 13.44 ECD P/U - 360K, S/O - N/A, ROT- 217K 270 Units Max Gas AVG = 63.6 FPH W/connections ADT= 3.82 Bit HRS= 119.35 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 33,671.0 34,053.0 4/13/2023 12:00 4/13/2023 18:00 6.00 PROD1, STK DDRL X Drill 6 3/4" production hole from 34,053' - 34,372' MD, 7191' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 3016 psi on 90 rpm 32K TQ on, 31K off 15-20K WOB 13.46 ECD P/U - 362K, S/O - N/A, ROT- 217K 239 Units Max Gas AVG = 53.2 FPH W/connections ADT= 4.83 Bit HRS= 124.18 Pump 40 BBL anti-jamming sweep every 6 HRS, to keep possum numbers low. 34,053.0 34,372.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 120/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/13/2023 18:00 4/13/2023 20:15 2.25 PROD1, STK DDRL X Drill 6 3/4" production hole from 34,372' - 34,487' MD, 7184' TVD, while maintaining 12.6 PPG EMW on connections at the 7 5/8" shoe with MPD. 265 gpm , 3016 psi on 90 rpm 32K TQ on, 31K off 15-20K WOB 13.46 ECD P/U - 362K, S/O - N/A, ROT- 217K 239 Units Max Gas AVG = 53.2 FPH W/connections ADT= 1.61 Bit HRS= 125.79 34,372.0 34,487.0 4/13/2023 20:15 4/14/2023 00:00 3.75 PROD1, TRIPCAS CIRC P Rack back stand 367. Obtain final torque & drag data. Obtain slow circulating rates. Pump sweep of 40 bbls high vis & 40 bbls low vis. Circulate & condition at 265 gpm, 3005 psi, 100 rpm, Tq 34K, ECD 13.36, PU 360K, SO N/A, ROT 218K, max gas 50. 34,487.0 34,478.0 4/14/2023 00:00 4/14/2023 05:00 5.00 PROD1, TRIPCAS CIRC P Circulate & condition at 265 gpm, 3005 psi, 100 rpm, Tq 34K, ECD 13.36, PU 360K, SO N/A, ROT 218K, max gas 125, total strokes pumped 24,390. 34,478.0 34,478.0 4/14/2023 05:00 4/14/2023 05:30 0.50 PROD1, TRIPCAS OWFF P Blow down top drive & grease wash pipe. Prep for drawdown, line up on trip tank 2 and flood flow line to trip tank. 34,478.0 34,478.0 4/14/2023 05:30 4/14/2023 06:15 0.75 PROD1, TRIPCAS OWFF P Perform static drawdown to 12.3 ppg EMW; 454 psi; 11.1 ppg; 7184' TVD. Bled back 2.2 bbls to the trip tank. 10 rpm, Tq 18K, ROT 228K Start with 490 psi on MPD. Trip tank volume = 11.6 bbls initial; 13.8 bbls final All step are choke 25% open for 5 seconds and monitor for 5 min #1 draw down - 490 to 451 psi; 5 min = 462 psi, pit gain = .5 bbls, #2 draw down - 462 to 354 psi; 5 min = 452 psi, pit gain = .5 bbls, #3 draw down - 454 to 367 psi; 5 min = 450 psi, pit gain = .4 bbls, #4 draw down - 453 to 397 psi; 5 min = 454 psi, pit gain = .4 bbls, 34,478.0 34,478.0 4/14/2023 06:15 4/14/2023 12:00 5.75 PROD1, TRIPCAS CIRC P Circulate & condition at 265 gpm, 3000 psi, 90 rpm, Tq 30K, ECD 13.31, PU 360K, SO N/A, ROT 218K, max gas 71. 34,478.0 34,478.0 4/14/2023 12:00 4/14/2023 18:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 34,478'- 33,200' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2850 psi 120 rpm, Tq 37K ECD 13.24 PU ROT 206K ROT 197K Max gas 25 34,478.0 33,200.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 121/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/14/2023 18:00 4/14/2023 23:30 5.50 PROD1, TRIPCAS BKRM P Backream out of the hole from 33,200'- 32,070' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2830 psi 90-110 rpm, Tq 29K ECD 13.22 PU ROT 206K ROT 199K Max gas 25 33,200.0 32,070.0 4/14/2023 23:30 4/15/2023 00:00 0.50 PROD1, TRIPCAS SVRG P Service top drive & tighten shot pin bolts. Service ST-120. 32,070.0 32,070.0 4/15/2023 00:00 4/15/2023 06:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 32,070'- 30,577' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2790 psi 90-110 rpm, Tq 27K ECD 13.04 PU ROT 205K ROT 199K Max gas 27 32,070.0 30,577.0 4/15/2023 06:00 4/15/2023 12:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 30,577'- 29,670' MD, holding an 12.6 ppg EMW at the shoe. Observe pressure increases with 50-150 psi at 30,429'; 30,387'; 30,165' MD. 265 gpm, 2750 psi 90-120 rpm, Tq 22-27K ECD 12.98 PU ROT 205K ROT 199K Max gas 24 30,577.0 29,670.0 4/15/2023 12:00 4/15/2023 18:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 29,670'- 28,260' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2490 psi 90 rpm, Tq 20-24K ECD 12.87 PU ROT 203K ROT 198K Max gas 25 29,670.0 28,260.0 4/15/2023 18:00 4/16/2023 00:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 28,260'- 26,775' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2570 psi 90 rpm, Tq 24K ECD 12.87 PU ROT 201K ROT 197K Max gas 25 28,260.0 26,775.0 4/16/2023 00:00 4/16/2023 06:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 26,775'- 25,008' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2510 psi 90 rpm, Tq 21K ECD 12.67 PU ROT 202K ROT 195K Max gas 19 26,775.0 25,008.0 4/16/2023 06:00 4/16/2023 12:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 25,008'- 23,508' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2516 psi 90 rpm, Tq 15-18K ECD 12.61 PU ROT 195K ROT 185K Max gas 16 25,008.0 23,508.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 122/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/16/2023 12:00 4/16/2023 18:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 23,508'- 22,042' MD, holding an 12.6 ppg EMW at the shoe. 265 gpm, 2516 psi 90 rpm, Tq 13-16K ECD 12.27 PU ROT 188K ROT 182K Max gas 16 23,508.0 22,042.0 4/16/2023 18:00 4/17/2023 00:00 6.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 22,042'- 20,968' MD, holding an 12.6 ppg EMW at the shoe. Work through & clean up 21,108'-20,968' MD with increased torque & pressure. 265 gpm, 2360 psi 90-110 rpm, Tq 18K ECD 12.58 PU ROT 180K ROT 173K Max gas 10 22,042.0 20,968.0 4/17/2023 00:00 4/17/2023 05:00 5.00 PROD1, TRIPCAS BKRM P Backream out of the hole from 20,968'- 20,379' MD, holding an 12.6 ppg EMW at the shoe. Work through & clean up 20,968'-20,926' MD with increased torque. 265 gpm, 2360 psi 90 rpm, Tq 16K ECD 12.55 PU ROT 174K ROT 169K Max gas 10 20,968.0 20,379.0 4/17/2023 05:00 4/17/2023 10:45 5.75 PROD1, TRIPCAS CIRC P Circulate bottoms up at 20,379' MD, holding an 12.6 ppg EMW at the shoe. SIMOPS repair ST-120. 265 gpm, 2345 psi 30 rpm, Tq 7-8K ECD 12.54 PU 224K SO 120K ROT 165K Max gas 0 20,379.0 20,379.0 4/17/2023 10:45 4/17/2023 14:00 3.25 PROD1, TRIPCAS SLPC P Cut and slip 47' of drilling line. SIMOPS repair ST-120, change out bolts on top drive shot pin, inspect drawworks & brakes. 20,379.0 20,379.0 4/17/2023 14:00 4/17/2023 14:45 0.75 PROD1, TRIPCAS SVRG P Change out swivel packing on the top drive. SIMOPS repair ST-120 20,379.0 20,379.0 4/17/2023 14:45 4/17/2023 16:30 1.75 PROD1, TRIPCAS SLPC P Remove block hanging line and calibrate drawworks. Perform block height & weight calibration. Blow down top drive, service blocks & top drive. Inspect saver sub. SIMOPS repair ST- 120 20,379.0 20,379.0 4/17/2023 16:30 4/17/2023 21:00 4.50 PROD1, TRIPCAS SVRG P Change out saver sub & grabber dies. Grease upper & lower IBOPs. SIMOPS repair ST-120 & perform weekly derrick inspection. 20,379.0 20,379.0 4/17/2023 21:00 4/18/2023 00:00 3.00 PROD1, TRIPCAS MPDA P Change out RCD per Advisor. Maintain 12.6 ppg EMW at the shoe with 556 psi while change out bearing. Line up to mud pump 3 and fluid pack MPD lines. Establish circulation across the top with MPD to hold 12.6 ppg EMW dynamically. 20,379.0 20,379.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 123/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/18/2023 00:00 4/18/2023 01:00 1.00 PROD1, TRIPCAS SEQP P Pressure test top drive swivel packing to 3500 psi, good. Blow down top drive. SIMOPS prep pits for trip in the hole, change out a liner &2 swabs on mud pump #4. Obtain torque & drag per town. PU 224K SO113K ROT 165K 30 rpm = Tq 9K 20 spm 20,379.0 20,379.0 4/18/2023 01:00 4/18/2023 06:00 5.00 PROD1, TRIPCAS SMPD P Strip in the hole from 20,379'-22,416' MD, holding an 12.6 ppg EMW at the shoe. Set down 20K 3 times at 22,416' MD. SIMOPS change out liner, 2 swabs & wiper seals on mud pump #4. PU 224K SO 113K ROT 165K 30 rpm = Tq 9K 20,379.0 22,416.0 4/18/2023 06:00 4/18/2023 07:45 1.75 PROD1, TRIPCAS REAM P Wash & ream in the hole from 22,416'- 22,688' MD, holding an 12.6 ppg EMW at the shoe. 148 gpm 1220 psi 10 rpm = Tq 9K SO ROT 165K ROT 190K 22,416.0 22,688.0 4/18/2023 07:45 4/18/2023 08:15 0.50 PROD1, TRIPCAS SMPD P Strip in the hole from 22,688'-22,786' MD, holding an 12.6 ppg EMW at the shoe. Obtain torque & drag at 22,689' MD PU 260K SO 108-120K ROT 185K 30 rpm = Tq 10-11K 22,688.0 22,786.0 4/18/2023 08:15 4/18/2023 08:30 0.25 PROD1, TRIPCAS RURD P Install PS-21 slips in the rotary table. 22,786.0 22,786.0 4/18/2023 08:30 4/18/2023 10:45 2.25 PROD1, TRIPCAS SMPD P Strip in the hole from 22,786'-23,980' MD, holding an 12.6 ppg EMW at the shoe. SO 110-120K 22,786.0 23,980.0 4/18/2023 10:45 4/18/2023 11:15 0.50 PROD1, TRIPCAS SRVY P Pump up survey to ensure BHA is in the main wellbore. 225 gpm 1755 psi 23,980.0 23,980.0 4/18/2023 11:15 4/18/2023 12:15 1.00 PROD1, TRIPCAS SMPD P Strip in the hole from 23,980'-24,295' MD, holding an 12.6 ppg EMW at the shoe. SO 110-120K 23,980.0 24,295.0 4/18/2023 12:15 4/18/2023 12:30 0.25 PROD1, TRIPCAS REAM P Wash & ream in the hole due to loss of weight from 24,295'-24,361' MD, holding an 12.6 ppg EMW at the shoe. 150 gpm 1310 psi 20 rpm = Tq 11-12K SO ROT 185K 24,295.0 24,361.0 4/18/2023 12:30 4/18/2023 13:00 0.50 PROD1, TRIPCAS SMPD P Strip in the hole from 24,361'-24,435' MD, holding an 12.6 ppg EMW at the shoe. SO 110-120K 24,361.0 24,435.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 124/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/18/2023 13:00 4/18/2023 22:15 9.25 PROD1, TRIPCAS REAM P Wash & ream in the hole due to loss of weight from 24,435'-26,222' MD, holding an 12.6 ppg EMW at the shoe. 250 gpm 2250 psi 60 rpm = Tq 17K SO ROT 190K ECD 12.68 Torque & drag at 24,542' MD 30 rpm = Tq 15K PU 295K SO ROT 168K ROT193K 24,435.0 26,222.0 4/18/2023 22:15 4/18/2023 22:45 0.50 PROD1, TRIPCAS SVRG P Service rig - grease the swivel packing & top drive; change out 3" bleeder valve on the mud manifold. 26,222.0 26,222.0 4/18/2023 22:45 4/19/2023 00:00 1.25 PROD1, TRIPCAS REAM P Wash & ream from 26,222'-26,501' MD, holding an 12.6 ppg EMW at the shoe. 250 gpm 2250 psi 60 rpm = Tq 17K SO ROT 190K ECD 12.68 26,222.0 26,501.0 4/19/2023 00:00 4/19/2023 06:00 6.00 PROD1, TRIPCAS REAM P Wash & ream from 26,501'-28,130' MD, holding an 12.6 ppg EMW at the shoe. 250 gpm 2450 psi 60 rpm = Tq 19K SO ROT 189K ROT 205K ECD 12.81 26,501.0 28,130.0 4/19/2023 06:00 4/19/2023 12:00 6.00 PROD1, TRIPCAS REAM P Wash & ream from 28,130'-29,561' MD, holding an 12.6 ppg EMW at the shoe. Observed 100 psi increase at 29,425' MD, slow running speed to 300 fph. 250 gpm 2430 psi 60 rpm = Tq 20-23K SO ROT 198K ROT 204K ECD 12.5 28,130.0 29,561.0 4/19/2023 12:00 4/19/2023 18:00 6.00 PROD1, TRIPCAS REAM P Wash & ream from 29,561'-30,582' MD, holding an 12.6 ppg EMW at the shoe. Slowed running speed as needed for DLS. 250 gpm 2520 psi 60 rpm = Tq 21-25K SO ROT 198K ROT 202K ECD 12.98 29,561.0 30,582.0 4/19/2023 18:00 4/20/2023 00:00 6.00 PROD1, TRIPCAS REAM P Wash & ream from 30,582'-32,446' MD, holding an 12.6 ppg EMW at the shoe. Slowed running speed as needed for DLS. 250 gpm 2602 psi 60 rpm = Tq 23K SO ROT 190K ROT 215K ECD 13.18 30,582.0 32,446.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 125/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/20/2023 00:00 4/20/2023 06:45 6.75 PROD1, TRIPCAS REAM P Wash & ream from 32,446'-34,480' MD, holding an 12.6 ppg EMW at the shoe. 250 gpm 2750 psi 60 rpm = Tq 27K SO ROT 192K ROT 215K ECD 13.40 32,446.0 34,480.0 4/20/2023 06:45 4/20/2023 15:00 8.25 PROD1, TRIPCAS CIRC P Circulate & reciprocate at 34,480' MD, holding an 12.6 ppg EMW at the shoe. Prep pits for displacement, cleaning pits 4 & 5, transferring fluids between tank farm & pits. 265 gpm 2650 psi 40-60 rpm = Tq 22-23K ECD 13.29 PU ROT 210K SO ROT 199K 34,480.0 34,480.0 4/20/2023 15:00 4/21/2023 00:00 9.00 PROD1, TRIPCAS DISP P Perform displacement from 11.1 ppg FloPro to 12.8 ppg Potassium Formate brine at 34,480' MD reciprocating. Adjust pump rate and MPD back pressure per rollover schedule. Observe spacer start to come back at 2897 bbls pumped. Pumped 2907bbls at 24:00 hrs. 250 - 100 gpm 2440 - 460 psi 80 rpm = Tq 33 - 46K MPD Back pressure 530 - 0 psi ECD PU ROT 219K SO ROT 216K ROT 212K 34,480.0 34,480.0 4/21/2023 00:00 4/21/2023 01:45 1.75 PROD1, TRIPCAS DISP P Continue displacement from 11.1 ppg FloPro to 12.8 ppg Potassium Formate brine at 34,480' MD reciprocating. Adjust pump rate and MPD back pressure per rollover schedule. Continued pumping from 2907bbls to 3315 bbls to see 12.6 ppg brine at surface. Observed 300 bbls of interface. Calculated was 200 bbls of interface. Recovered 116 bbls of the interface to be reconditioned and reused. 200 gpm 1350 psi 80 rpm = Tq 47K MPD Back pressure 0 psi PU ROT 219K SO ROT 215K ROT 216K 34,480.0 34,480.0 4/21/2023 01:45 4/21/2023 02:30 0.75 PROD1, TRIPCAS BKRM P Backream from 34,480'-34,390' MD, racking a stand back in the derrick. 225 gpm 1850 psi 60 rpm = Tq 43K PU ROT 220K ECD 13.31 34,480.0 34,390.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 126/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/21/2023 02:30 4/21/2023 10:30 8.00 PROD1, TRIPCAS CIRC P Circulate bottoms up at 34,390' MD. Obtain SCRs. 225 gpm 1875 psi 60 rpm = Tq 42K ECD 13.29 Obtain torque & drag at 34,380' MD 99 gpm = 425 psi 30 rpm = Tq 32K; BO @ 39K 20 fpm PU 460K; BO @ 468K SO N/A ROT 227K 34,390.0 34,390.0 4/21/2023 10:30 4/21/2023 11:30 1.00 PROD1, TRIPCAS CIRC P Circulate bottoms up at 34,390' MD. Obtain SCRs. 225 gpm 1875 psi 60 rpm = Tq 42K ECD 13.29 Obtain torque & drag at 34,385' MD 99 gpm = 425 psi 30 rpm = Tq 29K; Rotate down 25K 20 fpm PU 446K ROT SO 200K ROT 232K 34,390.0 34,390.0 4/21/2023 11:30 4/21/2023 12:45 1.25 PROD1, TRIPCAS OWFF P Monitor well. Observe slight flow to static. Observed well static 30 minutes. SIMOPS blow down top drive. 34,390.0 34,390.0 4/21/2023 12:45 4/21/2023 21:00 8.25 PROD1, TRIPCAS SMPD P Strip out of the hole with MPD to offset swab from 34,390' - 29,300' MD. PU 320K 750-1500 fph 34,390.0 29,300.0 4/21/2023 21:00 4/22/2023 00:00 3.00 PROD1, TRIPCAS SMPD P Strip out of the hole with MPD to offset swab from 29,300' - 27,523' MD. PU 269K 1000-1500 fph Obtain torque & drag at 29,004' MD No pump 30 rpm = Tq 20K; BO @ 21K; Rotate down 16K 20 fpm PU 320K ROT SO 187K ROT 216K 29,300.0 27,523.0 4/22/2023 00:00 4/22/2023 09:00 9.00 PROD1, TRIPCAS SMPD P Strip out of the hole from 27,523' - 20,189' MD. PU 241K 1500 fph Obtain torque & drag at 20,375' MD No pump 30 rpm = Tq 10K 20 fpm PU 236K SO 142K ROT 182K 27,523.0 20,189.0 4/22/2023 09:00 4/22/2023 09:30 0.50 PROD1, TRIPCAS OWFF P Monitor well, static. SIMOPS rotate wash pipe & prep for RCD removal. 20,189.0 20,189.0 4/22/2023 09:30 4/22/2023 10:15 0.75 PROD1, TRIPCAS MPDA P Remove 5-7/8" RCD bearing per SOP & Advisor. 20,189.0 20,189.0 4/22/2023 10:15 4/22/2023 12:30 2.25 PROD1, TRIPCAS TRIP P Trip out of the hole from 20,189' - 18,267' MD. PU 248K 20,189.0 18,267.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 127/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/22/2023 12:30 4/22/2023 14:00 1.50 PROD1, TRIPCAS CIRC P Open Well Commander per DD. Drop 1.75" steel ball & pump down at 1 bpm, 1175 psi. Ball on seat with 148 bbls pumped. Shift open with 1933 psi. One ball in catcher. Circulate at 250 gpm, 670 psi. SIMOPS prep for cut and slip. 18,267.0 18,267.0 4/22/2023 14:00 4/22/2023 15:30 1.50 PROD1, TRIPCAS SLPC P Cut and slip 443' of drilling line. Inspect brakes, deadman, & perform block calibration. Circulate at 190 gpm, 400 psi. 18,267.0 18,267.0 4/22/2023 15:30 4/22/2023 19:30 4.00 PROD1, TRIPCAS CIRC P Circulate at 7-5/8" liner top at 18,267' MD with Well Commander open. No cutting returns observed. 500 gpm 2150 psi FO 25% 80 rpm = Tq 16K ROT 170K 18,267.0 18,267.0 4/22/2023 19:30 4/22/2023 20:00 0.50 PROD1, TRIPCAS OWFF P Monitor well, static. SIMOPS blow down top drive & transfer brine to trip tank. 18,267.0 18,267.0 4/22/2023 20:00 4/23/2023 00:00 4.00 PROD1, TRIPCAS TRIP P Trip out of the hole from 18,267' - 14,812' MD. PU 210K Obtain torque & drag at 17,165' MD No pump 30 rpm = Tq 7K 20 fpm PU 211K ROT 168K SO ROT 158K 18,267.0 14,812.0 4/23/2023 00:00 4/23/2023 03:30 3.50 PROD1, TRIPCAS PULD P Trip out of the hole laying down 4-1/2" drill pipe from 14,812'-12,608' MD. PU 215K 69 joints laid down 14,812.0 12,608.0 4/23/2023 03:30 4/23/2023 06:00 2.50 PROD1, TRIPCAS CIRC P Circulate at 12,608' MD, reciprocating with Well Commander at the 9-7/8" liner top. Observed minimal fines with a 10%- 20% increase in cuttings. 850 gpm = 3615 psi 80 rpm = Tq 9K Flow out 40% ROT 159K Obtain torque & drag at 12,563' MD. PU 182K SO 138K ROT 159K 30 rpm = Tq 5K; BO 10K 12,608.0 12,608.0 4/23/2023 06:00 4/23/2023 07:00 1.00 PROD1, TRIPCAS CIRC P Close Well Commander per DD. Drop 1.75" steel ball. Pump down at 1 bpm, 300 psi. Pump 92.6 bbls to see ball on seat. Shift close with 1685 psi. Verify closed with 200 gpm, 980 psi. Well Commander has 2 balls in the catcher. Blow down top drive & prep to trip out of the hole. 12,608.0 12,608.0 4/23/2023 07:00 4/23/2023 14:00 7.00 PROD1, TRIPCAS TRIP P Trip out of the hole racking back 4-1/2" drill pipe from 12,608'-275' MD. (ST-120 position sensor broken and not operational. Decision made to rack back stands versus laying down singles.) 12,608.0 275.0 4/23/2023 14:00 4/23/2023 14:30 0.50 PROD1, TRIPCAS OWFF P Monitor well, static. SIMOPS clear & clean floor, prep to lay down BHA. 275.0 275.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 128/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/23/2023 14:30 4/23/2023 16:30 2.00 PROD1, TRIPCAS BHAH P Lay down BHA #9 to surface per SLB DD. Break off bit and hang off 58' of tools on XY crane to break apart with ST -100. Bit Grade: 2-3-CT-A-X-I-BT-TD 275.0 0.0 4/23/2023 16:30 4/23/2023 18:00 1.50 COMPZN, WHDBOP WWWH P Make up wear bushing running tool and remove wear bushing. Make up stack wash tool and flush stack, functioning BOPE as per SOP. 0.0 0.0 4/23/2023 18:00 4/23/2023 21:00 3.00 COMPZN, WHDBOP RURD P Flush & drain BOPE. Make up 5-7/8" test joint and space out pups. Make up dart & FOSV, both 4-1/2" & 5-7/8". SIMOPS MP2 on accumulator system, change sealing element on pit 1 dump gate, clean suction & discharge screens on mud pump #2. 0.0 0.0 4/23/2023 21:00 4/23/2023 23:00 2.00 COMPZN, WHDBOP BHAH P Lay down remaining 58' of BHA #9 with ST-100 & XY crane per SLB DD. 0.0 0.0 4/23/2023 23:00 4/23/2023 23:30 0.50 COMPZN, WHDBOP SVRG P Service rig & grease upper & lower IBOP on top drive. SIMOPS finishing changing out air pump on accumulator system. 0.0 0.0 4/23/2023 23:30 4/24/2023 00:00 0.50 COMPZN, WHDBOP RURD P Rig up test equipment for BOP test. 0.0 0.0 4/24/2023 00:00 4/24/2023 02:00 2.00 COMPZN, WHDBOP RURD P RIH and set test plug w/ 1 std 5-7/8" DP under the plug. RU test equip, fluid pack and shell test 0.0 0.0 4/24/2023 02:00 4/24/2023 10:00 8.00 COMPZN, WHDBOP BOPE P Perform BOPE Tests W/ 4 1/2" & 5 7/8" test joints, Annular 250 psi F/ 5 min, 2,500 psi F/ 10 min. Remaining Test 250 F/ 5 min, 4,000 F/ 10 min. Upper 4-1/2" X 7-5/8" VBRS, Lower 3-1/2" x 6-5/8" VBRS, CMV #1-#16 Manual & HCR Choke/Kill and Kill Valve #3, Upper and Lower IBOPS, 4-1/2" and 5-7/8" TIW and Dart Valves, blind/shears. Charted all tests. Conduct Koomey drawdown. 36-N2 @ 1000 psi avg, Acc = 3010 psi, Manifold = 1500 psi, Acc = 1700 psi after close, 14 sec for 200 psi build w/ 2 electric pumps, full system pressure in 89 sec w/ 2 electric and 6 air pumps. Closing times: Annular = 22 sec, UPR = 13 sec, Blind/Shears = 14 sec, LPR = 14 sec, Choke HCR = 2 sec, Kill HCR = 2 sec. Test PVT Gain /Loss and Flow out Alarms. Test LEL and H2S alarms. AOGCC rep Brian Bixby witnessed test. BLM rep Quin Sawyer waived witness 4/18/23 0830 Hrs. 0.0 0.0 4/24/2023 10:00 4/24/2023 10:45 0.75 COMPZN, WHDBOP RURD P Pull test plug, LD test joint. Blow down choke manifold, kill line and mud line. Drain BOP. Rack back 5-7/8" std DP 0.0 0.0 4/24/2023 10:45 4/24/2023 11:30 0.75 COMPZN, WHDBOP RURD P MU 2 jts of 5" DP w/ wear ring running tool and set wear ring as per SOP 0.0 0.0 4/24/2023 11:30 4/24/2023 12:00 0.50 COMPZN, WHDBOP RURD P Clean and clear floor, begin mobilizing equip for liner run 0.0 0.0 4/24/2023 12:00 4/24/2023 13:00 1.00 COMPZN, CASING RURD P Rig up casing equipment, PJSM for running lower completion 0.0 0.0 4/24/2023 13:00 4/24/2023 18:00 5.00 COMPZN, CASING PUTB P RIH t/ 6500' w/ 12.6 lb, 4-1/2" H563, P110S liner. MU to 5600 ft/lbs torque, install 6-1/8" Hydroform centralizers 1/Jt. Monitor displacement VIA trip tank. SOW = 115K 0.0 6,500.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 129/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/24/2023 18:00 4/25/2023 00:00 6.00 COMPZN, CASING PUTB P RIH F/6500' T/ 10,410' w/ 12.6 lb, 4-1/2" H563, P110S liner. 63 total ported jts and 1 IRSV. MU to 5600 ft/lbs torque, install 6-1/8" Hydroform centralizers 1/Jt. Monitor displacement VIA pit #5 once IRSV picked up to top fill as running and top off every 15 Jts. SOW = 115K, PUW = 136K 6,500.0 10,410.0 4/25/2023 00:00 4/25/2023 03:30 3.50 COMPZN, CASING PUTB P RIH F/10,410' T/ 14,176' w/ 12.6 lb, 4- 1/2" H563, P110S liner. 63 total ported jts and 1 IRSV. MU to 5600 ft/lbs torque, install 6-1/8" Hydroform centralizers 1/Jt. Monitor displacement VIA pit #5 once IRSV picked up to top fill as running and top off every 15 Jts. SOW = 115K, PUW = 136K 10,410.0 14,176.0 4/25/2023 03:30 4/25/2023 04:45 1.25 COMPZN, CASING PUTB P PJSM, MU 4.5" handling sub, XO and PU Drill Quip liner hanger as per Drill Quip Rep 14,176.0 14,176.0 4/25/2023 04:45 4/25/2023 05:00 0.25 COMPZN, CASING RUNL P MU std 4.5" DP, RIH F/14,176' T/14,315'. SOW = 119K 14,176.0 14,315.0 4/25/2023 05:00 4/25/2023 06:00 1.00 COMPZN, CASING RUNL P Test integrity of IRSV plug pressuring up to 500 psi for 5 min down tubing. OK. Obtain T&D at 14,292'. PUW = 155K, SOW = 120K, RTW = 129K, 30 RPM, 3K Tq. Blow down TD 14,315.0 14,315.0 4/25/2023 06:00 4/25/2023 10:00 4.00 COMPZN, CASING RUNL P RIH F/14,315' T/19,510' w/ 4.5" DP from derrick, Monitor displacement on pit #5, top fill every stand, Obtain T&D at 19,510'. PUW = 197K, SOW = 134K, RTW = 150K, 5K TQ 14,315.0 19,510.0 4/25/2023 10:00 4/25/2023 11:15 1.25 COMPZN, CASING RUNL P RIH F/19,510' T/19,979' w/ 4.5" HWDP F/ Shed, Monitor displacement on pit #5, top fill every joint, Obtain T&D at 19,979'. PUW = 203K, SOW = 138K, RTW = 154K, 5K TQ 19,510.0 19,979.0 4/25/2023 11:15 4/25/2023 12:00 0.75 COMPZN, CASING RUNL P Swap handling tools T/ 5-7/8", Install PS -21's, PJSM for drifting pipe out of derrick 19,979.0 19,979.0 4/25/2023 12:00 4/25/2023 18:00 6.00 COMPZN, CASING RUNL P RIH F/19,979' T/22,820' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". Monitor displacement on TT, top fill every stand, Obtain T&D at 20,440'. PUW = 210K, SOW = 144K, RTW = 164K, 5K TQ. Began taking wt in high DL, required rotation. Continue RIH rotating 20 RPM. 19,979.0 22,820.0 4/25/2023 18:00 4/25/2023 22:30 4.50 COMPZN, CASING RUNL P RIH F/22,820' T/24,157' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". Monitor displacement on TT, top fill every stand via pit #5. Continue RIH rotating 20 RPM, 10K Tq 22,820.0 24,157.0 4/25/2023 22:30 4/25/2023 23:30 1.00 COMPZN, CASING RGRP T Could not break out TD from stump, broke Lower IBOP to Saver sub attempting to break-out from stump. Remove torque rings on quill. 24,157.0 24,157.0 4/25/2023 23:30 4/26/2023 00:00 0.50 COMPZN, CASING SVRG P Service TD 24,157.0 24,157.0 4/26/2023 00:00 4/26/2023 03:30 3.50 COMPZN, CASING RGRP T CO lower IBOP and saver sub, Tq to 74K, max against tongs with TD, conduct torque test with TD against load cell to verify proper readings. Finish tie wire and torque rings to spec. Monitor well VIA TT. Approximately 1 BPH loss rate. 24,157.0 24,157.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 130/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/26/2023 03:30 4/26/2023 04:15 0.75 COMPZN, CASING RGRP T Pressure test lower IBOP 250 psi for 5 min, 4000 psi for 10 min, charted. Work pipe F/ 24,157' T/24,095' OK, 20 RPM, 8K Tq, monitor well VIA TT. Approximately 1 BPH loss rate. 24,157.0 24,157.0 4/26/2023 04:15 4/26/2023 05:30 1.25 COMPZN, CASING RGRP T Troubleshoot & test TD TQ readings against rig tongs and ST-120. Appear consistant. 24,157.0 24,157.0 4/26/2023 05:30 4/26/2023 08:00 2.50 COMPZN, CASING RGRP T Work pipe F/24,157' T/24,095' OK, 20 RPM, 8K Tq. Remove Upper/Lower lock rings, torque through IBOP/Saver sub to 85K per SOP 3X. MU lock rings and torque to spec. 24,157.0 24,157.0 4/26/2023 08:00 4/26/2023 08:30 0.50 COMPZN, CASING RUNL P RIH F/24,157' T/24,252' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 20 RPM, 11K Tq, 151K RTW 24,157.0 24,252.0 4/26/2023 08:30 4/26/2023 10:15 1.75 COMPZN, CASING RGRP T Unable to break out of stump. connection between lower IBOP and saver sub broke. attempt to break saver sub out of stump with ST-120. No go. Appears BU tongs slipped causing overtorquing not TD calibration 24,252.0 24,252.0 4/26/2023 10:15 4/26/2023 10:45 0.50 COMPZN, CASING RGRP T POOH F/24,252' T/24,220'. PUW = 236K. LD top single of std #107 with saver sub and lower IBOP attached 24,252.0 24,220.0 4/26/2023 10:45 4/26/2023 11:30 0.75 COMPZN, CASING RGRP T Mobilize new saver sub and lower IBOP, Install as per SOP, Tq to 85K 3Xs 24,220.0 24,220.0 4/26/2023 11:30 4/26/2023 12:00 0.50 COMPZN, CASING RGRP T Pressure test lower IBOP 250 psi 5 min, 4000 psi 10 min, charted 24,220.0 24,220.0 4/26/2023 12:00 4/26/2023 12:30 0.50 COMPZN, CASING RGRP T RD test equip, install lock rings on lower IBOP and saver sub per SOP. 24,220.0 24,220.0 4/26/2023 12:30 4/26/2023 13:00 0.50 COMPZN, CASING SVRG P Service/Inspect TD 24,220.0 24,220.0 4/26/2023 13:00 4/26/2023 18:00 5.00 COMPZN, CASING RUNL P RIH F/24,220' T/26,050' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 20 RPM, 8-13K Tq, 156K RTW. Monitor disp VIA TT, fill every std VIA pit #5 24,220.0 26,050.0 4/26/2023 18:00 4/27/2023 00:00 6.00 COMPZN, CASING RUNL P RIH F/26,050' T/27,696' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 25 RPM, 11-16K Tq, 160K RTW. Monitor disp VIA TT, fill every std VIA pit #5 26,050.0 27,696.0 4/27/2023 00:00 4/27/2023 06:00 6.00 COMPZN, CASING RUNL P RIH F/27,696' T/29,215' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 25 RPM, 22K Tq, 161K RTW. Monitor disp VIA TT, fill every std VIA pit #5 27,696.0 29,215.0 4/27/2023 06:00 4/27/2023 12:00 6.00 COMPZN, CASING RUNL P RIH F/29,215' T/31,030' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 20 RPM, 18K Tq, 165K RTW. Monitor disp VIA TT, fill every std VIA pit #5 29,215.0 31,030.0 4/27/2023 12:00 4/27/2023 18:00 6.00 COMPZN, CASING RUNL P RIH F/31,030' T/32,375' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 30 RPM, 24K Tq, 165K RTW. Monitor disp VIA TT, fill every std VIA pit #5. SIMOPS: LD 4.5" DP from derrick with tugger 31,030.0 32,375.0 4/27/2023 18:00 4/28/2023 00:00 6.00 COMPZN, CASING RUNL P RIH F/32,375' T/33,284' w/ 5-7/8" DP F/ derrick, drifting each stand to 3.5". 30 RPM, 24-27K Tq, 171K RTW. Monitor disp VIA TT, fill every std VIA pit #5. SIMOPS: LD 4.5" DP from derrick with tugger 32,375.0 33,284.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 131/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/28/2023 00:00 4/28/2023 06:00 6.00 COMPZN, CASING RUNL P RIH F/33,284' T/34,350' set depth w/ 5- 7/8" DP F/ derrick, drifting each stand to 3.5". 30 RPM, 28K Tq, 176K RTW. Monitor disp VIA TT, fill every std VIA pit #5. SIMOPS: LD 4.5" DP from derrick with tugger 33,284.0 34,350.0 4/28/2023 06:00 4/28/2023 06:15 0.25 COMPZN, CASING RUNL P Ream to 34,354', 30RPM, 18K Tq, 210K RTW. PU to obtain benchmark values prior to setting liner. PU to 333K, observed loss of string wt to 260K and free travel at 281K. Rotate 30 rpm, 16K Tq, 211K RTW. Rotate down to 34,354', took 17K wt and Tq increased to 21K. Stop rotation, PU to 280K, 9' of strectch from 220K to 280K. 34,350.0 34,354.0 4/28/2023 06:15 4/28/2023 11:00 4.75 COMPZN, CASING DHEQ P Attempt to pump down string to set liner hanger, not holding pressure, increase to 5500 psi with 33 stks, pop-off opened. Line up #1 MP, Pressure up again to 5500 psi with 16 more stks. Still bleeding off. Troubleshoot surface equip. May have had a partial blockage on surface. Attempt pressure up again, 1 bpm, observed returns, 70 psi, pumped 8 bbls with circulation. 34,354.0 34,354.0 4/28/2023 11:00 4/28/2023 12:00 1.00 COMPZN, CASING TRIP P POOH F/34,354' to 34,268'. PUW = 294K, Blow down TD. Monitor hole VIA TT 34,354.0 34,268.0 4/28/2023 12:00 4/28/2023 13:00 1.00 COMPZN, CASING DHEQ P RU to pressure up wellbore to determine if liner set. Pressured up to 118 psi and leaks off. RD test equipment. Monitor hole VIA TT. Discuss with town. SIMOPS: LD 4.5" DP from Drk w/ tugger 34,268.0 34,268.0 4/28/2023 13:00 4/28/2023 18:00 5.00 COMPZN, CASING CIRC P PU, CBU @ 34,250'. 350 GPM, 820 PSI, 14800 stks 34,268.0 34,268.0 4/28/2023 18:00 4/28/2023 18:15 0.25 COMPZN, CASING OWFF P Flow check, well U-tubing. MU TD, est circ 34,268.0 34,268.0 4/28/2023 18:15 4/28/2023 19:00 0.75 COMPZN, CASING CIRC P Circulate to balance, 346 GPM, 814 PSI. Pumped 3200 stks. 12.7+ MW in and out 34,268.0 34,268.0 4/28/2023 19:00 4/28/2023 20:00 1.00 COMPZN, CASING OWFF P Flow check. Blow down top drive. Observed slight Utubing. Observe till stop and static 15 min no flow. 34,268.0 34,268.0 4/28/2023 20:00 4/29/2023 00:00 4.00 COMPZN, CASING TRIP T POOH F/20,090' T/18,108' w/ 5-78" DP, rack back in Drk. PUW = 280K, monitor hole fill via TT. 20,090.0 18,108.0 4/29/2023 00:00 4/29/2023 06:00 6.00 COMPZN, CASING TRIP T POOH F/18,108' T/14,480' w/ 5-78" DP, rack back in Drk. PUW = 235K, monitor hole fill via TT. 18,108.0 12,480.0 4/29/2023 06:00 4/29/2023 12:00 6.00 COMPZN, CASING TRIP T POOH F/12,480' T/0', 5-7/8" and 4.5" DP, rack back in Drk. monitor hole fill via TT. 12,480.0 0.0 4/29/2023 12:00 4/29/2023 13:00 1.00 COMPZN, CASING BHAH T LD Drill Quip running tool. Running tools was complete except for one missing dog sub spline. Tool had not seen setting pressure. Clear and clean floor 0.0 0.0 4/29/2023 13:00 4/29/2023 18:00 5.00 COMPZN, CASING WAIT T Service rig, ST-120, rebuild Koomey pump #1, clean screens on MP # 1 &2 , housekeeping and MP2's. Mobilize casing equip to RF, welder build mule shoe, prep floor for packer run while discuss with town plan forward 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 132/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/29/2023 18:00 4/29/2023 19:00 1.00 COMPZN, CASING RURD T Plan is to run Mule shoe Jt, IRSV, blank Jt liner and DrillQuip liner hanger/packer assy. Dress mule shoe, check equipment ok, prep for run 0.0 0.0 4/29/2023 19:00 4/29/2023 21:00 2.00 COMPZN, CASING PUTB T MU liner stacked packer assy to 249' 0.0 249.0 4/29/2023 21:00 4/29/2023 21:30 0.50 COMPZN, CASING DHEQ T Fill string to IRSV with brine, test to 500 psi ok 249.0 249.0 4/29/2023 21:30 4/30/2023 00:00 2.50 COMPZN, CASING RUNL T RIH F/249' T/2,762' with stacker packer on 4.5" DP from derrick. Monitor displacement on TT, fill pipe every std, top off every 10 stds 249.0 2,762.0 4/30/2023 00:00 4/30/2023 06:00 6.00 COMPZN, CASING RUNL T RIH F/2,762' T/8,600' with stacker packer on 4.5"/5-7/8" DP from derrick. Monitor displacement on TT, fill pipe every std, top off every 10 stds 2,762.0 8,600.0 4/30/2023 06:00 4/30/2023 13:00 7.00 COMPZN, CASING RUNL T RIH F/8,600' T/20,106' with stacker packer on 5-7/8" DP from derrick. Monitor displacement on TT, fill pipe every std, top off every 10 stds 8,600.0 20,106.0 4/30/2023 13:00 4/30/2023 14:30 1.50 COMPZN, CASING RUNL T Fill pipe, obtain T&D. PUW=270K, SOW=148K, Rot Wt=270K, TQ=13K RIH F/20,106' T/20,174'. Tag no go, set down 10K to verify 20,106.0 20,174.0 4/30/2023 14:30 4/30/2023 15:30 1.00 COMPZN, CASING RUNL T Set Hgr/Pkr per DrilQuip rep. Pressure up to 500 psi, 77 stks, hold 5 min, pressure up to 3631 psi, shear ring, hold 2 min, pressure up to 5000 psi, hold for 10 min, 123 stks total. Bleed down to 500 psi, PU t/ 275K, bleed to 0 psi, PU to 330K, 60K over pull indicating Hgr set. SO to 120K. 20,174.0 20,174.0 4/30/2023 15:30 4/30/2023 16:00 0.50 COMPZN, CASING DHEQ T Test annulus to 2500 psi for 15 min charted. 86 stks total. 11 bbls bled back. 20,174.0 20,174.0 4/30/2023 16:00 4/30/2023 16:30 0.50 COMPZN, CASING TRIP P PU, released from liner, F/ 20,058' T/19,957' 20,068.0 19,937.0 4/30/2023 16:30 4/30/2023 17:00 0.50 COMPZN, CASING MPDA P Install MPD element/bearing per SOP 19,937.0 19,937.0 4/30/2023 17:00 4/30/2023 18:00 1.00 COMPZN, CASING DISP P Circulate 600 GPM, 2582 PSI, Reducing MW to 10.8 ppg w/ H2O, holding 12.6 ppg EMW w/ MPD. SIMOPS: LD 4.5" DP from Drk. 19,937.0 19,937.0 4/30/2023 18:00 4/30/2023 20:45 2.75 COMPZN, CASING DISP P Circulate 600 GPM, 1986 PSI, Reducing MW to 10.8 ppg with H2O, holding 12.6 ppg EMW w/ MPD. SIMOPS: LD 4.5" DP from Drk. 19,937.0 19,937.0 4/30/2023 20:45 4/30/2023 21:30 0.75 COMPZN, CASING OWFF P Shut down pumps, trap 600 psi, bleed to 12.0 ppg EMW monitor, bleed off stepping down in .25 ppg stages to 0 PSI ok. Shut in choke no pressure build, open to TT and monitor. Total fluid bled off = 5.2 bbls 19,937.0 19,937.0 4/30/2023 21:30 4/30/2023 22:15 0.75 COMPZN, CASING OWFF P Line up to flow check in cellar. Observe well static 30 min. 19,937.0 19,937.0 4/30/2023 22:15 4/30/2023 22:30 0.25 COMPZN, CASING TRIP P POOH F/19937 T/19,906'. Rack back std #214. Observe well U-tubing. 19,937.0 19,906.0 4/30/2023 22:30 4/30/2023 23:30 1.00 COMPZN, CASING RURD P MU TD, circ w/ prep for slip and cut drill line. 200 gpm, 258 psi 19,906.0 19,906.0 4/30/2023 23:30 5/1/2023 00:00 0.50 COMPZN, CASING SLPC P PJSM, Remove drawworks covers, Slip and Cut drill line per SOP. SIMOPS: Circ slowly to balance MW. 200 gpm, 257 psi 19,906.0 19,906.0 5/1/2023 00:00 5/1/2023 02:45 2.75 COMPZN, CASING SLPC P Hang blocks, cut 75' drill line, un-hang blocks, full block calibration 19,906.0 19,906.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 133/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/1/2023 02:45 5/1/2023 03:00 0.25 COMPZN, CASING RURD P Blow down TD, clear floor 19,906.0 19,906.0 5/1/2023 03:00 5/1/2023 04:00 1.00 COMPZN, CASING MPDA P PJSM, pull 5-7/8" RCD bearing/element per SOP, pressure wash bearing 19,906.0 19,906.0 5/1/2023 04:00 5/1/2023 04:30 0.50 COMPZN, CASING RURD P Prep floor to LD DP 19,906.0 19,906.0 5/1/2023 04:30 5/1/2023 07:30 3.00 COMPZN, CASING PULD P POOH F/19,906' T/17,724'. Laying down 5-7/8" DP to shed, PUW=279K. Monitor hole fill on TT. 19,906.0 17,724.0 5/1/2023 07:30 5/1/2023 07:45 0.25 COMPZN, CASING CIRC P Pump 30 bbl 12.6 ppg slug, chase with 10 bbl 10.8 ppg, blow down TD 17,724.0 17,724.0 5/1/2023 07:45 5/1/2023 12:00 4.25 COMPZN, CASING PULD P POOH F/17,724' T/13,169'. Laying down 5-7/8" DP to shed, PUW=255K. Monitor hole fill on TT. 17,724.0 13,169.0 5/1/2023 12:00 5/1/2023 17:45 5.75 COMPZN, CASING PULD P POOH F/13,169' T/5,800'. Laying down 5-7/8" DP to shed, PUW=125K. Monitor hole fill on TT. 13,169.0 5,800.0 5/1/2023 17:45 5/1/2023 18:15 0.50 COMPZN, CASING RURD P Swap handling tools to 4.5" 5,800.0 5,800.0 5/1/2023 18:15 5/1/2023 23:15 5.00 COMPZN, CASING PULD P POOH F/5,800' T/80'. Laying down 4- 1/2" DP to shed. Monitor hole fill on TT. 5,800.0 80.0 5/1/2023 23:15 5/2/2023 00:00 0.75 COMPZN, CASING PULD P PJSM for laying down running tool. LD last Jt DP 80.0 50.0 5/2/2023 00:00 5/2/2023 02:00 2.00 COMPZN, CASING BHAH P LD DrilQuip Stacker Packer running tool. Clear and clean floor 50.0 0.0 5/2/2023 02:00 5/2/2023 03:30 1.50 COMPZN, RPCOMP RURD P Mobilize Cameron wellhead equipment to floor. Pull wear ring. SIMOPS: Crane pick liner hanger skate off rig 0.0 0.0 5/2/2023 03:30 5/2/2023 05:00 1.50 COMPZN, RPCOMP WWWH P MU Cameron jetting tool, 2 Jts 5" DP. Jet hanger profile as per Cameron Rep. 700 gpm, 70 psi, 1 rpm. 2200 stks total. Install spring loaded VR plug and test 5K 15 min. 0.0 0.0 5/2/2023 05:00 5/2/2023 06:00 1.00 COMPZN, RPCOMP RURD P LD Cameron jet tool. B/D top drive, MU Cameron 9-7/8" dummy hanger as per Cameron rep 0.0 0.0 5/2/2023 06:00 5/2/2023 07:00 1.00 COMPZN, RPCOMP RURD P Set dummy hanger as per Cameron Rep, to 5K, test VR plug to 5K. LD 2 Jts 5" DP and hanger running tool 0.0 0.0 5/2/2023 07:00 5/2/2023 11:00 4.00 COMPZN, RPCOMP RURD P PJSM, mobilize Silverwell tools, spooling unit, clamps and casing equipment to rig floor. Hang sheave in derrick w/ secondary restraint 0.0 0.0 5/2/2023 11:00 5/2/2023 12:00 1.00 COMPZN, RPCOMP PUTB P PJSM, MU Baker locator assy w/ self orienting shoe and 1 Jt tbg 0.0 69.0 5/2/2023 12:00 5/2/2023 14:15 2.25 COMPZN, RPCOMP PUTB P RIH F/69' T/2,171' w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. Torque Turn to 3,800 ft/lbs. Monitor displacement on TT. 69.0 2,171.0 5/2/2023 14:15 5/2/2023 17:00 2.75 COMPZN, RPCOMP PUTB P MU Silverwell lower Dial GLM w/ DHG. MU top cable head connection. PT to 6K for 15 min 2,171.0 2,171.0 5/2/2023 17:00 5/2/2023 18:00 1.00 COMPZN, RPCOMP PUTB P RIH F/2,171' T/ 2500' w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. Torque Turn to 3,800 ft/lbs. Install 4.5" x 7.24" PolyOil clamps 1/Jt over Tec wire. Monitor displacement on TT. 2,171.0 2,500.0 5/2/2023 18:00 5/2/2023 22:15 4.25 COMPZN, RPCOMP PUTB P RIH F/2500' T/4,605'w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. Torque Turn to 3,800 ft/lbs. Install 4.5" x 7.24" PolyOil clamps 1/Jt over Tec wire. Monitor displacement on TT. 2,500.0 4,605.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 134/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/2/2023 22:15 5/2/2023 22:45 0.50 COMPZN, RPCOMP DHEQ P Test Silverwell GLM Dial. Valves 2-5 functioned. 1 and 6 would not open 4,605.0 4,605.0 5/2/2023 22:45 5/2/2023 23:30 0.75 COMPZN, RPCOMP PUTB T POOH F/4,605' T/4,166'. To reduce HPSI across valves. PUW = 114K. Monitor hole fill on TT 4,605.0 4,166.0 5/2/2023 23:30 5/2/2023 23:45 0.25 COMPZN, RPCOMP DHEQ T Test Silverwell GLM Dial. Valves 1-5 functioned. 6 would not open 4,166.0 4,166.0 5/2/2023 23:45 5/3/2023 00:00 0.25 COMPZN, RPCOMP PUTB T POOH F/4,166' T/4,110'. To reduce HPSI across valves. PUW = 114K. Monitor hole fill on TT 4,166.0 4,110.0 5/3/2023 00:00 5/3/2023 00:45 0.75 COMPZN, RPCOMP PUTB T POOH F/4,166' T/4,110'. To reduce HPSI across valves. PUW = 114K. Monitor hole fill on TT 4,110.0 3,841.0 5/3/2023 00:45 5/3/2023 01:00 0.25 COMPZN, RPCOMP DHEQ T Test Silverwell lower Dial GLM w/ 990 psi hydrostatic. All funtioned properly. All tests good. 3,841.0 3,841.0 5/3/2023 01:00 5/3/2023 02:00 1.00 COMPZN, RPCOMP PUTB T RIH F/3,841' T/4,605'w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. Torque Turn to 3,800 ft/lbs. Install 4.5" x 7.24" PolyOil clamps 1/Jt over Tec wire. Monitor displacement on TT. 3,841.0 4,605.0 5/3/2023 02:00 5/3/2023 11:00 9.00 COMPZN, RPCOMP PUTB P RIH F/4,605' T/9,556'w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. Torque Turn to 3,800 ft/lbs. Install 4.5" x 7.24" PolyOil clamps 1/Jt over Tec wire through Jt #187, 140 total. Begin install 4.5" x 11.75" on Jt #188. 1/Jt. Monitor displacement on TT. 4,605.0 9,556.0 5/3/2023 11:00 5/3/2023 12:00 1.00 COMPZN, RPCOMP FISH T While running Jt #228, one of the Cavins air slip dies came free from body and fell in hole with retaining pin. Shut down, notify Co Rep. Drain stack, remove bushings, look for die and pin. Unable to locate slip die. Pin visible. 9,556.0 9,556.0 5/3/2023 12:00 5/3/2023 18:00 6.00 COMPZN, RPCOMP FISH T Discuss with town. Prep T-bar w/ magnet. Hoist string to place centralizer at top of wellhead. SIMOPS: Clean/clear floor, replace wood bearing on auger in pits, 9,556.0 9,556.0 5/3/2023 18:00 5/3/2023 22:15 4.25 COMPZN, RPCOMP FISH T Retrieve keeper pin using T-bar w/ magnet. Lost magnet, Retrieve magnet with T-bar. 9,556.0 9,556.0 5/3/2023 22:15 5/3/2023 22:45 0.50 COMPZN, RPCOMP FISH T LD T-bar, Clear floor of excess retrieval equipment, inspect all tubing equipment.. Fill stack with 22 bbls. Prep to run tubing 9,556.0 9,556.0 5/3/2023 22:45 5/4/2023 00:00 1.25 COMPZN, RPCOMP PUTB P RIH F/9,556' T/10,086 'w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. Torque Turn to 3,800 ft/lbs. Install 4.5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 9,556.0 10,086.0 5/4/2023 00:00 5/4/2023 01:00 1.00 COMPZN, RPCOMP PUTB P RIH F/10,086' T/10,672' w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. SOW=123K, Torque Turn to 3,800 ft/lbs. Install 4.5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 10,086.0 10,672.0 5/4/2023 01:00 5/4/2023 02:15 1.25 COMPZN, RPCOMP DHEQ P Function test Silverwell lower GLM dial. Oriface #6 not opening fully, all other ok. Decision made to RIH. 10,672.0 10,672.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 135/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/4/2023 02:15 5/4/2023 09:30 7.25 COMPZN, RPCOMP PUTB P RIH F/10,672' T/14,469' w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. SOW=124K, Torque Turn to 3,800 ft/lbs. Install 4.5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 10,672.0 14,469.0 5/4/2023 09:30 5/4/2023 10:00 0.50 COMPZN, RPCOMP PUTB P MU upper Silverwell GLM dial assy. 14,469.0 14,469.0 5/4/2023 10:00 5/4/2023 18:00 8.00 COMPZN, RPCOMP PUTB P Silverwell crew MU lower cable head assy to Tec wire, PT to 6K 15min, charted. MU upper cable head assy to Tec wire, feed through Dial and MU top connection port. PT to 6K 15 min, charted. 14,469.0 14,469.0 5/4/2023 18:00 5/4/2023 19:15 1.25 COMPZN, RPCOMP PUTB P RIH F/14,469' T/15,019' w/ 4.5" 12.6# L80 H563 Tubing upper completion per detail. SOW=124K, Torque Turn to 3,800 ft/lbs. Install 4.5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 14,469.0 15,019.0 5/4/2023 19:15 5/4/2023 20:00 0.75 COMPZN, RPCOMP RURD P Swap handling tools to 5", MU 4.5 x 5" XO. 15,019.0 15,019.0 5/4/2023 20:00 5/5/2023 00:00 4.00 COMPZN, RPCOMP PUTB P RIH F/15,019' T/16,335' w/ 5" 24.1# L80 H563 Tubing upper completion per detail. PUW=170K, SOW=137K, Torque Turn to 18,000 ft/lbs. Install 5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 15,019.0 16,335.0 5/5/2023 00:00 5/5/2023 01:15 1.25 COMPZN, RPCOMP PUTB P RIH F/16,335' T/16,625' w/ 5" 24.1# L80 H563 Tubing upper completion per detail. PUW=175K, SOW=139K, Torque Turn to 18,000 ft/lbs. Install 5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 16,335.0 16,625.0 5/5/2023 01:15 5/5/2023 02:45 1.50 COMPZN, RPCOMP CIRC P Observed excess fluid coming over top of tubing, stabbed safety valve, flow check confirmed U-tubing/wel dead. MU TD and pump 30 bbl, 12.7 dry job. 100 gpm, 132 psi. Blow down TD 16,625.0 16,625.0 5/5/2023 02:45 5/5/2023 06:00 3.25 COMPZN, RPCOMP PUTB P RIH F/16,625' T/17,941' w/ 5" 24.1# L80 H563 Tubing upper completion per detail. PUW=175K, SOW=142K, Torque Turn to 18,000 ft/lbs. Install 5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 16,625.0 17,941.0 5/5/2023 06:00 5/5/2023 10:00 4.00 COMPZN, RPCOMP PUTB P RIH F/17,941' T/20,029' w/ 5" 24.1# L80 H563 Tubing upper completion per detail. PUW=209K, SOW=164K, Torque Turn to 18,000 ft/lbs. Install 5" x 11.75" PolyOil clamps over Tec wire. 1/Jt. Monitor displacement on TT. 17,941.0 17,941.0 5/5/2023 10:00 5/5/2023 12:00 2.00 COMPZN, RPCOMP RURD P RU 8' bail extensions, RU H563 X 5-7/8" FOSV and head pin. MU cement hose to head pin 17,941.0 17,941.0 5/5/2023 12:00 5/5/2023 12:30 0.50 COMPZN, RPCOMP CIRC P Wash down at 1bpm. SOW=164K, PUW=209K. Set down 10K to verify, 160 psi increase in pump pressure, tagged 9' in on Jt #481 17,941.0 20,042.0 5/5/2023 12:30 5/5/2023 13:00 0.50 COMPZN, RPCOMP RURD P RD cement hose, head pin and floor valve 20,042.0 20,042.0 5/5/2023 13:00 5/5/2023 14:00 1.00 COMPZN, RPCOMP THGR P LD Jts 481, 480, 479 and 478. PUW = 209K 20,042.0 19,908.0 5/5/2023 14:00 5/5/2023 15:00 1.00 COMPZN, RPCOMP THGR P MU Pups 3.93', 7.93', 9.83', 14.57' and Jt #478 19,908.0 19,980.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 136/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/5/2023 15:00 5/5/2023 15:30 0.50 COMPZN, RPCOMP THGR P MU Cameron hanger and landing Jt 19,980.0 19,980.0 5/5/2023 15:30 5/5/2023 16:30 1.00 COMPZN, RPCOMP THGR P Clean and clear floor, lower Tec line sheave, Silverwell prep Tec wire, strip 70' of Tec wire, feed through and terminate through hanger 19,980.0 19,980.0 5/5/2023 16:30 5/5/2023 17:00 0.50 COMPZN, RPCOMP THGR P Test control line fittings through hanger, 5000 psi good. 19,980.0 19,980.0 5/5/2023 17:00 5/5/2023 18:00 1.00 COMPZN, RPCOMP THGR P RIH with hanger on landing Jt. Took wt on MPD clamp 19,980.0 20,005.0 5/5/2023 18:00 5/5/2023 21:00 3.00 COMPZN, RPCOMP THGR P POOH, observed scar on hanger, damaged seals. LD Hanger and Cameron redress. Reconfigure space out pups, LD 3.93' pup 20,005.0 20,005.0 5/5/2023 21:00 5/5/2023 22:00 1.00 COMPZN, RPCOMP THGR P MU space out pups, #478, Cameron hanger, feed Tec wire through hanger. 20,005.0 20,005.0 5/5/2023 22:00 5/5/2023 22:30 0.50 COMPZN, RPCOMP THGR P Test Tec wire fittings to 5000 psi ok. 20,005.0 20,005.0 5/5/2023 22:30 5/6/2023 00:00 1.50 COMPZN, RPCOMP THGR P RIH w/ Cameron hanger, land out hanger, verify hanger on depth, turn landing Jt 4 turns out to release snap ring. Pull test to 259K hookload ok. 20,005.0 20,039.0 5/6/2023 00:00 5/6/2023 01:30 1.50 COMPZN, RPCOMP THGR P RU to pump down tubing and RU return line from IA. SIMOPS: Cameron rep pressure test tubing hanger seals to 5000 psi for 15 minutes each, T-seal and mechanical seals. 20,039.0 20,039.0 5/6/2023 01:30 5/6/2023 01:45 0.25 COMPZN, WHDBOP PACK P PJSM, fluid pack and PT surface lines to 5000 psi 20,039.0 20,039.0 5/6/2023 01:45 5/6/2023 03:00 1.25 COMPZN, WHDBOP PACK P Set Baker packer per Baker rep. Stage up pressure 500 psi per stage. Annulus pressure following +100 psi. At 1470 psi Tbg pressure, 1570 IA pressure, notice tbg pressure start increasing faster than IA w/ pump 1 more stroke. Shutdown pump, hold 1583 psi, 15 min. (Lower DHG=5525 psi) Bleed off IA, confirm packer set. 20,039.0 20,039.0 5/6/2023 03:00 5/6/2023 03:30 0.50 COMPZN, WHDBOP PRTS P PT Tbg and packer from below to 4000 psi for 15 min, charted 20,039.0 20,039.0 5/6/2023 03:30 5/6/2023 04:00 0.50 COMPZN, WHDBOP Bleed off Tbg, pressure up IA to1156 psi to shear SOV, 20,039.0 20,039.0 5/6/2023 04:00 5/6/2023 05:00 1.00 COMPZN, WHDBOP RURD P RD head pin and circ gear, back out landing Jt and LD. SIMOPS: RD casing equip and Silverwell equip. 20,039.0 20,039.0 5/6/2023 05:00 5/6/2023 06:00 1.00 COMPZN, WHDBOP RURD P Set HP-BPV with T-bar per Cameron Rep 0.0 0.0 5/6/2023 06:00 5/6/2023 07:00 1.00 COMPZN, WHDBOP DHEQ P Line up to Inj line/MP #4. Pump down IA to test HP-BPV from below to 1500 psi for 15 min.Charted. Bleed off, blow down. Cont clear and clean floor. 0.0 0.0 5/6/2023 07:00 5/6/2023 09:30 2.50 COMPZN, WHDBOP RURD P LD mousehole, foxhole #1 and #2. Prep MPD equip for RD, Silverwell conduct test on Tec wire. Remove low pressure riser. SIMOPS: Offload pit#5, clean pits, flush all pumps and surface lines w/ DeepKleen pill 0.0 0.0 5/6/2023 09:30 5/6/2023 12:00 2.50 COMPZN, WHDBOP NUND P RD MPD lines and HP iron. Cont cleaning pits and surface lines. Clear floor of Silverwell equip and tools. prep to hoist RCD clamp assy, power down Koomey unit 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 137/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/6/2023 12:00 5/6/2023 16:00 4.00 COMPZN, WHDBOP NUND P Remove RCD clamp assy and secure on cart in BOP deck, remove choke and kill lines, Rack back BOP's on transport stand and secure for move, remove HP riser from wellhead and secure on cart in BOP deck, clean sumps in pit and pump mods. 0.0 0.0 5/6/2023 16:00 5/6/2023 18:00 2.00 COMPZN, WHDBOP NUND P Cameron reps prep wellhead for tree adapter, Silverwell begin terminating Tec wire. Clean ST-120 and prep for mechanic, clean and drain liner wash sumps on MP's.Flush CPU with Deepclean and offload. 0.0 0.0 5/6/2023 18:00 5/6/2023 22:00 4.00 COMPZN, WHDBOP NUND P Silverwell installing wellhead outlet, test. SIMOPS. Flush and blow down all 4 mud pumps and pump lines, cont cleaning in pits, mobilize tree to BOP deck, make breaks on tree to orient per drawing. 0.0 0.0 5/6/2023 22:00 5/7/2023 00:00 2.00 COMPZN, WHDBOP NUND T Cameron attempt to install support ring for ICanh seals. Trouble getting threaded in. SIMOPS: Cont flushing and blowing down mix/charge pumps, pit lines, clean drip pan and rotary table area, mobilize rig mats off location for rig move. Move cuttings tanks for mat access. 0.0 0.0 5/7/2023 00:00 5/7/2023 03:30 3.50 COMPZN, WHDBOP NUND P Install support ring per Cameron rep. SIMOPS: Cont flushing and blowing down mix/charge pumps, pit lines, clean drip pan and rotary table area. Mobilize rig mats off location for rig move. 0.0 0.0 5/7/2023 03:30 5/7/2023 05:15 1.75 COMPZN, WHDBOP NUND P Install wellhead studs for Tbg head adapter. Install tubing head adapter and torque per Cameron rep. SIMOPS: Cont flushing and clean in pits, clean drip pan area and rig floor 0.0 0.0 5/7/2023 05:15 5/7/2023 06:00 0.75 COMPZN, WHDBOP PRTS P Test tubing head adapter through upper port 250 psi low 5000 psi high for 15 min. Pressure test tubing head adapter through lower port, 250 psi low and 5000 psi for 15 min. Co man witness. 0.0 0.0 5/7/2023 06:00 5/7/2023 10:15 4.25 COMPZN, WHDBOP NUND P NU tree to adapter per Cameron rep. orient tree and actuator valve per drawing. Pad operator verify correct orientation. Torque all studs to spec. SIMOPS: Prep CD4 location for move 0.0 0.0 5/7/2023 10:15 5/7/2023 12:00 1.75 COMPZN, WHDBOP PRTS P Fill tree with diesel and pressure test, 250 psi low and 5000 psi high for 15 min, charted. 0.0 0.0 5/7/2023 12:00 5/7/2023 12:45 0.75 COMPZN, WHDBOP RURD P Pull HP-BPV per Cameron rep 0.0 0.0 5/7/2023 12:45 5/7/2023 14:00 1.25 COMPZN, WHDBOP FRZP P RU to pump freeze protection w/ LRS. PT lines to 2000 psi. PJSM w/ crew 0.0 0.0 5/7/2023 14:00 5/7/2023 17:00 3.00 COMPZN, WHDBOP FRZP P LRS pump diesel freeze protect down IA taking returns up tubing to CPU. 191 bbls pumped, 1.25 bpm. 644 psi max pressure. Swap to generator power and off gas at 1500 Hrs. 0.0 0.0 5/7/2023 17:00 5/7/2023 18:30 1.50 COMPZN, WHDBOP FRZP P RD, LRS. IA = 262 psi. Line up and U- tube to balance freeze protect to 1400' MD /1391' TVD. 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 138/138 CD2-361 Report Printed: 5/23/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 5/7/2023 18:30 5/7/2023 20:00 1.50 COMPZN, WHDBOP FRZP P Blow down all lines and freeze protect equipment. RD same. 0.0 0.0 5/7/2023 20:00 5/7/2023 21:00 1.00 COMPZN, WHDBOP RURD P Remove double annulus valves, install flanges and valve/gauge assy's on OA, IA and TBG. Check final pressures. OA= 10 psi, IA = 20 psi, TBG = 0 psi. Secure well, all valves closed. SIMOPS: Prep for skidding drill mod. unhook all power cables to mods and drill floor. clean and stow tools from cellar, begin blow down water system. 0.0 0.0 5/7/2023 21:00 5/8/2023 00:00 3.00 DEMOB, MOVE RURD P Clean wellhead/tree and cellar. Cont prep for skidding drill mod. Clean and stow tools from cellar, blow down water system and steam system. Release Rig 5/8/23 0000 hrs 0.0 0.0 Rig: DOYON 26 RIG RELEASE DATE 5/8/2023 Page 1/1 CD2-361 Report Printed: 6/1/2023 Cement Cement Details Description Surface String Cement Cementing Start Date 12/13/2022 18:00 Cementing End Date 12/14/2022 22:00 Wellbore Name CD2-361 Comment Cement Stages Stage # 1 Description 20" Casing Cement Objective Top Depth (ftKB) 56.1 Bottom Depth (ftKB) 2,478.5 Full Return? Yes Vol Cement … 265.0 Top Plug? No Btm Plug? No Q Pump Init (bbl/m… 11 Q Pump Final (bbl/… 11 Q Pump Avg (bbl/… 700 P Pump Final (psi) 810.0 P Plug Bump (psi) 1,420.0 Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment BREAK CIRCULATION @ 2 BPM, VERIFY FLOW PATH AND ENSURE DEBRIS CUP IS IN PLACE. STAGE PUMPS UP TO 12 BPM, PSI=490, F/O=28%, CONTINUE CLEARING CASING EQUIPMENT FROM RIG FLOOR. RIG UP INJECTION LINE TO 4" VALVE IN CELLAR BOX FOR BLACK WATER FLUSH/CEMENT CLEAN UP. RIG PUMPS DISPLACE 68 BBLS OF 10.0 PPG DRIL PLEX MUD AT 420 GPM W/ 560 PSI. LATCH DART AND PRESSURE UP TO 1420 PSI, BLEED OFF, & CHECK FLOATS. FLOATS HOLDING. Cement Fluids & Additives Fluid Fluid Type Lead Cement Fluid Description Estimated Top (ftKB) 56.1 Est Btm (ftKB) 1,500.0 Amount (sacks) 1,757 Class G Volume Pumped (bbl) 645.0 Yield (ft³/sack) 1.92 Mix H20 Ratio (gal/sack) 6.70 Free Water (%) Density (lb/gal) 11.00 Plastic Viscosity (cP) 198.0 Thickening Time (hr) 5.47 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 1,500.0 Est Btm (ftKB) 2,478.5 Amount (sacks) 684 Class G Volume Pumped (bbl) 155.0 Yield (ft³/sack) 1.17 Mix H20 Ratio (gal/sack) 4.80 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) 87.0 Thickening Time (hr) 5.32 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Surface String Cement Page 1/1 CD2-361 Report Printed: 6/1/2023 Cement Cement Details Description Intermediate String 1 Cement Cementing Start Date 12/31/2022 21:30 Cementing End Date 1/1/2023 04:30 Wellbore Name CD2-361 Comment Cement Stages Stage # 1 Description Intermediate String 1 Cement Objective Top Depth (ftKB) 2,319.3 Bottom Depth (ftKB) 6,404.0 Full Return? Yes Vol Cement …Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 5 Q Pump Final (bbl/… 3 Q Pump Avg (bbl/… 12 P Pump Final (psi) 600.0 P Plug Bump (psi) 600.0 Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Lead Cement Fluid Description Estimated Top (ftKB) 2,319.3 Est Btm (ftKB) 5,900.0 Amount (sacks) 1,123 Class *NOT IN LIBRARY Volume Pumped (bbl) 382.0 Yield (ft³/sack) 1.91 Mix H20 Ratio (gal/sack) 6.66 Free Water (%) Density (lb/gal) 11.00 Plastic Viscosity (cP) 326.0 Thickening Time (hr) 8.00 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 5,900.0 Est Btm (ftKB) 6,404.0 Amount (sacks) 474 Class *NOT IN LIBRARY Volume Pumped (bbl) 98.0 Yield (ft³/sack) 1.16 Mix H20 Ratio (gal/sack) 4.77 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) 180.0 Thickening Time (hr) 5.50 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 1 Cement Page 1/1 CD2-361 Report Printed: 6/1/2023 Cement Cement Details Description Intermediate String 2 Cement Cementing Start Date 1/15/2023 02:00 Cementing End Date 1/15/2023 07:30 Wellbore Name CD2-361 Comment Cement Stages Stage # 1 Description Intermediate String 2 Cement Objective Top Depth (ftKB) 11,406.0 Bottom Depth (ftKB) 12,599.0 Full Return? Yes Vol Cement … 0.0 Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 12 Q Pump Final (bbl/… 3 Q Pump Avg (bbl/… 10 P Pump Final (psi) 900.0 P Plug Bump (psi) 1,400.0 Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Fluid Description Estimated Top (ftKB) Est Btm (ftKB) Amount (sacks) Class Volume Pumped (bbl) Yield (ft³/sack) Mix H20 Ratio (gal/sack) Free Water (%) Density (lb/gal) Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 2 Cement Page 1/1 CD2-361 Report Printed: 6/1/2023 Cement Cement Details Description Intermediate String 3 Cement Cementing Start Date 2/6/2023 13:45 Cementing End Date 2/6/2023 16:15 Wellbore Name CD2-361 Comment Cement Stages Stage # 1 Description Intermediate String 3 Cement Objective Top Depth (ftKB) 17,260.0 Bottom Depth (ftKB) 18,468.0 Full Return? Yes Vol Cement …Top Plug? No Btm Plug? No Q Pump Init (bbl/m… 6 Q Pump Final (bbl/… 6 Q Pump Avg (bbl/… 6 P Pump Final (psi) 600.0 P Plug Bump (psi) Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 17,260.0 Est Btm (ftKB) 18,468.0 Amount (sacks) 705 Class G Volume Pumped (bbl) 147.0 Yield (ft³/sack) 1.17 Mix H20 Ratio (gal/sack) 4.71 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) 9.00 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 3 Cement Page 1/1 CD2-361 Report Printed: 6/1/2023 Cement Cement Details Description Intermediate String 4 Cement Cementing Start Date 2/21/2023 18:00 Cementing End Date 2/22/2023 02:00 Wellbore Name CD2-361 Comment no returns during cement job, bump plug on time, test casing 3500 psi good test Cement Stages Stage # 1 Description Liner Cement Objective Top Depth (ftKB) 18,790.0 Bottom Depth (ftKB) 20,445.0 Full Return? No Vol Cement … 0.0 Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… Q Pump Final (bbl/… Q Pump Avg (bbl/…P Pump Final (psi) P Plug Bump (psi) Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 18,790.0 Est Btm (ftKB) 20,445.0 Amount (sacks) 705 Class G Volume Pumped (bbl) 84.0 Yield (ft³/sack) 1.17 Mix H20 Ratio (gal/sack) 4.71 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) 12.00 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 4 Cement STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION BOPE Test Report for: Reviewed By: P.I. Suprv Comm ________COLVILLE RIV UNIT CD2-361 JBR 05/23/2023 MISC. INSPECTIONS: FLOOR SAFTY VALVES:CHOKE MANIFOLD:BOP STACK: ACCUMULATOR SYSTEM:MUD SYSTEM: P/F P/F P/FP/FP/F Visual Alarm QuantityQuantity Time/Pressure SizeQuantity Number of Failures:1 Tested all gas alarms and PVT's, LEL sensor on rig floor was calibrated and passed retest. Tested with 4 1/2" and 5 7/8" test joints. Precharge Bottles = 36 Each all @ 1000psi each. Test Results TEST DATA Rig Rep:Zeciri / AgnesOperator:ConocoPhillips Alaska, Inc.Operator Rep:Brown / Lundale Rig Owner/Rig No.:Doyon 26 PTD#:2211160 DATE:4/24/2023 Type Operation:DRILL Annular: 250/2500Type Test:OTH Valves: 250/4000 Rams: 250/4000 Test Pressures:Inspection No:bopBDB230426084736 Inspector Brian Bixby Inspector Insp Source Related Insp No: INSIDE REEL VALVES: Quantity P/F (Valid for Coil Rigs Only) Remarks: Test Time 10 MASP: 3510 Sundry No: Control System Response Time (sec) Time P/F Housekeeping:P PTD On Location P Standing Order Posted P Well Sign P Hazard Sec.P Test Fluid W Misc NA Upper Kelly 1 P Lower Kelly 1 P Ball Type 2 P Inside BOP 2 P FSV Misc 0 NA 16 PNo. Valves 1 PManual Chokes 1 PHydraulic Chokes 0 NACH Misc Stripper 0 NA Annular Preventer 1 18 3/4"P #1 Rams 1 4.5 x 7 5/8 P #2 Rams 1 Blind/Shear P #3 Rams 1 3.5 x 6 5/8 P #4 Rams 0 NA #5 Rams 0 NA #6 Rams 0 NA Choke Ln. Valves 1 3 1/8"P HCR Valves 2 3 1/16,3 1/8 P Kill Line Valves 2 3", 3 1/16"P Check Valve 0 NA BOP Misc 0 NA System Pressure P3010 Pressure After Closure P1700 200 PSI Attained P14 Full Pressure Attained P89 Blind Switch Covers:PYES Bottle precharge P Nitgn Btls# &psi (avg)P10@3900 ACC Misc NA0 P PTrip Tank P PPit Level Indicators P PFlow Indicator P FPMeth Gas Detector P PH2S Gas Detector 0 NAMS Misc Inside Reel Valves 0 NA Annular Preventer P22 #1 Rams P13 #2 Rams P14 #3 Rams P14 #4 Rams NA0 #5 Rams NA0 #6 Rams NA0 HCR Choke P2 HCR Kill P2 9 9 9999 9 LEL sensor on rig floor was calibrated and passed retest. FP 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov Chris Brillon Wells Engineering Manager ConocoPhillips P.O. Box 100360 Anchorage, AK, 99510 Re: Colville River Field, Alpine Oil Pool, CRU CD2-361 ConocoPhillips Permit to Drill Number: 221-116 revised Surface Location: 2181' FNL, 1770' FEL, Sec. 2, T11N, R4E, UM Bottomhole Location: 1726' FNL, 635' FEL, Sec. 8, T12N, R4E, UM Dear Mr. Brillion: Enclosed is the approved application for the permit to drill the above referenced well. Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071, composite curves for all well logs run must be submitted to the AOGCC within 90 days after completion, suspension, or abandonment of this well, or within 90 days of acquisition of the data, whichever occurs first. For clarity of the well records, all information, survey data, well logs, and other data from the 3,000' abandoned section of wellbore must be labeled with the well name and number CRU CD2-361 PB1, API Number 50-103-20836-70-00, and Permit to Drill Number 221-116. This permit to drill does not exempt you from obtaining additional permits or an approval required by law from other governmental agencies and does not authorize conducting drilling operations until all other required permits and approvals have been issued. In addition, the AOGCC reserves the right to withdraw the permit in the event it was erroneously issued. Operations must be conducted in accordance with AS 31.05 and Title 20, Chapter 25 of the Alaska Administrative Code unless the AOGCC specifically authorizes a variance. Failure to comply with an applicable provision of AS 31.05, Title 20, Chapter 25 of the Alaska Administrative Code, or an AOGCC order, or the terms and conditions of this permit may result in the revocation or suspension of the permit. Sincerely, Brett W. Huber, Sr. Chair, Commissioner DATED this ___ day of March, 2023. 28 Brett W. Huber, Sr. Digitally signed by Brett W. Huber, Sr. Date: 2023.03.28 09:32:58 -08'00' 1a. Type of Work: 1b. Proposed Well Class: Exploratory - Gas Service - WAG Service - Disp 1c. Specify if well is proposed for: Drill Lateral Stratigraphic Test Development - Oil Service - Winj Single Zone Coalbed Gas Gas Hydrates Redrill Reentry Exploratory - Oil Development - Gas Service - Supply Multiple Zone Geothermal Shale Gas 2. Operator Name:5. Bond: Blanket Single Well 11. Well Name and Number: Bond No. 3. Address:6. Proposed Depth:12. Field/Pool(s): MD: 35,306 TVD: 7,198 4a. Location of Well (Governmental Section):7. Property Designation: Surface: Top of Productive Horizon:8. DNR Approval Number:13. Approximate Spud Date: 3/25/2023 Total Depth:9. Acres in Property:14. Distance to Nearest Property: 3554' to ADL390345 4b. Location of Well (State Base Plane Coordinates - NAD 27):10. KB Elevation above MSL (ft): 70.7 15. Distance to Nearest Well Open Surface: x- 371463.9 y- 5974180.2 Zone- 4 15.7 to Same Pool: 4804' to CD2-310 16. Deviated wells:Kickoff depth: 400 feet 17. Maximum Potential Pressures in psig (see 20 AAC 25.035) Maximum Hole Angle: 90 degrees Downhole:Surface: Hole Casing Weight Grade Coupling Length MD TVD MD TVD 56" 30"328 X65 Welded 80 55 55 135 135 24" 20"133 L-80 TNS-ER 2,425 53 53 2,478 2,411 20" 17"88.1 P-110IC TNS-W521 4,085 2,319 2,264 6,404 4,407 17-1/2" 13-5/8"88.2 L-80IC TNS-W563 12,548 51 51 12,599 5,681 13-1/2" 9-7/8"62.8 L-80 TNS-W563 6,045 12,423 5,645 18,468 6,896 684 sx 15.8 ppg Class G Tail 10-1/4" 7-5/8"29.7 L-80 TNS-W523 2,342 18,103 6,820 20,445 7,134 6-3/4" 4-1/2"12.6 L-80 TNS-W563 15,065 20,241 7,126 35,306 7,198 19.PRESENT WELL CONDITION SUMMARY (To be completed for Redrill and Re-Entry Operations) Junk (measured): TVD Hydraulic Fracture planned?Yes No 20. Attachments: Property Plat BOP Sketch Drilling Program Time v. Depth Plot Shallow Hazard Analysis Diverter Sketch Seabed Report Drilling Fluid Program 20 AAC 25.050 requirements Contact Name: Matt Nagel Chris Brillon Contact Email:Matt.B.Nagel@ConocoPhillips.com Wells Engineering Manager Contact Phone:907-263-4747 Date: Permit to Drill API Number: Permit Approval Number:Date: Conditions of approval : If box is checked, well may not be used to explore for, test, or produce coalbed methane, gas hydrates, or gas contained in shales: Samples req'd: Yes No Mud log req'd: Yes No H2S measures: Yes No Directional svy req'd: Yes No Spacing exception req'd: Yes No Inclination-only svy req'd: Yes No Post initial injection MIT req'd: Yes No APPROVED BY Approved by: COMMISSIONER THE COMMISSION Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng 21. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Surface Perforation Depth TVD (ft): GL / BF Elevation above MSL (ft): Perforation Depth MD (ft): 1,034 sx 15.8 ppg Class G Tail Uncemented Liner Beneath Packer Effect. Depth MD (ft): Effect. Depth TVD (ft): Authorized Title: Authorized Signature: Production Liner Intermediate Authorized Name: Conductor/Structural LengthCasing Cement Volume MDSize Plugs (measured): (including stage data) 13 yds Slurry 2,655sx 11.0 ppg DeepCRETE Lead 836 sx 15.8 ppg Class G Tail 293 sx 15.8 ppg Class G Tail 4397, 2589, 986, 240, 653, 1427, 853 18. Casing Program:Top - Setting Depth - BottomSpecifications 4229 Total Depth MD (ft): Total Depth TVD (ft): 59-52-180 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION PERMIT TO DRILL 20 AAC 25.005 1,219 sx 11.0 ppg Extended Class G Lead, 471 sx 15.8 ppg Class G Tail 3510 5218' FNL, 950' FEL, Sec. 16, T12N, R4E, UM 1726' FNL, 635' FEL, Sec. 8, T12N, R4E, UM LONS 97-007 P.O. Box 100360 Anchorage, AK 99510-0360 ConocoPhillips 2181' FNL, 1770' FEL, Sec. 2, T11N, R4E, UM ADL380075 ADL025530 ADL025529 AA084140 ADL388904 ADL380093 ADL390344 CRU CD2-361 Colville River Field Alpine Oil Pool Cement Quantity, c.f. or sacks Commission Use Only See cover letter for other requirements. Stratigraphic Test Nooo Mud log req'd: Yesss No oo No Directional svy req'd: Yes Noo Seabed ReportDrilling Fluid Program 20 AAC 25.050 requirements BOP SketchDrillingProgram Time v. Depth PlotShallow HazardAnalysis Single Well Gas Hydrates Nooo Inclination-only svy req'd: Yes ss Noo Exploratory -Oil Development -Gas Service -Supply MultipleZone Geothermal sss Nooo s No Form 10-401 Revised 3/2021 This permit is valid for 24 months from the date of approval per 20 AAC 25.005(g) By Samantha Carlisle at 12:53 pm, Mar 24, 2023 50-103-20836-00-00 SFD BOP test to 4000 psig Annular preventer test to 2500 psig BOP test frequency is 3 weeks according to attached OTH-21-018. 221-116 23,875 3/25/2023 X VTL 03/24/2023 Revised SFD 3/24/2023GCW 03/28/23JLC 3/28/2023 01/20/2022 3/28/23Brett W. Huber, Sr.Digitally signed by Brett W. Huber, Sr. Date: 2023.03.28 09:33:36 -08'00' 1 Regg, James B (OGC) From:Rig 26 <rig26@doyondrilling.com> Sent:Tuesday, March 14, 2023 9:56 AM To:Andrew Honea; DOA AOGCC Prudhoe Bay; Doyon 26 Driling Supervisor; Hobbs, Greg S; Regg, James B (OGC); Brooks, Phoebe L (OGC) Cc:BLM_AK_AKSO_EnergySection_Notifications; WSC Rig Advisor (wscrigadvisor@conocophillips.com); Samuel Dye; Ben Wedin; Bill Walter Subject:Doyon 26 BOP Test 3-13-23 Attachments:CD2-361 Drawdown Worksheet 3-13-23.xlsx; BOP Doyon 26 3-13-2023.xlsx; 3-13-23 Doyon 26 CD2-361 Test Sequence.docx; 3-13-23 Chart #2.pdf; 3-13-23 Chart #1.pdf All, attached is info for our BOP test date 3‐13‐23 Johnny Newman Rig 26 Toolpusher Rig26@doyondrilling.com Rig Cell 907‐301‐1502 Personal Cell 907‐980‐5303 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. CRU CD2-361PTD 2211160 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:26 DATE:3/13/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2211160 Sundry # Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:Other:X Rams:250/4000 Annular:250/2500 Valves:250/4000 MASP:3579 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 P Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 2 P Test Fluid Water Inside BOP 2 P FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 18-3/4"x5000psi P Pit Level Indicators P P #1 Rams 1 4-1/2"x7-5/8"P Flow Indicator P P #2 Rams 1 Blind/Shear P Meth Gas Detector P P #3 Rams 1 3-1/2"x6-5/8"P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3-1/8"x5000psi P Time/Pressure Test Result HCR Valves 2 3-1/16" & 3-1/8"P System Pressure (psi)3050 P Kill Line Valves 2 3" & 3-1/16"P Pressure After Closure (psi)1625 P Check Valve 0 NA 200 psi Attained (sec)11 P BOP Misc 0 NA Full Pressure Attained (sec)84 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:1000 P Quantity Test Result Nitgn. Bottles # & psi (Avg.):10 @ 3600 P No. Valves 16 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 22 P #1 Rams 17 P Coiled Tubing Only:#2 Rams 17 P Inside Reel valves 0 NA #3 Rams 16 P #4 Rams NA Test Results #5 Rams NA #6 Rams NA Number of Failures:0 Test Time:10.5 HCR Choke 2 P Repair or replacement of equipment will be made within days. HCR Kill 2 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 3/10/23 13:43 Waived By Test Start Date/Time:3/12/2023 18:00 (date)(time)Witness Test Finish Date/Time:3/13/2023 4:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Brian Bixby Doyon Test Annular with 4-1/2" & 5-7/8" TJ to 250psi low f/ 5min and 2500psi high f/ 10min. All remaining tests performed to 250psi low f/ 5min and 4000psi high f/ 10min each, #1 Rams w/ 4-1/2" & 5-7/8" TJ, #3 Rams w/ 4-1/2" & 5-7/8" TJ, Blind Rams, Auto/Man IBOP, choke valves #1-16, 4-1/2 & 5-7/8 FOSV & Dart valves. Function tested PVT sensors, tested flow Meter and Gas Alarms. J Newman/ E Fleagle CPAI K Hinrichs / M Arthur CRU CD2-361 Test Pressure (psi): rig26@doyondrilling.com d26cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0313_BOP_Doyon26_CRU_CD2-361         J. Regg; 6/14/2023 BOP Test - Doyon 26 CRU CD2-361 PTD 2211160 3/13/2023 J. Regg; 6/14/2023 BOP Test - Doyon 26 CRU CD2-361 PTD 2211160 3/13/2023 J. Regg; 6/14/2023 Doyon 26 CD2-361 3-13-23 Test Sequence 4-1/2 & 5-7/8 Test Joint #1. Annular #2. UPR/ Valves 1,14,15,16/ kill valve 3/ upper IBOP #3. Valves 10,13/ HCR kill/ Lower IBOP #4. Valves 4,9,12/ 5-7/8 FOSV/ Manual kill #5. Valves 6,8,11/ 5-7/8 Dart #6. Valves 5,7 #7. Valve 2/ 4-1/2 FOSV #8. HCR choke/ 4-1/2 Dart #9. Manual choke #10. LPR #11. Blind rams/ valves 3 5-7/8 Test Joint #12. Annular #13. UPR #14. LPR #15. Choke A #16. Choke B J. Regg; 6/14/2023 DOYON RIG 26 ACCUMULATOR DRAW DOWN WORKSHEET WELL: CD2-361 DATE: 3/13/23 ACCUMULATOR PSI 3050 MANIFOLD PSI 1550 FUNCTION RAMS/ANNULAR/ HCR'S, DON'T FUNCTION BLINDS! FUNCTION ONE RAM TWICE LET PRSSURE STABILIZE AND RECORD BACK UP NITROGEN BOTTLE'S ACCUMULATOR PSI 1625 Accumulator bottle pre-charge 1000 NITROGEN BOTTLE'S 10ea 3600psi Avg. TURN ON ELEC. PUMP, SEC FOR 200 PSI =11 *Tested with both electric pumps TURN ON AIR PUMP'S TIME FOR FULL CHARGE =84 J. Regg; 6/14/2023 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION BOPE Test Report for: Reviewed By: P.I. Suprv Comm ________COLVILLE RIV UNIT CD2-361 JBR 04/05/2023 MISC. INSPECTIONS: FLOOR SAFTY VALVES:CHOKE MANIFOLD:BOP STACK: ACCUMULATOR SYSTEM:MUD SYSTEM: P/F P/F P/FP/FP/F Visual Alarm QuantityQuantity Time/Pressure SizeQuantity Number of Failures:1 4.5" and 5 7/8" test joints used. The upper rams had a hydraulic leak from a door seal. Test started on 2/23/23; I left location after testing was complete but before the seal was repaired. Test Results TEST DATA Rig Rep:A. Zeciri/E. FleagleOperator:ConocoPhillips Alaska, Inc.Operator Rep:R. Bjorhus/M. Arthur Rig Owner/Rig No.:Doyon 26 PTD#:2211160 DATE:2/24/2023 Type Operation:DRILL Annular: 250/2500Type Test:OTH Valves: 250/4000 Rams: 250/4000 Test Pressures:Inspection No:bopGDC230223072257 Inspector Guy Cook Inspector Insp Source Related Insp No: INSIDE REEL VALVES: Quantity P/F (Valid for Coil Rigs Only) Remarks: Test Time 17 MASP: 3579 Sundry No: Control System Response Time (sec) Time P/F Housekeeping:P PTD On Location P Standing Order Posted P Well Sign P Hazard Sec.P Test Fluid W Misc NA Upper Kelly 1 P Lower Kelly 1 P Ball Type 1 P Inside BOP 1 P FSV Misc 0 NA 16 PNo. Valves 1 PManual Chokes 1 PHydraulic Chokes 0 NACH Misc Stripper 0 NA Annular Preventer 1 18 3/4" 5000 P #1 Rams 1 4.5x7 5/8 VB P #2 Rams 1 Blind/Shear P #3 Rams 1 3.5x6 5/8 VB P #4 Rams 0 NA #5 Rams 0 NA #6 Rams 0 NA Choke Ln. Valves 1 3 1/8" 5000 P HCR Valves 2 3 1/16" 3 1/8"P Kill Line Valves 2 3" & 3 1/16" P Check Valve 0 NA BOP Misc 1 UPR Rams D F System Pressure P3050 Pressure After Closure P1650 200 PSI Attained P26 Full Pressure Attained P151 Blind Switch Covers:PAll Stations Bottle precharge P Nitgn Btls# &psi (avg)P10@4000 ps ACC Misc NA0 P PTrip Tank P PPit Level Indicators P PFlow Indicator P PMeth Gas Detector P PH2S Gas Detector NA NAMS Misc Inside Reel Valves 0 NA Annular Preventer P21 #1 Rams P17 #2 Rams P18 #3 Rams P16 #4 Rams NA0 #5 Rams NA0 #6 Rams NA0 HCR Choke P2 HCR Kill P2 9 9 9 9999 9 9 0$63SHU37' SVLMEU 7HVWFKDUWVDWWDFKHG7HVWFRQILUPVUHSDLUV WRXSSHUSLSHUDPGRRUVHDOMEU F upper rams had a hydraulic leak from a door seal. left location after testing was complete but before the seal was repaired. 0$63SHU37' SVLMEU 9 6QQFS1JQF3BNTBGUFSSFQBJSTUPEPPSTFBMT DOYON RIG 26 ACCUMULATOR DRAW DOWN WORKSHEET WELL: CD2-361 DATE: 2/25/22 ACCUMULATOR PSI 3050 MANIFOLD PSI 1650 FUNCTION RAMS/ANNULAR/ HCR'S, DON'T FUNCTION BLINDS! FUNCTION ONE RAM TWICE LET PRSSURE STABILIZE AND RECORD BACK UP NITROGEN BOTTLE'S ACCUMULATOR PSI 1650 Accumulator bottle pre-charge 1000 NITROGEN BOTTLE'S 10ea 4000psi Avg. TURN ON ELEC. PUMP, SEC FOR 200 PSI = 26 * Tested with both electric pumps TURN ON AIR PUMP'S TIME FOR FULL CHARGE = 151 1 Regg, James B (OGC) From:Rig 26 <rig26@doyondrilling.com> Sent:Sunday, February 5, 2023 1:08 PM To:Andrew Honea; DOA AOGCC Prudhoe Bay; Doyon 26 Driling Supervisor; Hobbs, Greg S; Regg, James B (OGC); Brooks, Phoebe L (OGC) Cc:BLM_AK_AKSO_EnergySection_Notifications; WSC Rig Advisor (wscrigadvisor@conocophillips.com); Samuel Dye; Ben Wedin; Bill Walter Subject:Doyon 26 BOP Test 2-5-23 Attachments:2-5-23 BOP Doyon 26 Test Chart 1.pdf; 2-5-23 BOP Doyon 26 Test Chart 2.pdf; 2-5-23 Doyon 26 CD2-361 Test Sequence.pdf; CD2-361 Drawdown Worksheet 2-5-23.xlsx; BOP Doyon 26 2-5-2023.xlsx All, attached is info for our BOP test date 2‐5‐23 Johnny Newman Rig 26 Toolpusher Rig26@doyondrilling.com Rig Cell 907‐301‐1502 Personal Cell 907‐980‐5303 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Colville River Unit CD2-361PTD 2211160 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:26 DATE:2/5/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2211160 Sundry # Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:X Other: Rams:250/4000 Annular:250/2500 Valves:250/4000 MASP:3579 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 P Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 3 P Test Fluid Water Inside BOP 3 P FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 18-3/4"x5000psi P Pit Level Indicators P P #1 Rams 1 4-1/2"x7-5/8"P Flow Indicator P P #2 Rams 1 Blind/Shear P Meth Gas Detector P P #3 Rams 1 3-1/2"x6-5/8"P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3-1/8"x5000psi P Time/Pressure Test Result HCR Valves 2 3-1/16" & 3-1/8"P System Pressure (psi)2900 P Kill Line Valves 2 3" & 3-1/16"P Pressure After Closure (psi)1650 P Check Valve 0 NA 200 psi Attained (sec)28 P BOP Misc 0 NA Full Pressure Attained (sec)154 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:1000 P Quantity Test Result Nitgn. Bottles # & psi (Avg.):10@3900 P No. Valves 16 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 16 P #1 Rams 18 P Coiled Tubing Only:#2 Rams 19 P Inside Reel valves 0 NA #3 Rams 15 P #4 Rams NA Test Results #5 Rams NA #6 Rams NA Number of Failures:0 Test Time:12.5 HCR Choke 2 P Repair or replacement of equipment will be made within days. HCR Kill 2 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 2/3/23 10:49 Waived By Test Start Date/Time:2/4/2023 12:00 (date)(time)Witness Test Finish Date/Time:2/5/2023 0:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Sully Sullivan Doyon Test Annular with 4-1/2" TJ to 250psi low f/ 5min and 2500psi high f/ 10min. All remaining tests performed to 250psi low f/ 5min and 4000psi high f/ 10min each, #1 Rams w/ 4-1/2" & 7-5/8" TJ, #3 Rams w/ 4-1/2" & 6-5/8" TJ, Blind Rams, Auto/Man IBOP, choke valves #1-16, 4-1/2, 5-7/8 & 6-5/8" FOSV, 4-1/2, 5-7/8 & 6-5/8" DART valves. Function tested PVT sensors, tested flow Meter and Gas Alarms. Accumulator Test with 2 electric pumps, #3 Rams functioned a second time to simulate Blind Rams. J Newman / A Agnes CPAI R Bjhorus / A Dorr CRU CD2-361 Test Pressure (psi): rig26@doyondrilling.com d26cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0205_BOP_Doyon26_CRU_CD2-361          J. Regg; 6/2/2023 DOYON RIG 26 ACCUMULATOR DRAW DOWN WORKSHEET WELL: CD2-361 DATE: 2/5/22 ACCUMULATOR PSI 2900 MANIFOLD PSI 1450 FUNCTION RAMS/ANNULAR/ HCR'S, DON'T FUNCTION BLINDS! FUNCTION ONE RAM TWICE LET PRSSURE STABILIZE AND RECORD BACK UP NITROGEN BOTTLE'S ACCUMULATOR PSI 1650 Accumulator bottle pre-charge 1000 NITROGEN BOTTLE'S 10ea 3900psi Avg. TURN ON ELEC. PUMP, SEC FOR 200 PSI =28 *Tested with both electric pumps TURN ON AIR PUMP'S TIME FOR FULL CHARGE =154 1 Regg, James B (OGC) From:Brooks, Phoebe L (OGC) Sent:Tuesday, January 31, 2023 1:43 PM To:Rig 26 Cc:Regg, James B (OGC) Subject:RE: BOP Doyon 26 1-2-2023.xlsx Attachments:Doyon 26 01-03-23 Revised.xlsx Attached is a revised report for Doyon 26 01‐03‐23 adding the Number Failures and Test Time (based on the remarks). I also moved the precharge amount to the remarks (if you want this documented – place it in the comments). Please update your copy. Thank you, Phoebe Phoebe Brooks Research Analyst Alaska Oil and Gas Conservation Commission Phone: 907‐793‐1242 CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Phoebe Brooks at 907-793-1242 or phoebe.brooks@alaska.gov. From: Rig 26 <rig26@doyondrilling.com> Sent: Tuesday, January 3, 2023 2:23 PM To: Andrew Honea <ahonea@doyondrilling.com>; DOA AOGCC Prudhoe Bay <doa.aogcc.prudhoe.bay@alaska.gov>; Doyon 26 Driling Supervisor <d26cm@conocophillips.com>; Hobbs, Greg S <Greg.S.Hobbs@conocophillips.com>; Regg, James B (OGC) <jim.regg@alaska.gov>; Brooks, Phoebe L (OGC) <phoebe.brooks@alaska.gov> Subject: BOP Doyon 26 1‐2‐2023.xlsx Please see attach bop test report. Thanks, Rig 26 Tool Pusher Agim Zeciri Rig Phone: 907‐670‐4187 Rig 26 Cell: 907‐301‐1502 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. CRU CD2-361PTD 2211160 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:26 DATE:1/3/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2211160 Sundry # Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:X Other: Rams:250/4000 Annular:250/2500 Valves:250/4000 MASP:3579 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 P Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 2 P Test Fluid Water Inside BOP 1 P FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 18-3/4"x5000psi P Pit Level Indicators P P #1 Rams 1 4-1/2"x7-5/8"P Flow Indicator P P #2 Rams 1 Blind/Shear P Meth Gas Detector P P #3 Rams 1 3-1/2"x6-5/8"P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3-1/8"x5000psi P Time/Pressure Test Result HCR Valves 2 3-1/16" & 3-1/8"P System Pressure (psi)3080 P Kill Line Valves 2 3" & 3-1/16"P Pressure After Closure (psi)1800 P Check Valve 0 NA 200 psi Attained (sec)17 P BOP Misc 0 NA Full Pressure Attained (sec)78 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:P Quantity Test Result Nitgn. Bottles # & psi (Avg.):10@4025 P No. Valves 16 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 22 P #1 Rams 17 P Coiled Tubing Only:#2 Rams 16 P Inside Reel valves 0 NA #3 Rams 18 P #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:10.0 HCR Choke 2 P Repair or replacement of equipment will be made within days. HCR Kill 2 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 12/31/22 07:50 Waived By Test Start Date/Time:1/2/2023 23:45 (date)(time)Witness Test Finish Date/Time:1/3/2023 10:00 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Adam Earl Doyon Test Annular with 6-5/8" TJ to 250psi low f/ 5min and 2500psi high f/ 10min. All remaining tests performed to 250psi low f/ 5min and 4000psi high f/ 10min each, #1 Rams w/ 6-5/8" TJ, #3 Rams w/ 6-5/8" TJ, Blind Rams, Auto/Man IBOP, choke valves #1-16, 6-5/8 FOSV X2 and DART. Function tested PVT sensors, tested flow Meter and Gas Alarms. Bottle precharge - 1000. A Zeciri / E Fleagle / A Agnes CPAI R Bjorhus / A Door CRU CD2-361 Test Pressure (psi): rig26@doyondrilling.com d26cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0103_BOP_Doyon26_CRU_CD2-361        J. Regg; 5/24/2023 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov -DQXDU\ &(57,),('0$,/± 5(78515(&(,375(48(67(' 0U/XNH/DZUHQFH :HOOV0DQDJHU &RQRFR3KLOOLSV$ODVND *6WUHHW $QFKRUDJH$. 5H 'RFNHW1XPEHU27+ $SSOLFDWLRQIRU:DLYHURQ&3$,5RWDU\ 5LJ%23(7HVW)UHTXHQF\ 'HDU0U/DZUHQFH %\OHWWHUGDWHG0D\&RQRFR3KLOOLSV$ODVND,QF&3$,UHTXHVWHGDZDLYHUIURPWKH $ODVND 2LO DQG *DV &RQVHUYDWLRQ &RPPLVVLRQ¶V $2*&& UHJXODWRU\ UHTXLUHG EORZRXW SUHYHQWLRQHTXLSPHQW%23(WHVWIUHTXHQF\IRUDOO&3$,URWDU\GULOOLQJULJVSHWLWLRQLQJWRWHVW WKHEORZRXWSUHYHQWLRQHTXLSPHQW%23(RQDGD\WHVWVFKHGXOH$2*&&JUDQWVDSSURYDO IRUOLPLWHGGXUDWLRQDQGVFRSH &3$,PHWZLWK$2*&&RQ$SULOVXPPDUL]HGLWVREMHFWLYHLQUHTXHVWLQJDSSURYDORID GD\%23(WHVWVFKHGXOHLPSURYH&3$,¶VDELOLW\WRFRPSHWHIRUFRUSRUDWH FDSLWDOLQYHVWPHQWV H[SODLQHGDOLJQPHQWZLWKLQGXVWU\VWDQGDUG%23(WHVWFULWHULD DQG&RQRFR3KLOOLSVJOREDOZHOO FRQWUROSROLF\DQGSURYLGHGDQRYHUYLHZRIQHZGULOOLQJWDUJHWVSODQQHGXVLQJD³KLJKVSHF H[WHQGHGUHDFKGULOOLQJULJ´&3$,DOVRSURYLGHGGHWDLOVDERXWWKHVFRSHDQG%23(SHUIRUPDQFH DFKLHYHPHQWV XQGHU LWV %HWZHHQ :HOO 0DLQWHQDQFH 3URJUDP %:0 IRU URWDU\ GULOOLQJ DQG ZRUNRYHUULJV $VZLWKSUHYLRXVUHTXHVWVWRH[WHQGWKH%23(WHVWLQWHUYDO&3$,UHIHUHQFHVQXPHURXVUHJXODWRU\ MXULVGLFWLRQVDVZHOODVVXJJHVWHGLQGXVWU\SUDFWLFHIURPWKH$PHULFDQ3HWUROHXP,QVWLWXWHUHODWLQJ WR WHVW IUHTXHQF\ HDFK SURYLGLQJIRU %23( WHVWLQJ DW LQWHUYDOV EH\RQG GD\V &3$, DOVR UHIHUHQFHVLWVLQWHUQDOZHOOFRQWUROPDQXDOZKLFKDOORZVIRUWHVWLQJDWLQWHUYDOVEH\RQGGD\V ϭW/^ƚĂŶĚĂƌĚϱϯ͕͞tĞůůŽŶƚƌŽůƋƵŝƉŵĞŶƚ^ǇƐƚĞŵƐĨŽƌƌŝůůŝŶŐtĞůůƐ͕͟ϱƚŚĚŝƚŝŽŶ;ĞĐĞŵďĞƌϮϬϭϴͿ ϮK'ĂƉƉƌŽǀĂůŽĨƚŚĞtDƉƌŽŐƌĂŵŚĂƐĞŶĂďůĞĚW/ǁŽƌŬŽǀĞƌƌŝŐƐƚŽĞǆƚĞŶĚƚŚĞŝŶƚĞƌǀĂůďĞƚǁĞĞŶKWƚĞƐƚƐ ĨƌŽŵĞǀĞƌǇϳĚĂǇƐƚŽŶŽƚĞǆĐĞĞĚŝŶŐϭϰĚĂǇƐ͘W/ĚĂƚĂƐŚŽǁƐƚŚĞtDŚĂƐƌĞĚƵĐĞĚƚŚĞŶƵŵďĞƌŽĨĐŽŵƉŽŶĞŶƚ ĨĂŝůƵƌĞƐĚƵƌŝŶŐKWƚĞƐƚŝŶŐďǇƌĞƉůĂĐŝŶŐĐŽŵƉŽŶĞŶƚƐƚŚĂƚŝŶĚŝĐĂƚĞƐƵƐƉĞĐƚŝŶƚĞŐƌŝƚǇďĞĨŽƌĞƚŚŽƐĞĐŽŵƉŽŶĞŶƚƐĨĂŝů ĚƵƌŝŶŐƚĞƐƚŝŶŐ͘ 'RFNHW1XPEHU27+ &3$,±GD\%23(7HVW,QWHUYDO -DQXDU\ ,PSURYHPHQW LQ %23( SHUIRUPDQFH WHVWLQJ UHVXOWV DWWULEXWHG WR &3$,¶V %:0 SURJUDP LV UHFRJQL]HG&3$,LVFRPPHQGHGIRULPSOHPHQWLQJWKHSURJUDPDQGZLWK$2*&&DSSURYDO&3$, ZRUNRYHUULJV KDYHEHHQDXWKRUL]HGWRWHVW %23( DWLQWHUYDOVXSWR GD\V$2*&&UHFRJQL]HV WKHFRPSOH[GULOOLQJSURJUDPVWKDWKDYHEHHQLQLWLDWHGE\&3$,WRWDUJHWFKDOOHQJLQJUHVRXUFHV ZKLOHPDLQWDLQLQJDVPDOOHQYLURQPHQWDOIRRWSULQWDQGWKHFRPPLWPHQWWRXVHUREXVWGULOOLQJULJV DQGFUHZVWRSHUIRUPWKRVHSURMHFWVLQDVDIHDQGHIILFLHQWPDQQHU,QUHVSRQVHWRWKHVHFKDOOHQJHV DQG WKH FRPPLWPHQWV E\ &3$, LQFOXGLQJ LPSOHPHQWDWLRQ RI WKH %:0 SURJUDP $2*&& FRQGLWLRQDOO\DSSURYHG'R\RQ5LJWRWHVW%23(RQDQHYHQWEDVLVLQVWHDGRIDWVSHFLILFWLPH LQWHUYDOVZKLOHGULOOLQJVSHFLILFLQWHUYDOV LQDQXOWUDH[WHQGHGUHDFKZHOO &3$,¶VUHTXHVWIRUD YDULDQFHIURPUHJXODWRU\UHTXLUHPHQWV RI$$&H$LV DSSURYHGIRUGULOOLQJULJV'R\RQDQG'R\RQDVDSLORWSURMHFWZLWKWKHIROORZLQJFRQGLWLRQV 7KHSLORWWHVWGXUDWLRQLVIRU21( \HDU IURPWKHDSSURYDOGDWHRIWKLVOHWWHUVXEMHFWWR SRWHQWLDOH[WHQVLRQDQG H[SDQVLRQWRLQFOXGHRWKHU&3$,RSHUDWHGULJVZLWK DWOHDVW PRQWKVRIFRQWLQXRXVULJZRUNDQG$2*&&UHYLHZRIDULJ¶V%23(V\VWHPUHOLDELOLW\ &3$,PXVWFRQWLQXHWRLPSOHPHQWWKH%:0SURJUDPDVDSSURYHGE\$2*&& 'HYHORSPHQWGULOOLQJZHOOVRQO\DUHLQFOXGHGLQWKLVDSSURYDO 7KHLQLWLDOWHVWDIWHUULJJLQJXS%23(WRGULOODZHOOPXVWEHWRWKHUDWHGZRUNLQJSUHVVXUH DVSURYLGHGLQ$3,6WDQGDUG &3$,LVHQFRXUDJHGWRWDNHDGYDQWDJHRIRSSRUWXQLWLHVWRWHVW5LJVPXVWWHVWEHIRUH UHHQWHULQJWKHZHOOLIDWULSWRVXUIDFHRFFXUVZLWKLQGD\VRIWKHGXHGDWHXQOHVVRWKHUZLVH DSSURYHGE\$2*&& &3$,PXVWDGKHUHWRRULJLQDOHTXLSPHQWPDQXIDFWXUHUUHFRPPHQGDWLRQVDQGUHSODFHPHQW SDUWVIRU%23( 5HTXHVWV IRU H[WHQVLRQV EH\RQG GD\V PXVW LQFOXGH MXVWLILFDWLRQ ZLWK VXSSRUWLQJ LQIRUPDWLRQGHPRQVWUDWLQJWKHDGGLWLRQDOWLPHLVQHFHVVDU\IRUZHOOFRQWUROSXUSRVHVRUWR PLWLJDWHDVWXFNGULOOVWULQJ KRXUDGYDQFHQRWLFHIRUD%23(WHVWVKDOOEHSURYLGHGWR$2*&&IRURSSRUWXQLW\WR ZLWQHVV ,I\RXKDYH TXHVWLRQVUHJDUGLQJWKLV SOHDVH FRQWDFW-LP5HJJ DW 6LQFHUHO\ -HUHP\0 3ULFH &KDLU&RPPLVVLRQHU FF *UHJ+REEV&3$, 0LNH.QHDOH&3$, 9LFWRULD/RHSS$2*&& $2*&&,QVSHFWRUVHPDLO Jeremy Price Digitally signed by Jeremy Price Date: 2022.01.25 13:00:50 -09'00' ConocoPhillips Alaska, Inc. Post Office Box 100360 Anchorage, Alaska 99510-0360 Telephone 907-276-1215 March 24, 2023 Alaska Oil and Gas Conservation Commission 333 West 7th Avenue, Suite 100 Anchorage, Alaska 99501 Re: Application for Permit to Drill CRU CD2-361 Dear Sir or Madam: ConocoPhillips Alaska, Inc. hereby applies for a Permit to Drill an onshore producer well from the CD2 drilling pad. The spud date for this well was December 10, 2022 using Doyon Rig 26 to drill the well. CD2-361 is planned to be a lateral Kuparuk C sand producer. The 24” Surface section was drilled to TD above the C-30 sand and then 20” casing was set and cemented to surface. The intermediate hole was drilled in four sections to mitigate issues with drilling the extended overburden section. The 17-1/2” x 20” Intermediate 1 section was drilled to 6,445’ MD and landed at an inclination of 78°. A 17” liner was set and cemented from TD to secure the shoe isolate the Qannik and C-10 reservoir. The 15-3/4” x 17-1/2” Intermediate 2 section was drilled at 78° inclination through the Albian 97 to 12,607’MD. A 13-5/8” casing was set and cemented to 250’ TVD above the shoe. The 12-1/4” x 13-1/2” Intermediate 3 section was drilled to 18,468’MD and into the HRZ. A 9-7/8” liner was set and cemented to 250’ TVD above the shoe. The 8-1/2” x 10-1/4” Intermeidate 4 section was drilled through the HRZ and Kalubik and was landed within the Kuparuk C target reservoir at 20,448’ MD. A 7-5/8” liner was set and cemented. The 6-3/4” Production section was geosteered within the Kuparuk C target reservoir. The wellbore will be sidetracked within the 6-3/4” section and will be geosteered within the Kuparuck C to investiage another section of the reservoir. A 4-1/2” pre- perforated liner will be set and the well will be completed with a tapered 5” x 4-1/2” tubing upper completion string. It is requested that a variance of diverter line size under 20 AAC 25.035 (c)(1)(B) is granted to allow drilling a 24” surface hole with a 16” diverter line using Doyon 26 as per Docket OTH-17-048. Please find attached the information required by 20 ACC 25.005 (a) and (c) for your review. Pertinent information attached to this application includes the following: 1. Form 10-401 APPLICATION FOR Permit to Drill per 20 ACC 25.005 (a) 2. A proposed drilling program 3. A proposed completion diagram 4. A drilling fluids program summary 5. Pressure information as required by 20 ACC 25.035 (d)(2) 6. Directional drilling / collision avoidance information as required by 20 ACC 25.050 (b) Information pertinent to the application that is presently on file at the AOGCC: 1. Diagrams of the BOP equipment, diverter equipment and choke manifold lay out as required by 20 ACC 25.035 (a) and (b). 2. A description of the drilling fluids handling system. 3. Diagram of riser set up. If you have any questions or require further information, please contact Matt Nagel at 907-263-4747 (Matt.B.Nagel@ConocoPhillips.com) or Chris Brillon at 265-6120. Sincerely, cc: CD2-361 Well File / Jenna Taylor ATO 540 David Lee ATO 1726 Chris Brillon ATO 1796 Matt Nagel Layla Unger ATO 1756 Drilling Engineer Andy Mack Kuukpik Corp g A 7-5/8” liner was set and cemented. wellbore will be sidetracked withingpg the 6-3/4” section and will be geosteered within the Kuparuck C to investiage another section of the reservoir. A AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 1 of 21 Printed: 24-Mar-23 CD2-361 AOGCC Application for Permit to Drill Document Table of Contents 1. Well Name (Requirements of 20 AAC 25.005 (f)) .................................................................................... 2 2. Location Summary (Requirements of 20 AAC 25.005(c)(2)) ................................................... 2 3. Blowout Prevention Equipment Information (Requirements of 20 AAC 25.005(c)(3)) .......... 2 4. Drilling Hazards Information (Requirements of 20 AAC 25.005 (c)(4)) ................................... 3 5. Procedure for Conducting Formation Integrity Tests (Requirements of 20 AAC 25.005 (c)(5)) ......................................................................................... 4 6. Casing and Cementing Program (Requirements of 20 AAC 25.005(c)(6)) ............................. 5 7. Diverter System Information (Requirements of 20 AAC 25.005(c)(7)).................................... 5 8. Drilling Fluid Program (Requirements of 20 AAC 25.005(c)(8)) .............................................. 6 9. Abnormally Pressured Formation Information (Requirements of 20 AAC 25.005 (c)(9)) ..... 7 10. Seismic Analysis (Requirements of 20 AAC 25.005 (c)(10)) .................................................... 7 11. Seabed Condition Analysis (Requirements of 20 AAC 25.005 (c)(11)) ................................... 7 12. Evidence of Bonding (Requirements of 20 AAC 25.005 (c)(12)) .............................................. 7 13. Proposed Drilling Program (Requirements of 20 AAC 25.005 (c)(13)) .................................... 8 14. Discussion of Mud and Cuttings Disposal and Annular Disposal ..................... 11 (Requirements of 20 AAC 25.005 (c)(14)) ..................................................................................... 11 15. Attachments ........................................................................................................... 11 Attachment 1 Cement Summary Attachment 2 Drilling Hazards Summary Attachment 3 Completion Schematic Attachment 4 Property Plat Attachment 5 Directional Plan CD2-361 AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 2 of 21 Printed: 24-Mar-23 1. Well Name (Requirements of 20 AAC 25.005 (f)) The well for which this application is submitted will be designated as CRU CD2-361. 2. Location Summary (Requirements of 20 AAC 25.005(c)(2)) Location at Surface (CD2-361 Slot) 2,181‘ FNL, 1,770' FEL, Sec. 2, T11N, R4E, UM NAD27 Northings: 5,974,180 Eastings: 371,464 RKB Elevation 70.2’ AMSL Pad Elevation 15.7’ AMSL Location at Productive Horizon (Heel) 5,218' FNL, 950' FEL, Sec. 16, T12N, R4E, UM NAD27 Northings: 5,981,348 Eastings: 369,237 Measured Depth, RKB: 20,233’ Total Vertical Depth, RKB: 7,103’ Total Vertical Depth, SS: 7,031’ Location at Total Depth (Toe) 1,726' FNL, 635' FEL, Sec. 8, T12N, R4E, UM NAD27 Northings: 6,001,296 Eastings: 357,198 Measured Depth, RKB: 35,306’ Total Vertical Depth, RKB: 7,198’ Total Vertical Depth, SS: 7,126’ Requirements of 20 AAC 25.050(b) Please see Attachment 4: CD2-361 wp08 (ST) Directional Plan The Applicant is the only affected owner. 3. Blowout Prevention Equipment Information (Requirements of 20 AAC 25.005(c)(3)) Please reference BOP and diverter schematics on file for Doyon 26. AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 3 of 21 Printed: 24-Mar-23 4. Drilling Hazards Information (Requirements of 20 AAC 25.005 (c)(4)) The following shows the calculation results of anticipated surface pressure (ASP) while drilling this well: Casing Size (in) Casing Set Depth MD/TVD (ft) Fracture Gradient (ppg) Pore Pressure (psi) ASP Drilling (psi) 30 150 / 150 10.9 60 64 20 2,478 / 2,411 12.5 1,061 1,326 17 6,404 / 4,407 13.0 1,939 1,929 13-5/8 12,599 / 5,681 13.2 2,500 2,413 9-7/8 18,468 / 6,896 13.2 3,103 3,479 7 5/8 20,445/ 7,134 15.7 4,192 3,510 5-1/2 35,306/ 7,198 14.4 4,229 N/A PROCEDURE FOR CALCULATING ANTICPATED SURFACE PRESSURE (ASP) ASP is determined as the lesser of 1) surface pressure at breakdown of the formation casing seat with a gas gradient to the surface, or 2) formation pore pressure at the next casing point less a gas gradient to the surface as follows: 1) ASP = [(FG x 0.052) - 0.1] x D Where: ASP = Anticipated Surface pressure in psi FG = Fracture gradient at the casing seat in lb/gal 0.052 = Conversion from lb/gal to psi/ft 0.1 = Gas gradient in psi/ft D = true Vertical depth of casing seat in ft RKB OR 2) ASP = FPP – (0.1 x D) Where: FPP = Formation Pore Pressure at the next casing point FPP = 0.44psi/ft x TVD above HRZ & 0.45psi/ft below HRZ unless otherwise specified (A) ASP Calculations Per Interval 1. Drilling Below 30” Conductor: ASP = [(FG x 0.052) – 0.1] x D = [(12.5x 0.052) – 0.1] x 135 = 64psi OR ASP = FPP – (0.1 x D) = 1,059 – (0.1 x 2,411) = 820psi 2. Drilling Below 20” Surface Casing ASP = [(FG x 0.052) – 0.1] x D = [(12.5 x 0.052) – 0.1] x 2,411’ = 1,326psi OR ASP = FPP – (0.1 x D) = 1,939 – (0.1 x 4407’) = 1,498psi AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 4 of 21 Printed: 24-Mar-23 3. Drilling Below 17” Intermediate 1 Drilling Liner ASP = [(FG x 0.052) – 0.1] x D = [(13.2 x 0.052) – 0.1] x 4,407’ = 2,533psi OR ASP = FPP – (0.1 x D) = 2,500 – (0.1 x 5,681’) = 1,932psi 4. Drilling Below 13-5/8” Intermediate 2 Production Liner ASP = [(FG x 0.052) – 0.1] x D = [(13.2 x 0.052) – 0.1] x 5,681 = 3,507psi OR ASP = FPP – (0.1 x D) = 3,103 – (0.1 x 6,896) = 2,413psi 5. Drilling Below 9-7/8” Intermediate 3 Production Liner ASP = [(FG x 0.052) – 0.1] x D = [(15.7 x 0.052) – 0.1] x 6,896 = 4,940psi OR ASP = FPP – (0.1 x D) = 4,192 – (0.1 x 7,134) = 3,479psi NOTE: 11.3ppg Kuparuk C Pressure 6. Drilling Below 7-5/8” Intermediate 3 Production Liner ASP = [(FG x 0.052) – 0.1] x D = [(14.4 x 0.052) – 0.1] x 7,137 = 4,628psi OR ASP = FPP – (0.1 x D) = 4,229 – (0.1 x 7198) = 3,510psi NOTE: 11.3ppg Kuparuk C Pressure (B) data on potential gas zones; The well bore is not expected to penetrate any hydrates nor gas zones. (C) data concerning potential causes of hole problems such as abnormally geo-pressured strata, lost circulation zones, and zones that have a propensity for differential sticking; Please see Attachment 2 - Drilling Hazards Summary 5. Procedure for Conducting Formation Integrity Tests (Requirements of 20 AAC 25.005 (c)(5)) Drill out casing or liner shoe and perform LOT test or FIT in accordance with the COP ERD LOT / FIT procedure that ConocoPhillips Alaska has on file with the Commission. () NOTE: 11.3ppg Kuparuk C Pressure ()p NOTE: 11.3ppg Kuparuk C Pressure AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 5 of 21 Printed: 24-Mar-23 6. Casing and Cementing Program (Requirements of 20 AAC 25.005(c)(6)) Casing and Cementing Program Csg/Tbg OD (in) Hole Size (in) Weight (lb/ft) Grade Conn. Length (ft) Top MD/TVD (ft) Btm MD/TVD (ft) Planned Cement Program 30 56 328 X65 Welded 80 54.5 / 54.5 135 / 135 Cemented to Surface with 13 yds slurry 20 24 133.0 L-80 Hydril W563 2,425 53 / 53 2,478 / 2,411 Cement to Surface with 2,655 sx DeepCRETE Lead at 11.0ppg, 836 sx Class G Tail at 15.8ppg 17 17-1/2 x 20 88.1 P-110 IC Hydril W521 4,085 2,319 / 2,264 6,404 / 4,407 1,219 sx Extended Class G Lead at 11.0ppg 471 sx Class G Tail at 15.8ppg 13-5/8 14-3/4 x 17-1/2 88.2 L-80 IC Hydril W563 12,548 52 / 52 12,599 / 5,681 1,219 sx Class G Tail at 15.8ppg 9-7/8 12-1/4 x 13-1/2 62.8 L-80 Hydril W563 6,045 12,423 / 5,645 18,468 / 6,896 1,034 sx Class G Tail at 15.8ppg 7-5/8 8-½ x 10-1/4 29.7 L-80 Hydril W523 2,342 18,103 / 6,820 20,445 / 7,134 293 sx Class G Tail at 15.8ppg 5 n/a 24.1 L-80 Hydril W563 4,977 46 / 46 5,023 / 4,088 N/A – Upper Part of Tapered Upper Completion Tubing String 4-1/2 n/a 12.6 L-80 Hydril W563 15,218 5,023 / 4,088 20,241 / 7,126 N/A – Lower Part of Tapered Upper Completion Tubing String 4-1/2 6-3/4 12.6 L-80 Hydril W563 15,065 20,241 / 7,126 35,306 / 7,198 N/A – Uncemented Open Hole Liner w/ Pre-Perforated Pup Joints 7. Diverter System Information (Requirements of 20 AAC 25.005(c)(7)) CPAI requests a variance to the diverter requirement under 20 AAC 25.035 (h)(2) be granted. CD2-361 meets the requirements as outlined below: 1. The well is a development well drilled by Doyon 26 from an existing drill site. a. CD2-361 is a development well being drilled by Doyon 26 from CD2. 2. At least one previously drilled borehole has penetrated the horizontal circle with a radius of 500 feet centered on the proposed location of the surface casing shoe of the well to be drilled. a. There are eight wells within a 500’ radius of the proposed CD2-361 surface shoe at 2,466’ MD: CD2-162 (~61’), CD2-32 (~311’), CD2-25 (~317’), CD2-22 (~388’), CD2-33 (~392’), CD2-23 (~468’), CD2-17 (~487’), and CD2-46 (~492’). 3. There have been no significant gas shows or well control events while any borehole was drilled to the depth of the surface casing shoe within the 500-foot radius circle. a. There are fifty-three wells within a 500’ radius across the CD2-361 surface hole interval. There have been no significant indications of shallow gas or gas hydrates while drilling from CD2 pad including on CD2-162 where a surface hole was drilled to 4,011’ TVD in 2019. AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 6 of 21 Printed: 24-Mar-23 8. Drilling Fluid Program (Requirements of 20 AAC 25.005(c)(8)) Surface Intermediate #1 Intermediate #2 Intermediate #3 Intermediate #4 Production Hole Size in 24 17-1/2 x 20 14-3/4 x 17- 1/2 12-1/4 x 13-1/2 8-1/2 x 10 1/4 8-1/2 Casing Size in 20 17 13-5/8 9-7/8 7-5/8 5-1/2 Density ppg 9.5 – 10.0 10.5 – 11.0 10-11 10.5 – 12.2 11-12.5 10.5 – 12.2 PV cP 9 – 10 12 – 13 9-10 13 – 21 20-30 11 YP lb./ 100 ft2 45 – 50 25 – 40 25 – 40 20 – 30 30-40 15 - 25 Initial Gels lb./ 100 ft2 46 14 15 10 10 7 10 Minute Gels lb./ 100 ft2 48 15 25 23 13 8 API Fluid Loss cc/ 30 min N.C. – < 10.0 4 – 12 2 – 10 < 6 < 6 < 6 pH 11.0 9.0 – 10.0 9.0 – 10.0 9.0 – 10.5 9.0-10.5 9.0 – 9.5 Surface Hole: The Surface interval will be drilled with a mixed-metal oxide freshwater drilling fluid (DRILPLEX WBM). Keep flow line viscosity at r 200 sec/qt while drilling and running casing. Reduce viscosity prior to cementing. Maintain mud weight 10.0ppg through the base of Permafrost and increase to 10.0ppg prior to TD. Control LGS using solids control system and dilutions where necessary. Intermediate #1: The Intermediate 1 interval will be drilled with a fresh water gel / polymer drilling fluid (LSND WBM). Ensure good hole cleaning by maximizing fluid annular velocity and rotary speed. Maintain mud weight from 10.5 – 11.0ppg for shallow instability and be prepared to add loss circulation material or weight-up as needed for actual Qannik pore pressure. Good filter cake quality, hole cleaning and maintenance of low gravity drill solids (by diluting as required) will all be important in maintaining good hole conditions. Intermediate #2: The Intermediate 2 interval will be drilled with a fresh water gel / polymer drilling fluid (LSND WBM). Ensure good hole cleaning by maximizing fluid annular velocity and rotary speed. Maintain mud weight from 10.5 – 11.0ppg for instability. MPD maybe used to prevent cycling on the formation. Good filter cake quality, hole cleaning and maintenance of low gravity drill solids (by diluting as required) will all be important in maintaining good hole conditions. Intermediate #3: The Intermediate 3 interval will be drilled with fresh water gel / polymer drilling fluid (LSND WBM) to properly condition the hole for the floated liner run. Ensure good hole cleaning by maximizing fluid annular velocity and adjusting drilling parameters. Condition the mud using dilutions as required to maintain low gravity drill solids. Weight-up to 11.0-11.5ppg at TD and adjust tripping parameters to ensure clean hole prior to floating the 9-7/8” liner to bottom. MPD will used on this hole section to minimize cycling and improve instability. 10.5 – 12.2 AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 7 of 21 Printed: 24-Mar-23 Intermediate #4: The Intermediate 4 interval will be drilled with an synthetic based mud (NAF SBM) to mitigate wellbore instability and to properly condition the hole for the floated liner run. Ensure good hole cleaning by maximizing fluid annular velocity. There is potential for lost circulation so ensure adequate LCM material is available on location to address any unexpected losses. Good filter cake quality, hole cleaning, and maintenance of low gravity drill solids (by diluting as required) will all be important in maintaining good hole conditions. Mitigate wellbore instability with MPD targeting ~13.2ppg EMW and Lower Shale specific mud additives. Weight-up as needed at 9 7/8” shoe to the greater of 13.0-13.2ppg EMW for wellbore instability mitigation or as needed for Kuparuk C pore pressure. Production Hole: The Production interval will be drilled with a water-based drill-in fluid (FLO-PRO WBM) weighted appropriately so that MPD can provide a dynamic overbalance of ~11.7ppg EMW while reducing the risk of lost circulation created by high ECDs. There is potential for lost circulation so ensure adequate LCM material is available on location to address any losses. There is a potential for abnormal pressure so ensure adequate weighting material is on location to weight-up as needed. Kill-weight brine will be placed in the well prior to pulling out of hole. Please reference pit diagram on file for Doyon 26. All drilling fluid practices will be in accordance with appropriate regulations stated in 20 AAC 25.033. 9. Abnormally Pressured Formation Information (Requirements of 20 AAC 25.005 (c)(9)) N/A - Application is not for an exploratory or stratigraphic test well. 10. Seismic Analysis (Requirements of 20 AAC 25.005 (c)(10)) N/A - Application is not for an exploratory or stratigraphic test well. 11. Seabed Condition Analysis (Requirements of 20 AAC 25.005 (c)(11)) N/A - Application is not for an offshore well. 12. Evidence of Bonding (Requirements of 20 AAC 25.005 (c)(12)) Evidence of bonding for ConocoPhillips Alaska, Inc. is on file with the Commission. This wellbore. SFD 3/24/2023 AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 8 of 21 Printed: 24-Mar-23 13. Proposed Drilling Program (Requirements of 20 AAC 25.005 (c)(13)) The proposed drilling program is listed below. Please refer to Completion Schematic. 1. MIRU Doyon 26 onto CRU CD2-361 over pre-installed 30” x 48” insulated conductor. 2. Dewater cellar, rig-up riser, & test same. 3. Pick-up enough 6-5/8” VX69 drill pipe to drill SURF section and rack-back. 4. Make-up 24” Conductor Clean-Out BHA. Clean-out conductor. 5. Make-up 24” SURF Drilling BHA (LMWD Program: GR/DIR), spud well, & directionally-drill 24” hole to SURF TD estimated at 2,478’ MD / 2,411’ TVD top-setting the C-30 and as per the directional plan. 9.5 – 10ppg DRILPLEX WBM will be used to drill the section. 6. Circulate & condition, flow-check well, and POOH. Lay-down SURF Drilling BHA. 7. Run new 20” 133# L-80 TNS-ER SURF casing centralized as per design to section TD. Circulate & condition, land casing on hanger within wellhead, and back-off upper half of landing joint. 8. Pick-up & TIH with the SURF Inner String BHA, stab into the inner string float collar, and establish circulation. 9. Cement the 20” SURF casing to surface as per the cement program with 500’ of 15.8ppg Class G tail and 11.0ppg DeepCRETE lead to surface. Bump inner string darts, bleed pressure, & check floats. a. CONTINGENCY: If cement is not brought to surface, notify AOGCC and prepare for top job. 10. Flow check well, N/D flow riser & N/U HP Riser & BOPE with the following equipment/configuration: a. 18-5/8” Annular / Upper 4-1/2” x 7-5/8” VBR / Blind/Shear Ram / Lower 4-1/2” x 7-5/8” VBR 11. Test BOPE to 250psi low / 4,000psi high. Test annular to 250psi low / 2,500psi high. (Provide 48 hr. AOGCC notice) 12. Pick-up & TIH with the 17-1/2” x 20” INTRM1 Drilling BHA (LMWD Program: GR/RES/DIR). a. CONTINGENCY: If unable to clean-out SURF casing shoe track with INTRM1 Drilling BHA, drill out SURF casing shoe track with dedicated SURF Casing Clean-Out BHA and perform FIT. 13. Chart 20” SURF casing pressure test to 3,000psi for 30 minutes. 14. Drill-out shoe track, 24” rathole, and 20’ of new hole. Circulate & condition. 15. Perform FIT to minimum 11.5ppg EMW. 16. Displace well to 10.5ppg LSND WBM. 17. Directionally drill 17-1/2” INTRM1 Pilot Hole until the underreamer is below the 20” SURF Casing Shoe and open the underreamer. 18. Directionally drill 17-1/2” x 20” INTRM1 Hole past the Base Qannik. Circulate a minimum 1x bottom’s up and flow check the well to determine if additional overbalance is needed. 19. Directionally drill 17-1/2” x 20” INTRM1 Hole to INTRM1 TD at 6,404’ MD / 4,407’ TVD as per the directional plan. Circulate & condition while weighting up as needed for a trip margin. 20. Observe well for flow while rotating at 20 rpm to avoid differential sticking. 21. POOH and lay-down the 17-1/2” INTRM1 Drilling BHA. 22. Change Upper 4-1/2” x 7-5/8” VBRs to 17” Solid-Body Rams. Test same to 250psi low / 3,000psi high. (Provide 48 hr. AOGCC notice) 23. Run new 17” 88.1# P-110 IC TSH-521 liner centralized as per design. Circulate & condition prior to exiting the SURF Casing Shoe and again before making-up the Liner Hanger. 24. M/U the 17” x 20” INTRM1 Liner Hanger / Running Tool Assembly and TIH with the 17” INTRM1 liner to above rat hole. Once there, circulate & condition as needed in preparation for the cement job. 25. Cement the 17” INTRM1 liner with sufficient 13.5ppg Extended Class G led to provide 500’ isolation above the Top Qannik and C10 and a 500’ 15.8ppg tail to tack the 17” INTRM1 Liner Shoe. Bump plugs to 500psi over circulating pressure, bleed pressure, & check floats. a. CONTINGENCY: If cement is not circulated above the Qannik and C10, drill, case, cement INTRM2. Intrm 1 is a drilling liner and will be covered by Intrm 2 long string. 26. Set the 17” x 20” TIW XPAK Liner Hanger. Perform overpull test to confirm hanger set. AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 9 of 21 Printed: 24-Mar-23 27. Perform Liner-Top test to 1,000psi. 28. Pick-up to release running tools from Liner Hanger. Circulate & condition. Flow-check well. 29. TOH on elevators. Lay-down INTRM1 Liner Running Tools. 30. Change 17” Solid-Body Rams back to 4-1/2” x 7-5/8” VBRs. Test same to 250 / 3,000psi. (Provide 48 hr. AOGCC notice) 31. Pick-up & TIH with 15-3/4” INTRM1 Clean-Out BHA to the 17” INTRM1 Liner top. 32. Circulate & condition, drill-out pack-off bushing below Liner Hanger, circulate bottom’s up, and continue TIH. 33. Chart 20” casing x 17” liner pressure test to 3,000psi for 30 minutes. 34. Drill-out shoe track, 17-1/2” x 20” rathole, and 20’ of 15 ¾” new hole. Circulate & condition. 35. Perform FIT to minimum 11.5ppg EMW. 36. Circulate & condition, observe well for flow, and TOH. Lay-down the 15-3/4” INTRM1 Clean-Out BHA. 37. Pick-up & TIH with 14-3/4” x 17-1/2” INTRM2 Drilling BHA to the 17” INTRM1 Liner Shoe (LMWD Program: GR/RES/DIR). 38. Displace the well to 10.5ppg LSND WBM. 39. Open underreamer and directionally-drill 15-3/4” x 17-1/2” INTRM2 hole to TD at 12,599’ MD. a. This hole section is the upper part of the original 5 string INT2 hole section, the drilling/tripping out time is estimated to be over 14 days. To avoid the high risk of stuck pipe, ConocoPhillips is requesting to continue the approved Event Based BOP testing schedule from original INT2. Perform full BOP test once BHA out of hole. 40. POOH and lay-down 15-3/4” x 17-1/2” INTRM2 Drilling BHA. 41. Change Upper 4-1/2” x 7-5/8” VBRs to 13-5/8” Solid-Body Rams. Test same to 250psi low / 3,000psi high. (Provide 48 hr. AOGCC notice) 42. Float new 13-5/8” 88.2# L-80 IC TSH-563 INTRM2 Casing centralized as per design to TD; attempt to run on elevators and rotate only if needed to move past a ledge or to break axial friction. 43. Circulate & condition in preparation for the cement job. 44. Cement the 13-5/8” INTRM2 liner with sufficient 15.8ppg Class G to tack the INTRM2 casing shoe with 250’ TVD slurry. 45. Install pack off and displace the 13-5/8” x 17” x 20” annulus to corrosion-inhibited seawater and diesel freeze- protect. 46. Change 13-5/8” solid body rams back to 4-1/2” x 7-5/8” VBRs. Test same to 250 / 4,000psi. (Provide 48 hr. AOGCC notice) 47. Pick-up & TIH with 12-1/4” x 13-1/2” INTRM3 Drilling BHA (LMWD Program: GR/RES/NEU/DEN/DIR). 48. Chart 13-5/8” INTRM2 casing pressure test to 4,000psi for 30 minutes. 49. Drill-out shoe track, 14-3/4” x 17-1/2” rathole, and 20’ of new 12-1/4” hole. 50. Perform FIT to minimum 13.0ppg EMW. 51. Displace well to 11.0ppg LSND WBM. 52. Directionally drill 12-1/4 x 13-1/2” new INTRM3 hole to TD 10’ TVD below the Top HRZ estimated at 18,468’ MD / 6,896’ TVD. a. This hole section is the lower part of the original 5 string INT2 hole section, the drilling/tripping out time is estimated to be over 14 days. To avoid the high risk of stuck pipe, ConocoPhillips is requesting to continue the approved Event Based BOP testing schedule from original INT2. Perform full BOP test once BHA out of hole. 53. Circulate & condition hole while weighting-up to 11.5ppg. Observe well for flow. 54. POOH and lay-down 12-1/4 x 13-1/2” INTRM3 Drilling BHA. 55. Change Upper 4-1/2” x 7-5/8” VBRs to 9-7/8” Solid-Body Rams. Test same to 250psi low / 4,000psi high. (Provide 48 hr. AOGCC notice) AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 10 of 21 Printed: 24-Mar-23 56. Float 9-7/8” 62.8# L-80 TSH-563 new INTRM3 Liner centralized as per design to TD. Cement the same with 15.8ppg Class G to 250’ TVD above the shoe. 57. Set the Liner Hanger. Test the backside to 1,000 psi for integrity. 58. POOH and L/D liner hanger running tool. 59. Change Upper back to 4-1/2” x 7-5/8” VBRs. Test same to 250psi low / 4,000psi high. (Provide 48 hr. AOGCC notice) 60. Pressure tests the 9-7/8” liner and 13-5/8” casing to 3,500psi for 30 minutes. 61. Pick-up & TIH with 8-1/2” x 10-1/4” INTRM4 Drilling BHA (LMWD Program: GR/RES/NEU/DEN/DIR). 62. Displace well to 11.5ppg NAF SBM. 63. Drill-out shoe track and 20’ of new hole. Perform FIT to minimum 11.1ppg EMW. 64. Directionally drill 8-1/2” x 10-1/4” hole to section TD within the Fiord West Kuparuk C at 20,445’ MD / 7,134’ TVD using MPD to target 12.3ppg EMW at 7,250’ TVD. 65. SOOH to 9 7/8” shoe. 66. Circulate & weight up the mud to 13.1ppg kill-weight NAF SBM. 67. Flow check, SOOH, and lay-down 8-1/2” x 10-1/4” Drilling BHA. 68. Run new 7-5/8” 29.7# L-80 TSH-523 INTRM3 Liner to TD. 69. Cement the 7-5/8” liner with 15.8ppg tail Class G to 250’ TVD above the top of Kuparuk C reservoir. 70. Set liner hanger and perform 1,000 psi back pressure test. 71. POOH and L/D liner hanger running tool. 72. Pressure test 13-5/8” x 9-7/8” x 7-5/8” Liner pressure test to 3,500psi for 30 minutes. 73. Pick-up & TIH with 6-3/4” PROD Drilling Assembly (LMWD Program: GR/RES/NEU/DEN/DIR). 74. Displace well to new 11.1ppg FLO-PRO WBM. 75. Drill out shoe track, 8-1/2” x 10-1/4” rat hole, and 20’ of new hole. Perform FIT to minimum of 13.5ppg EMW. 76. Directionally drill 6-3/4" hole to the 25,966’ MD. Due to reservoir uncertainty SOOH to 23,875’ MD and perform an open hole sidetrack within the Kuparuk C. 77. Directionally drill 6-3/4” hole Production TD at 35,306’ MD geo-steering to stay within the Kuparuk C while using MPD to target 11.7 EMW at 7 5/8” Shoe. 78. Circulate & condition. BROOH to the 7-5/8” INTRM3 liner shoe and further as needed to clean up the well. 79. Strip-in back to bottom. 80. Circulate & condition, displace well to kill-weight brine, flow check, & TOH. Lay-down 6-3/4” PROD Drilling BHA. 81. Run new 4-1/2” 12.6# L-80 TSH 563 Liner with pre-perforated pups centralized as per design. 82. Pick-up the 7 5/8” x 5-1/2” Liner Hanger / Packer with Running Tool Assembly to the Rig Floor. Make-up to the liner hanger. 83. TIH with 4-1/2” PROD Liner; rotate as needed to reduce axial friction and run to TD. Circulate as needed through the open circulation sub. 84. With the liner on bottom, set the liner top packer as per equipment specs. 85. Release running tools, perform ~1,000psi liner-top test to confirm packer & liner barrier integrity. 86. TOH on elevators. Lay-down PROD Liner Running Tools. 87. Run 5” x 4-1/2” Upper Completion with smart gas lift mandrels. Space out, pick-up, & with the annular closed on landing string, spot diesel freeze-protect. Land tubing hanger & pressure-up to set packer. Confirm connectivity to smart GLMs. 88. Install BPV and pressure test hanger seals to 5,000psi, chart test. 89. Nipple down BOPE. 90. Install tubing head adapter assembly and tree. Pressure-test same to 5,000psi, chart test. Remove BPV. performy, an open hole sidetrack within the Kuparuk C. (LMWD Program: GR/RES/NEU/DEN/DIR) Planned KOP 23,875' MD. SFD 3/24/2023 AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 11 of 21 Printed: 24-Mar-23 91. Test tubing and tubing-casing annulus separately to 3,500psi / 30 mins, chart tests. 92. Shear circulation valve in GLM. Circulate tubing to diesel & freeze-protect annulus. 93. Set BPV and secure well. RDMO Doyon 26. 94. POST RIG – Ops a. Pressure-up to convert flotation barrier disk & unload well. 14. Discussion of Mud and Cuttings Disposal and Annular Disposal (Requirements of 20 AAC 25.005 (c)(14)) Incidental fluids developed from CD2-361 drilling operations will be hauled to the Alpine Grind & Inject Facility and injected into the dedicated Class 1 disposal well CD1-01A on CD1 Pad. Because of the 17” Intermediate 1 Liner Hanger blocking the 20” Surface Casing Shoe, CD2-361 is not a candidate for future annular disposal. 15. Attachments Attachment 1 Cement Summary Attachment 2 Drilling Hazards Summary Attachment 3 Completion Schematic Attachment 4 Directional Plan AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 12 of 21 Printed: 24-Mar-23 Attachment 1 – Cement Summary AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 13 of 21 Printed: 24-Mar-23 20” Surface Casing to 2,478’ MD / 2,411’ TVD Cement from 2,478’ to 1,978' MD (500’) with 15.8ppg Class G tail and from 1,978' to surface with 11.0ppg DeepCRETE lead. Assume 250% excess annular volume in Permafrost, 50% excess below the Permafrost, and no excess within the 30” conductor. Lead Slurry from 1,978’ MD to Surface with 11.0ppg DeepCRETE Conductor (135’ – 55’) X 2.0625 ft3/ft X 1.0 (0% excess) = 165 ft3 Permafrost to Conductor (1,308’ – 135’) X 0.9599 ft3/ft X 3.5 (250% excess) = 3,942 ft3 Top of Tail to Permafrost (1,978’ – 1,308’) X 0.9599 ft3/ft X 1.5 (50% excess) = 965 ft3 Total Volume = 165 + 3,942 + 965 = 5,072 ft3 => 2,655 sx of 11.0ppg DeepCRETE @ 1.91 ft3 /sk Tail Slurry from 2,478’ MD to 1,978’ MD with 15.8ppg Class G + additives Shoe to Top of Tail (2,478’ – 1,978) X 0.9599 ft3/ft X 1.50 (50% excess) = 720 ft3 Shoe Joints (130’) X 1.9134 ft3/ft X 1.00 (0% excess) = 249 ft3 Total Volume = 720 + 249 = 969 ft3 => 836 sx of 15.8ppg Class G + additives @ 1.16 ft3/sk 17” Intermediate 1 Liner to 6,404’ MD / 4,407’ TVD Cement from 6,404’ to 5,904’ MD (500’) with 15.8ppg Class G tail and from 5,904’ to 500’ MD above the top of the C10 with 11.0ppg Extended Class G lead assuming 20% excess annular volume. Lead Slurry from 5,904’ MD to 2,700’ MD with 11.0ppg Extended Class G + additives Top of Tail to 500’ MD Above C10 Top at 3,200’ MD (5,904’ – 2,700’) X 0.6054 ft3/ft X 1.20 (20% excess) = 2,328 ft3 Total Volume = 2,328 ft3 => 1,219 sx of 11.0ppg Extended Class G + additives @ 1.91 ft3/sk Tail Slurry from 6,404’ MD to 5,904’ MD with 15.8ppg Class G + additives Shoe to Top of Tail (6,404’ – 5,904’) X 0.6054 ft3/ft X 1.20 (20% excess) = 363 ft3 Shoe Joints (131’) X 1.3963 ft3/ft X 1.00 (0% excess) = 183 ft3 Total Volume = 363 + 183 = 546 ft3 => 471 sx of 15.8ppg Class G + additives @ 1.16 ft3/sk AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 14 of 21 Printed: 24-Mar-23 13-5/8” Intermediate 2 Casing to 12,599’ MD / 5,681’ TVD Cement from 12,599’ to 250’ TVD above liner shoe with 15.8ppg Class G assuming 30% excess annular volume. Cement from 12,599’ MD to 11,398’ MD with 15.8ppg Class G + additives Shoe to Top of Cement (12,599’ – 11,398’) X 0.6578 ft3/ft X 1.30 (30% excess) = 1,027 ft3 Shoe Joint (207’) X 0.8353 ft3/ft X 1.00 (0% excess) = 173 ft3 Total Volume = 1,027 + 173 = 1,200 ft3 => 1,034 sx of 15.8ppg Class G + additives @ 1.16 ft3/sk 9-7/8” Intermediate 3 Liner to 18,468’ MD / 6,896’ TVD Cement from 18,468’ to 250’ TVD above the shoe with 15.8ppg Class G assuming 30% excess annular volume. Cement from 18,468’ MD to 17,260’ MD with 15.8ppg Class G + additives Shoe to Top of Cement (18,468’ – 17,260’) X 0.4622 ft3/ft X 1.30 (30% excess) = 725 ft3 Shoe Joint (167’) X 0.4057 ft3/ft X 1.00 (0% excess) = 68 ft3 Total Volume = 725 + 68 = 794 ft3 => 684 sx of 15.8ppg Class G + additives @ 1.16 ft3/sk 7-5/8” Intermediate 4 Liner to 20,445’ MD / 7,134’ TVD *Due to high angle and short open hole section the required 250’ TVD TOC is above our liner hanger and in the shoe of the 9 7/8” casing. This is a high risk as our liner hanger is set against the plugs. If the plugs don’t bump we have to wait on cement. Intrm 4 is a drilling liner. A cement Intrm 3 shoe and Intrm 4 packer test provide isolation of the formation. COP request to use the 1,000’MD (ࡱ 2/3 open hole volume). Cement from 20,445’ MD to 19,445’ MD with 15.8ppg Class G + additives Shoe to Top of Cement (20,445’ – 19,445’) X 0.2559 ft3/ft X 1.15 (15% excess) = 295 ft3 Shoe Joint (167’) X 0.2578 ft3/ft X 1.00 (0% excess) = 44 ft3 Total Volume = 295 + 68 = 339 ft3 => 293 sx of 15.8ppg Class G + additives @ 1.16 ft3/sk AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 15 of 21 Printed: 24-Mar-23 Attachment 2 – Drilling Hazards Summary (To be posted in Rig Floor Doghouse Prior to Spud) 24" Hole / 20” Casing Interval Event Risk Level Mitigation Strategy Conductor Broach Low Monitor cellar continuously during interval. Well Collision High Closely monitor traveling cylinder, update as needed. Utilize gyro equipment as needed to verify wellbore location. Closely follow CPAI Anti- Collision policies. Shut-in offset wells as required. Rig-up diverter for collision risk mitigation. Gas Hydrates Low Diverter drills and if observed – control drill, reduce pump rates and circulating time, reduce mud temperatures. Shallow hazard study noted minimal risk on CD2 pad. Abnormal Pressure in Surface Formations Low Diverter drills, increased mud weight. Shallow hazard study noted minimal risk on CD2 pad. Abnormal Pressure in C- 30 (CD2 Annular Injection) Low Top-set C-30 formation. No annular injection performed on pad since 2012 nor abnormal pressure encountered in C-30 on CD2-162 (2019). Clay Balling High Maintain planned mud parameters and flow rates. Use proactive anti-balling sweeps and mud product additions. Lost Circulation Low Reduce pump rates, mud rheology, add lost circulation material, & control pipe running speeds. 17-1/2” x 20” Hole / 17” Liner Interval Event Risk Level Mitigation Strategy Lost Circulation Medium Reduce pump rates, reduce trip speeds, monitor real time ECDs, adjust mud rheology, and add lost circulation material as needed. Abnormal Pressure in Qannik High Employ Qannik Pressure Management Plan. Perform well control drills, flow check as needed, MPD fingerprint if possible, increase mud weight. Abnormal Pressure in Overburden Formations Low Perform well control drills, check for flow during connections, and increase mud weight as needed. Hole Cleaning Low Monitor ECD and torque/drag trends, control drill and use best hole cleaning practices, and backream to clean hole prior to liner run. Swabbing on Trips Medium Reduce trip speeds, condition mud properties, monitor hole fill, pump out of hole, monitor real time ECDs, and use MPD if possible. Differential Sticking Medium Monitor for seepage losses, monitor static T&D forces, run LCM as needed, and employ proper centralization to provide semi-flush liner stand-off. Qannik Cement Isolation Medium Centralize for > 70% Stand-Off, use Lead / Tail slurry design to reduce ECDs, create mud / spacer / slurry train to allow effective displacement, and be prepared for liner top squeeze contingency. AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 16 of 21 Printed: 24-Mar-23 14-3/4” x 17-1/2” Hole / 13-5/8” Liner Interval Event Risk Level Mitigation Strategy Hole Cleaning Low Monitor ECD and torque/drag trends, control drill, use best hole cleaning practices, and backream to clean hole prior to liner run. BHA Failure Medium Proactively plan BHA trip to allow for tool wear evaluation and monitor shock and vibration. Lost Circulation Medium Reduce pump rates, reduce trip speeds, real time ECD monitoring, mud rheology, add lost circulation material as needed. Casing Wear Medium Model previous liner casing wear, have NRDPPs available, & use CPAI casing wear best practices. Stuck Pipe Medium Use good drilling practices, monitor T&D trends, run BHA disconnect sub if necessary, have fishing kit pre-identified. Differential Sticking Medium Monitor for seepage losses, run LCM as needed, monitor static T&D forces, centralize liner as needed to prevent differential sticking. Floated Liner Run High Employ CD2-162 and CD2-310 Lessons Learned, implement flotation-specific well control drills, & use floated liner decision tree for issues encountered. 12-1/4” x 13-1/2” Hole / 9-7/8” Liner Interval Event Risk Level Mitigation Strategy Hole Cleaning Low Monitor ECD and torque/drag trends, control drill, use best hole cleaning practices, and backream to clean hole prior to liner run. BHA Failure Medium Proactively plan BHA trip to allow for tool wear evaluation and monitor shock and vibration. Lost Circulation Medium Reduce pump rates, reduce trip speeds, real time ECD monitoring, mud rheology, add lost circulation material as needed. Casing Wear Medium Model previous liner casing wear, have NRDPPs available, & use CPAI casing wear best practices. Stuck Pipe Medium Use good drilling practices, monitor T&D trends, run BHA disconnect sub if necessary, have fishing kit pre-identified. Differential Sticking Medium Monitor for seepage losses, run LCM as needed, monitor static T&D forces, centralize liner as needed to prevent differential sticking. Floated Liner Run High Employ CD2-162 and CD2-310 Lessons Learned, implement flotation-specific well control drills, & use floated liner decision tree for issues encountered. AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 17 of 21 Printed: 24-Mar-23 8-1/2” x 10-1/4” Hole / 9-7/8” Liner Interval Event Risk Level Mitigation Strategy Wellbore Instability High Isolated instable shales with dedicated hole section, employ CD2-162 and CD2-310 instability mitigations (underreamer, proper EMW to prevent shear failure, MPD, & inhibited fluid), monitor real- time drilling data. Use CPAI Lower Shale instability mitigation drilling best practices. Lost Circulation High Reduce pump rates, reduce trip speeds, real time ECD monitoring, mud rheology, add lost circulation material as needed. Use MPD to reduce ECDs. Abnormal Reservoir Pressure High Well control drills, flow check during connections, use MPD to fingerprint / provide dynamic overbalance, increase mud weight as needed to maintain overbalance during tripping activities. Landing in Thin Kuparuk C High Use CD2-162 and CD2-310 data to reduce depth uncertainty. Use Ultra-Deep Azimuthal Resistivity to identify Kuparuk C and assist with adjusting landing. Swabbing on Trips Medium Reduce trip speeds, condition mud properties, proper hole filling, pump out of hole, real time ECD monitoring, & use MPD if possible. Cement around liner hanger from 250’TVD regualtion High Due to high angle and short open hole section the required 250’ TVD TOC is above our liner hanger and in the shoe of the 9 7/8” casing. This is a high risk as our liner hanger is set against the plugs. If the plugs don’t bump, we have to wait on cement. Reduce cement column to 1,000’MD or 2/3 of the open hole volume. Barite Sag High Use ultra-fine barite to reduce sag risk. Employ barite sag mitigation best practices. 6-3/4” Hole / 4-1/2” Pre-Perforated Liner Interval Event Risk Level Mitigation Strategy Lost Circulation Medium Reduce pump rates, reduce trip speeds, real time ECD monitoring, mud rheology, add lost circulation material as needed. Use MPD to reduce ECDs. Abnormal Reservoir Pressure High Well control drills, flow check during connections, use MPD to fingerprint / provide dynamic overbalance, increase mud weight as needed to maintain overbalance during tripping activities. Staying in Kuparuk C High Use geosteering best practices from offset Nanuq Kuparuk C, use Deep Reading Azimuthal Resistivity tool to assist with reservoir interpretation, and create decision tree responding to for reservoir excursions. Wellbore Instability High Employ CD2-162 and CD2-310 instability mitigations (underreamer, proper EMW to prevent shear failure, MPD, & inhibited fluid), monitor real- time drilling data. Use CPAI Lower Shale instability mitigation drilling best practices. Barite Sag High Use weighted kill-weight brine for tripping operations. AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 18 of 21 Printed: 24-Mar-23 Swabbing on Trips Medium Reduce trip speeds, use weighted kill-weight brine to reduce swab pressure, monitor trip tanks, & use MPD if possible. Well Proximity Risks: CD2-361 will be the seventy-seventh (78th) well drilled on the pad. Directional drilling / collision avoidance information as required by 20 ACC 25.050 (b) is provided in the following attachments. Drilling Area Risks: Qannik & Kuparuk C Reservoir Pressure: Offset injection has the potential to increase the reservoir pressure. Heightened awareness and good well control practices will be used to prevent a well control scenario. If a well control scenario is encountered, well control drills will be used to reduce shut-in times and enough kill-weight material will be on location to kill the well as required. Weak Overburden Sand Stringers – Clean sand stringers from slope deposits were intermittently deposited on the slope shelves of the Torok and Albian. These clean sands have reduced fracture gradients relative to the silts and clays that make up most of the overburden. LCM material will be available to mitigate losses in the intermediate sections. Lower Shale Stability: The HRZ and Kalubik in the Intermediate #4 hole section will require higher mud weights than historically used to enhance wellbore stability. Managed Pressure Drilling will be used in conjunction with a 6-string casing design to mitigate HRZ & Kalubik shale instability. LCM material and well bore strengthening pills are expected to be effective in dealing with lost circulation as required to maintain sufficient overbalance for wellbore instability mitigation. For all sections, good tripping practices will be stressed to minimize the potential of taking swabbed kicks. Kuparuk C Reservoir Pressure: AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 19 of 21 Printed: 24-Mar-23 Attachment 3 –Completion Schematic AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 20 of 21 Printed: 24-Mar-23 Attachment 4 – Property Plat AOGCC Application for Permit to Drill, Well CRU CD2-361 Saved: 24-Mar-23 CRU CD2-361 AOGCC APD Page 21 of 21 Printed: 24-Mar-23 Attachment 5 – Directional Plan CD2-361 CD2-361 wp08 (ST) 23819 23850 23850 24000 24000 24200 24200 24400 CD2-361 wp08 (ST)Plan Summary 0 3 Dogleg Severity24000 26000 28000 30000 32000 34000 Measured Depth 4-1/2" Production Liner 60.0 60.0 120.0 120.0 0 90 180 270 30 210 60 240 120 300 150 330 Travelling Cylinder Azimuth (TFO+AZI) [°] vs Travelling Cylinder Separation [120 usft/in] 2385023900239502399924047 24094 24140 24184 24228 24269 24312CD2-361PB1 6000 6750 True Vertical Depth16000 18000 20000 22000 24000 26000 28000 30000 Vertical Section at 331.26° 7-5/8" Intermediate Casing 4-1/2" Production Liner 0 18 35 Centre to Centre Separation23800 23900 24000 24100 24200 24300 24400 24500 Measured Depth Equivalent Magnetic Distance DDI 7.860 SURVEY PROGRAM Date: 2022-11-07T00:00:00 Validated: Yes Version: Depth From Depth To Survey/Plan Tool 131.79 1294.54 CD2-361 Srvy 1 SDI_URSA1_I4 1356.61 2399.41 CD2-361 Srvy 2 MWD+IFR2+SAG+MS 2497.48 2497.48 CD2-361 Srvy 3 INC+TREND 2563.25 6358.44 CD2-361 Srvy 4 MWD+IFR2+SAG+MS 6425.05 6425.05 CD2-361 Srvy 5 INC+TREND 6517.38 12536.73 CD2-361 Srvy 6 MWD+IFR2+SAG+MS 12631.24 18362.63 CD2-361 Srvy 7 MWD+IFR2+SAG+MS 18461.52 18461.52 CD2-361 Srvy 8 INC+TREND 18497.67 20357.16 CD2-361 Srvy 9 MWD+IFR2+SAG+MS 20438.01 20438.01 CD2-361 Srvy 10 INC+TREND 20510.19 22086.32 CD2-361 Srvy 11 MWD+IFR2+SAG+MS 22147.43 23819.20 CD2-361 Srvy 12 MWD+IFR2+SAG+MS 23819.20 35306.33 CD2-361 wp08 (ST) (CD2-361) MWD+IFR2+SAG+MS Ground /15.50 CASING DETAILS TVD MD Name 7197.65 35306.33 4-1/2" Production Liner Mag Model & Date: BGGM2022 19-Jan-23 Magnetic North is 14.53° East of True North (Magnetic Declinatio Mag Dip & Field Strength: 80.60° 57177.19nT SECTION DETAILS Sec MD Inc Azi TVD +N/-S +E/-W Dleg TFace VSect Target Annotation 1 23819.20 89.98 314.21 7180.37 18524.69 -7775.40 0.00 0.0019981.46 Start DLS 3.86 TFO 81.72 2 23875.00 90.29 316.34 7180.24 18564.34 -7814.67 3.86 81.72 20035.10 Start DLS 3.00 TFO -90.35 325410.11 89.95 270.29 7176.90 19155.66 -9186.79 3.00 -90.35 21213.29 Start 204.33 hold at 25410.11 MD 4 25614.44 89.95 270.29 7177.09 19156.68 -9391.12 0.00 0.00 21312.42 Start DLS 3.00 TFO 90.08 5 27538.18 89.90 328.00 7179.92 20054.44 -11001.17 3.00 90.0822873.71 CD2-361 Tgt 01 032323 Start DLS 3.00 TFO 90.54 627648.81 89.87 331.32 7180.14 20149.91 -11057.05 3.00 90.54 22984.28 Start 7657.52 hold at 27648.81 MD 7 35306.33 89.87 331.32 7197.65 26867.86 -14732.16 0.00 0.00 30641.78 CD2-361 Tgt 02 032323 TD at 35306.33 FORMATION TOP DETAILS No formation data is available By signing this I acknowledge that I have been informed of all risks, checked that the data is correct, ensured it's completeness, and all surroundingwells are assigned to the proper position, and I approve the scan and collision avoidance plan as set out in the audit pack.I approve it as the basiis for the final well plan and wellsite drawings. I also acknowledge that unless notified otherwise all targets have a 100 feet lateral tolerance. Prepared by Checked by Accepted by Approved by CD2-361 actual @ 70.03usft (D26) 20004000600080001000012000True Vertical Depth16000 18000 20000 22000 24000 26000 28000 30000Vertical Section at 331.26°CD2-361PB17-5/8" Intermediate Casing4-1/2" Production Liner2000021000 220002300024000 25000 260002700028000290003000031000320003300034000350003530690°90°90°CD2-361wp08(ST)CD2-361 wp08 (ST)18:52, March 23 2023Section View 160001800020000220002400026000South(-)/ orth( )-18000 -16000 -14000 -12000 -10000 -8000 -6000 -4000 -2000est(-)/ ast( )CD2-361 Tgt 02 032323CD2-361 Tgt 01 032323CD2-361PB17-5/8" Intermediate Casing4-1/2" Production LinerCD2-361wp08(ST)CD2-361 wp08 (ST)While drilling production section, stay within 100 feet laterally of plan, unless notified otherwise.18:56, March 23 20233ODQ9LHZ (QQSQX &rmuQp =yreXT AcX IXjj IXjjSrxX (Xc_p *)C"iRfR>wsV 'sqsUs>adiidv"iRfRhqUPLB MYwq8s|aBisvY ':"ivdqY>RV ') ') ')vBC 4rTQj&r ryWcpQX?XZXyXpTX DG(?X\XxXpTX 6(?X\XxXpTX 9r}b?XZX{pTX AxX&QjTjQcrp6XbrW Mii') ')RURi!]) ')RURi!]) CwY 7dqdnn'RwY =xreXTMYwq8s|aBisvY 8s|aBisvY"iRfR EqdYVBRY 6QuAXm .Xr(Qm 6QuNrpX AcX AcX=rccrp ,xrm =rccrpFpTX}Qcp IXjj IXjj=rccrp ':"ivdqY>RV 7Rv ') 9 A + I ] ] AXm(Qm 7YRqBYR5YYi Edq`Mii@Y[YwYqUY>sdq Edq``YsVYdUURiY[RUsw =rccrpFpTX}Qcpttt].xrpW4XXj ] IXjjSr{ 6Q_pXcT (Xc_p #Wc9rX Hzcrp GX}cTQjAXTcrp ') 6rWXj9QmXAQmujX(QX $//7 ')vBC =bQX (Xub,yrm1DG( k^ =jQpA~XDrrj=xr_xQm(QX (Xub,xrm ^l =jQpAXTcrp 6XQyXW (XubDr ^lAxX1IXjjSrxXl ')vBC') GX}cTQj (Xub3pTjcpQcrp#cmb(Xub9 ^l ^l^ (XTjcpQcrp (cu#p_jX ,cXjWAyXp_b kpD0 >5"8 9 k^ DcX;p(Xub + I ^ Drrj9QmX 7K 2-@ B"/ 7B ?XmQxg <JB/7K 2-@ BR` (r_jX_ %cjW + I?QX ?QX ^k^lk^ Do (cxXTcrp ?QXD,; k^lDQx_X ')C` ')C` ";"#":&C !>>/%7-%>42'>2$".C226%,1";&C&'&6&1$&C #//> > 2/4"1?C 212&2+,//,37>/%7-%>.1&$" > C&(&5&1$&C >%&89%/> 97)> > 62-&$;C #78(41>26+> /23(>C&(&5&1$&C >%&89%/> 97)> > ,;&C >/3,1(>%'>28+C&'&71$&C !49(> !&..C >=5>&?C".$=.";,21C&;+2%C ,1,090>94:%894(> !&..#25&C > &:,*1C >;3> !> ."11&%C=9&?C &":=5&%C &4;+C 1$.,1";,21C @,/=;+C =:)C > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > C";C C C52%=$;,21C,1&5C &:,*1C"6*&;:C "6*&;C"/&C +,</,::C;"6*&;C +"4&C ,4C1*.&C AC ,4C,5C &8,$".C &4;+C =:)C C =:)C > > > > > > > > > > > > > > > > > > > > > C =:)C C =:)C > > > > > > > > > > > > > > > > > > > > > !C =:)C !C =:)C > > > > > > > > > > > > > > > > > > > > > > > &8,$".C 2*.&*C &$;,21C ";&C =:)C C=:)C > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > =,.%C =0C ";&C ";&C B 33=:)C C=:)C > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > >!*8>> > > > > > > 3/%1>+,87>8%4*(8>&(18(4> ,4&/(>4%',97> > >!*8> > > 3/%1>+,87>8%4*(8>&(18(4> ,4&/(>4%',97> > ":,1*C2,1;:C &":=5&%C &4;+C =:)C > > > > > > > > > > > > &8,$".C &4;+C =:)C "/&C >> > > 95%&(>%7,1*> >>18(40(',%8(>%7,1*> > >18(40(',%8(>%7,1*> > >18(40(',%8(>%7,1*> > >18(40(',%8(>%7,1*> >> >42'9&8,21>,1(4> ":,1*C 2.&C ,"/&;&5C ,"/&;&5C ,1C ,1C > > > > > > > > > > > > > > """""" " " " "! "" 7[=d i hOMSBDYi,U]Ki0YUgMRMahi4?=SiUSi cYYDSai4c^Dhi!=a=i,U]Ki2DFD\DS?Di2DFDYDS?Di!D_MJSi -iOWMSDi0=Bii !ii !ii !ieW.5i47i!=acRi(DMJKai !i=?ac=Oii Pc_Ii!i4?=Si2=SJDi iaUi ic_I i+D=_cYDBi!DWaK i4?=Si2=BMc_iM_i:SOMRMaDBi i OD=Y=S?Di%=?aUYi?caUHiM_i:SOMRMaDB i +=gi#OOMW_Di4DW=Y=aMUSiM_i ic_Ii'EVCEbN@i6@>QEi&>AVZiXXQNECi;D[_MUSi i cMOBi4?=Si9WDi'*/*i&)*8$3i11*)$"iQQifEQQX>bL`ifNbLNTi i iVGiZEGEZET@Ei4?=Si9WDi i 0 30 60 Centre to Centre Separation23880 23940 24000 24060 24120 24180 Partial Measured Depth CD2-361PB1CD2-361 wp08 (ST)e View 0 150 300 Centre to Centre Separation24000 26000 28000 30000 32000 34000 Measured DepthCD2-361PB1SV P M Depth rom Depth To Sur e /Plan Tool 131.79 1294.54 CD2-361 Sr 1 SDI S 1 I4 1356.61 2399.41 CD2-361 Sr 2 M D I 2 S MS 2497.48 2497.48 CD2-361 Sr 3 I C T D 2563.25 6358.44 CD2-361 Sr 4 M D I 2 S MS 6425.05 6425.05 CD2-361 Sr 5 I C T D 6517.3812536.73 CD2-361 Sr 6 M D I 2 S MS 12631.2418362.63 CD2-361 Sr 7 M D I 2 S MS 18461.5218461.52 CD2-361 Sr 8 I C T D 18497.67 20357.16 CD2-361 Sr 9 M D I 2 S MS 20438.0120438.01 CD2-361 Sr 10 I C T D 20510.1922086.32 CD2-361 Sr 11 MDI 2S MS 22147.43 23819.20 CD2-361 Sr 12 M D I 2 S MS 23819.2035306.33 CD2-361 wp08 (ST) (CD2-361) M D I 2 S MS 1 20 c 23 2023 C SI D T ILS TVD MD ame 35306.33 4-1/2" Production Liner 23819 23850 23850 24000 24000 24200 24200 24400 CD2-361 wp08 (ST)TC View 30 30 60 60 90 90 120 120 150 150 0 90 180 270 30 210 60 240 120 300 150 330 Tra elling C linder imuth (T I) ° s Tra elling C linder Separation 60 us t/in 23850239002395023999 24047 24094 24140 24184 24228 24269 24312 24353 CD2-361PB1 SV P M Date: 2022-11-07T00:00:00 Validated: es Version: rom To Tool 131.79 1294.54 SDI S 1 I4 1356.61 2399.41 M D I 2 S MS 2497.48 2497.48 ICT D 2563.25 6358.44 M D I 2 S MS 6425.05 6425.05 I C T D 6517.38 12536.73 M D I 2 S MS 12631.24 18362.63 M D I 2 S MS 18461.52 18461.52 I C T D 18497.67 20357.16 M D I 2 S MS 20438.01 20438.01 I C T D 20510.19 22086.32 M D I 2 S MS 22147.43 23819.20 M D I 2 S MS 23819.20 35306.33 M D I 2 S MS CSI DTILS TVD MD ame 35306.33 4-1/2" Production Liner S CTI D T ILS Sec MD Inc i TVD /-S /- Dleg T ace VSect Target nnotation 1 23819.20 89.98 314.21 7180.37 18524.69 -7775.40 0.00 0.0019981.46 Start DLS 3.86 T 81.72 2 23875.00 90.29 316.34 7180.24 18564.34 -7814.67 3.86 81.72 20035.10 Start DLS 3.00 T -90.35 325410.11 89.95 270.29 7176.90 19155.66 -9186.79 3.00 -90.35 21213.29 Start 204.33 hold at 25410.11 MD 4 25614.44 89.95 270.29 7177.09 19156.68 -9391.12 0.00 0.0021312.42 Start DLS 3.00 T 90.08 5 27538.18 89.90 328.00 7179.92 20054.44 -11001.17 3.00 90.0822873.71 CD2-361 Tgt 01 032323 Start DLS 3.00 T 90.54 627648.81 89.87 331.32 7180.14 20149.91 -11057.05 3.00 90.54 22984.28 Start 7657.52 hold at 27648.81 MD 7 35306.33 89.87 331.32 7197.65 26867.86 -14732.16 0.00 0.00 30641.78 CD2-361 Tgt 02 032323 TD at 35306.33 CD2-361 wp08 (ST)Spi e ot1 33 c 23 20232381 20 To 3 306 33orthing (3000 us t/in)asting (3000 us t/in)707171CD2-162PB170717 172727373747475757676777778 Temptation1707171727273737474757576Temptation1CD2-03CD2-06707171727273CD2-31070CD2-310PB370717172CD2-361PB1CD2-466CD2-468707171CD2-320wp13CD2-358wp06.17071hea170717172727373747475757676777778787979igli170igli1 707171727273737474757576767777Iapetus27071717272737374747575767677Char170717172CD2-361wp08(ST) &lhoMj! :tlcTP{! >a{T! FTgg! FTggOlqT! (Tya]j! :qlcTP{ 3Mo>y{Th! .Tl(M{~h! 3MoJljT! >a{T >a{T:lya{alj! ,qlh! :lya{aljDjPTwMaj{! FTgg FTgg:lya{alj :lya{aljDjPTwMaj{ .qaS&ljTq]TjPT! FTggOltT 3M]jT{aPy (Tya]j $~Sa{6l{Ty! ETsyalj! ETwaPMg>TP{alj! >~xTBlg:ql]sMh ,tlh ~y\ 'mkmQm;_bffbpz#fNzdNekQLG5? Iz|Urk5mv_?fmpU '7#fpbkU;NR ') ') ')p?@ 1lPMg&lltSajM{T<TVTtTjPT! AE(<TXTqTjPT! 3(<TVTqTjPT! 6lw`<TVTtTjPT! >~xT&MgP~gM{alj3T{`lS! 8~{o~{TqqlsyMqTM{ (M{MOMyT! Iz|Urk5mv_?fmpU5mv_?fmpU#fNzdNCkb|UR?|N|Uz >y{Th(M{~h! '7#fpbkU;NR Iff') ')NQ|Nf"z[ ')NQ|Nf"z[ @rU 4bkbii'rN|u zb^iN *)@#fNzdN;rmR 4UNk?UN2UUf Czbk^Iff=UWUrUkQU;mbk| Czbk^^UmRU|bQzQNfUYQ|mr 4Np ') 6> +F ') nnn z[ nnnz[ z[ nnnz[ .ql~jS1TTg! z[ 3lSTg6MhT>MhogT(M{T(TPgajM{alj (ao$j]gT ,aTgS>{tTj]{` jA %//4 ')p?@ :`MyT!;2#5 (To{`,tlhAE( ~y\ 6 ~y\ Al ~y\ (M{T >~xTFTggOlqT ')?r ?)0CrzN');% ')?r ?2%4G)/4#/'7 ')?r ?2%4G)ekQLmkfLZffU ')?r ?2%4G)/4#/'7 ')?r ?2%4G)ekQLmkfLWbffU ')?r ?2%4G)/4#/'7 ')?r ?2%4G)/4#/'7 ')?r ?2%4G)ekQLmkfLWbffU ')?r ?2%4G)/4#/'7 ')?r ?2%4G)ekQLmkfLZf ')?r ?2%4G)/4#/') ')?r ?2%4G)/4#/') ')p?@') AaT8j(To{`! +F ~y\ Blg6MhT ?)0LC=?#L0 4G)0-=?#/4? 05'@=*5) 4G)0-=?#/4? 05'@=*5) 4G)0-=?#/4? 4G)0-=?#/4? 05'@=*5) 4G)0-=?#/4? 05'@=*5) 4G)0-=?#/4? 4G)0-=?#/4? 4G)0-=?#/4? (TyPqao{alj (aqTP{alj ?)0C=?#^rm4G)0?'H#=U 9H/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk 0kQfbkmiU|Ur dkmkNb|rUkR 9G?/4G)0-=?N^4f|b?}N|bmk'mrrUQ|bmk 0kQfbkmiU|Ur dkmkNb|rUkR 9G?/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk 9G?/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk 0kQfbkmiU|Ur dkmkNb|rUkR 9H/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk 0kQfbkmiU|Ur dkmkNb|rUkR 9H/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk 9H/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk 9H/4G)0-=?N^4f|b?|N|bmk'mrrUQ|bmk *(+)5 6 -*&1 6 323'3,-00-49?0&9.&?/2'%#!? $9:)52?38,?!034)? *'6**-%)16 -) 6 6!,) 6 %1 6 ?04-2)?&(? '' 6 ? ''*, 6 ? 0%#) 6 ?>4 ?!"? *0%1%*)63)/%)156)6%061603,456011%*)6 6 ,) 6 */$6 -) 6 3,456'3'1%*)61$* 6 31+316,,*.06,616 10 6 #& ( %( &%( "( #( %!( '"( %&( %( %(( #( ( #( ( #((#( &#(&#(&#( &#(&#( &#( &#(&#(&#( 0%#)6-#106 -#16(6 $%2(%0061-#16 %+6)#'6 %+6 %,6 6 6 6 $+6 30"6 30"6 30"6 ?"+:? ? ? ? ? ? ? ? 40&2?,-:9?:&5+):?')2:)5? -5'0)?5&(-<9? ? ?"+:? ? ? ? ? ? ? ? 40&2?,-:9?:&5+):?')2:)5? -5'0)?5&(-<9? ? ?"+;? ? ? ? ? ? ? ? 40&2?,-:9?:&5+):?')2:)5? -5'0)?5&(-<9? ? ?"+:? ? ? ? ? ? ? ? 40&2?,-:9?:&5+):?')2:)5? -5'0)?5&(-<9? ? 0%)#6*%)106 03-6 /%'6 +1$6 +1$6 30"6 30"6 (6 ?? ? ? ? ?!<7&')?&9-2+? ? ??2:)51)(-&:)?&9-2+? ? ? ?2:)51)(-&:)?&9-2+? ? ? ?2:)51)(-&:)?&9-2+? ?? ?2:)51)(-&:)?&9-2+? ? ?? ?53(<':-32?-2)5? $00? ? ?&':<&0? <9*? ? ?&':<&0? <9*? ? "5<)? -2-1<1?<5=&:<6)? ?9-+1&? "??0&9.&?53(? ( $( (( ( &#(&#( 0%)#6 *'6 %(1,6 %(1,6 %)6 %)6 ? ? ? ? ? ? ? ? ? ? ? ? ? ? CD2-361 wp08 (ST)CD2-162PB1Temptation 1Temptation 1CD2-310PB3CD2-361PB1CD2-320 wp13Char 13-D ViewCD2-361 wp08 (ST)19:42, March 23 2023 CD2-361 wp08 (ST)CD2-162PB1Temptation 1Temptation 1CD2-03CD2-03L1CD2-21CD2-21PB1CD2-310PB3CD2-361PB1Char 13-D ViewCD2-361 wp08 (ST)19:43, March 23 2023 150001750020000225002500027500South(-)/ orth( ) (2500 us t/in)-22500 -20000 -17500 -15000 -12500 -10000 -7500 -5000 -2500e t(-) t( ) (2 00 t in)00011111CD2-16210001111122222333336666688 T e p t t i o n100011111222223333366Tepttion1 0001111122222CD2-31000CD2-31030001111122CD2-3611CD2-660111CD2-320wp130001111122222333336666688888 ii1ii1 00011111222223333366666pet200011111222223333366666C10001111122CD2-361wp08(ST)CD2-361 wp08 (ST)te i e View1 c 23 2023LLB T T D T ILS (M P C - DI T S)ame TVD ShapeCD2-361 Tgt 01 032323 7179.92 Circle ( adius: 100.00)CD2-361 Tgt 02 032323 7197.65 Circle ( adius: 100.00)CD2-361 Tgt 01 M 7179.92 Circle ( adius: 1320.00)CD2-361 Tgt 02 M 7197.65 Circle ( adius: 1320.00) CD2-361 (ST)wp08 Surface Location CD2-361 (ST)wp08 Surface Location #SchlumbergerͲConfidential CD2-361 (ST)wp08 KOP for ST CD2-361 (ST)wp08 KOP for ST #SchlumbergerͲConfidential CD2-361 (ST)wp08 TD CD2-361 (ST)wp08 TD #SchlumbergerͲConfidential $/3,1( )$&,/,7<352-(&7'5,// 6,7(&' &' W,KE͗ϵϬϳͲϲϳϬͲϰϳϯϵ W,KE͗ϵϬϳͲϲϳϬͲϰϳϯϵ NAD 83 W,KE͗ϵϬϳͲϲϳϬͲϰϳϯϵ )67+72($7 $/$$ . 6 80,$4'HVLJQ 0XQLFLSDO 6HUYLFHV//&$(&/ Revised 7/2022 TRANSMITTAL LETTER CHECKLIST WELL NAME:______________________________________ PTD:_____________________________________________ ___ Development ___ Service ___ Exploratory ___ Stratigraphic Test ___ Non-Conventional FIELD:__________________________POOL:____________________________________ Check Box for Appropriate Letter / Paragraphs to be Included in Transmittal Letter CHECK OPTIONS TEXT FOR APPROVAL LETTER MULTI LATERAL (If last two digits in API number are between 60-69) The permit is for a new wellbore segment of existing well Permit Number _____________, API Number 50-______________________. Production from or injection into this wellbore must be reported under the original API Number stated above. Spacing Exception The permit is approved subject to full compliance with 20 AAC 25.055. Approval to produce or inject is contingent upon issuance of a conservation order approving a spacing exception. The Operator assumes the liability of any protest to the spacing exception that may occur. Dry Ditch Sample All dry ditch sample sets submitted to the AOGCC must be in nogreater than 30-foot sample intervals from below the permafrost or from where samples are first caught and 10-foot sample intervals through target zones. Non- Conventional Well Please note the following special condition of this permit: Production or production testing of coal bed methane is not allowed for this well until after the Operator has designed and implemented a water-well testing program to provide baseline data on water quality and quantity. The Operator must contact the AOGCC to obtain advance approval of such a water-well testing program. Well Logging Requirements Regulation 20 AAC 25.071(a) authorizes the AOGCC to specify types of well logs to be run. In addition to the well logging program proposed by the Operator in the attached application, the following well logs are also required for this well: Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071, composite curves for all well logs run must be submitted to the AOGCC within 90 days after completion, suspension, or abandonment of this well, or within 90 days of acquisition of the data, whichever occurs first. ALPINE OIL 221-116 (Revised) Additional text for the approval letter: SFD 3/24/2023 “For clarity of the well records, all information, survey data, well logs, and other data from the 3,000' abandoned section of wellbore must be labeled with the well name and number CRU CD2-361 PB1, API Number 50-103-20836-70-00, and Permit to Drill Number 221-116.” CRU CD2-361 COLVILLE RIVER WELL PERMIT CHECKLISTCompanyConocoPhillips Alaska, Inc.Well Name:COLVILLE RIV UNIT CD2-361Initial Class/TypeDEV / 1-OILGeoArea890Unit50360On/Off ShoreOnProgramDEVField & PoolWell bore segAnnular DisposalPTD#:2211160COLVILLE RIVER, ALPINE OIL - 120100NA1 Permit fee attachedYes Surface Location lies within ADL0380075; Portion of Well Passes Thru ADL0025530;2 Lease number appropriateYes Top Productive Interval lies in ADL0025529; Portion of Productive Interval3 Unique well name and numberYes passes thru AA0084140, ADL0388904, ADL0380093; TD lies in ADL0390344.4 Well located in a defined poolYes COLVILLE RIVER, ALPINE OIL - 120100, governed by CO 443D.5 Well located proper distance from drilling unit boundaryYes CO No. 443D has no interwell spacing restrictions. Wellbore will be more than 500'6 Well located proper distance from other wellsYes from an external property line where ownership or landownership changes.7 Sufficient acreage available in drilling unitYes As planned, well will conform to spacing requirements.8 If deviated, is wellbore plat includedYes9 Operator only affected partyYes10 Operator has appropriate bond in forceYes11 Permit can be issued without conservation orderYes12 Permit can be issued without administrative approvalYes13 Can permit be approved before 15-day waitNA14 Well located within area and strata authorized by Injection Order # (put IO# in comments) (ForNA15 All wells within 1/4 mile area of review identified (For service well only)NA16 Pre-produced injector: duration of pre-production less than 3 months (For service well only)NA17 Nonconven. gas conforms to AS31.05.030(j.1.A),(j.2.A-D)Yes 80" conductor provided18 Conductor string providedYes 2316' MD19 Surface casing protects all known USDWsYes 155% excess20 CMT vol adequate to circulate on conductor & surf csgNo21 CMT vol adequate to tie-in long string to surf csgNo uncemented production liner22 CMT will cover all known productive horizonsYes23 Casing designs adequate for C, T, B & permafrostYes Rig has steel tanks24 Adequate tankage or reserve pitNA25 If a re-drill, has a 10-403 for abandonment been approvedYes26 Adequate wellbore separation proposedYes diverter line variance requested and approved27 If diverter required, does it meet regulationsYes Max reservoir pressure 4305 psig(11.5 ppg EMW); will drill w/ 9.5-12.2 ppg EMW; MPD used28 Drilling fluid program schematic & equip list adequateYes29 BOPEs, do they meet regulationYes MPSP is 3579 psig; will test BOPs to 4000 psig30 BOPE press rating appropriate; test to (put psig in comments)Yes31 Choke manifold complies w/API RP-53 (May 84)Yes32 Work will occur without operation shutdownNo H2S measures rqd33 Is presence of H2S gas probableNA34 Mechanical condition of wells within AOR verified (For service well only)Yes H2S not encountered in offset wells. However, rig will be equipped with operational sensors/alarms.35 Permit can be issued w/o hydrogen sulfide measuresYes Maximum expected reservoir pressure is about 11.3 ppg EMW; will be drilled with 9.5 to 12.2 ppg36 Data presented on potential overpressure zonesNA mud using Managed Pressure Drilling technique to maintain borehole stability in shale sections37 Seismic analysis of shallow gas zonesNA and manage reservoir pressure. Some potential to encounter lost circulation. Adequate mud and38 Seabed condition survey (if off-shore)NA LCM supplies will be available on site. Drilling hazards and mitigation discussed on p. 1939 Contact name/phone for weekly progress reports [exploratory only]Geologic Commissioner:Date:Engineering Commissioner:JLCDatePublic CommissionerDateGCW 03/28/23JLC 3/28/2023 1. Type of Request: Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: ___________________ 2. Operator Name: 4. Current Well Class: 5. Permit to Drill Number: Exploratory Development 3. Address: Stratigraphic Service 6. API Number: 7. If perforating:8. Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Will planned perforations require a spacing exception? Yes No 9. Property Designation (Lease Number): 10. Field: Current Pools: Colville Riber Unit Alpine Pool 11. Total Depth MD (ft): Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: MPSP (psi): Plugs (MD): Junk (MD): Casing Collapse Intermediate 2 5380 Intermediate 3 8260 Intermediate 4 4790 Packers and SSSV Type: Packers and SSSV MD (ft) and TVD (ft): 12. Attachments: Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations: OIL WINJ WDSPL Suspended 16. Verbal Approval: Date: GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Matt Wiens Contact Email: Contact Phone: 281-620-1222 Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other: Post Initial Injection MIT Req'd? Yes No Spacing Exception Required? Yes No Subsequent Form Required: APPROVED BY Approved by: COMMISSIONER THE AOGCC Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng Perforation Depth MD (ft): N/A N/A N/A 12599 13.625 9.875 7.625 5869 1977 MD 6420 8860 6890 6896 7134 18468 20445 Length Size Proposed Pools: 12599 5681 TVD Burst PRESENT WELL CONDITION SUMMARY STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 ADL390344, ADL380093, ADL388904, AA084140, ADL388906, ADL387211, ADL387212, ADL025530, ADL380075 221-116 P.O. Box 100360 Anchorage, Alaska, 99510-0360 50-103-20836-00-00 ConocoPhillips Alaska Inc. CD2-361 Tubing Grade: Tubing MD (ft):Perforation Depth TVD (ft): Tubing Size: N/A N/A 12/10/2022 N/A N/A 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: AOGCC USE ONLY matt.r.wiens@cop.com Drilling Enginer Perforate Repair Wepair Well Exploratory Stratigraphic Development Service BOP TestMechanical Integrity Test Location Clearance No No Form 10-403 Revised 10/2022 Approved application valid for 12 months from date of approval.Submit PDF to aogcc.permitting@alaska.gov By Samantha Carlisle at 11:19 am, Mar 02, 2023 323-128 12/10/2022 x All conditions of approval in the original PTD, sundries 322-508 and 322-640 apply including AOGCC notes written in the PTD and in the drilling procedure. VTL 3/2/2023 BOP test to 4000 psig Annular preventer test to 2500 psig file with 10-407 PTD x 3/2/2023 River DSR-3/2/22SFD 3/2/2023 ADL0380075, ADL0025530, ADL0025529, ADL0388901, AA00084140, ADL0388904, ADL0380093 SFD 3/2/2023 JLC 3/2/2023 3/2/23 Brett W. Huber, Sr. Digitally signed by Brett W. Huber, Sr. Date: 2023.03.02 15:30:42 -09'00' RBDMS JSB 030323 ConocoPhillips Alaska, Inc. Post Office Box 100360 Anchorage, Alaska 99510-0360 Telephone 907-276-1215 March 1, 2023 Alaska Oil and Gas Conservation Commission 333 West 7th Avenue, Suite 100 Anchorage, Alaska 99501 Re: Sundry for CRU CD2-361 Operational Changes Dear Sir or Madam: ConocoPhillips Alaska, Inc. hereby applies for a change to the approved Permit to Drill (221-116) an onshore producer well from the CD2 drilling pad. The change is the location of the production packer from the 7 5/8” liner to the 9 7/8” liner. Current forecast shows that this will happen the middle of March 2023. This request is coming from full losses on the Intermediate 4 cement job failing to meet 1,000’MD PTD requirement. The approval is needed before drilling ahead production lateral. Currently CD2-361 is secured with 13 5/8” x 9 7/8” x 7 5/8” casing that has been pressure tested to 3,500psi. The drilling BHA has been used to log with sonic in real time to identify top of cement. The PTD requires a 1,000’MD of cement. No cement has been found up to 20,250’MD. Approval to drill ahead and move up the production packer to the 9 7/8” liner is requested Moving the production packer to the 9 7/8” liner will ensure that it is across an interval of liner that has cement, remove the 7 5/8” cement challenges, and maintain containment of reservoir. ConocoPhillips will work with AOGCC during abandonment operations to secure the 7 5/8” section to meet all regulations. See attached power point slides supporting this change. Please find attached the information required by 20 ACC 25.005 (a) and (c) for your review. Pertinent information attached to this application includes the following: 1. Form 10-403 2. A proposed drilling program 3. A proposed completion diagram 4. A drilling fluids program summary Information pertinent to the application that is presently on file at the AOGCC: 1. Diagrams of the BOP equipment, diverter equipment and choke manifold lay out as required by 20 ACC 25.035 (a) and (b). 2. A description of the drilling fluids handling system. 3. Diagram of riser set up. If you have any questions or require further information, please contact Matt Wiens at 281-620-1222 (Matt.R.Wiens@ConocoPhillips.com) or Chris Brillon at 265-6120. Sincerely, cc: CD2-361 Well File / Jenna Taylor ATO 540 David Lee ATO 1726 Chris Brillon ATO 1548 Matt Wiens Layla Unger ATO 1756 Senior Drilling Engineer Greg Hobbs ATO 1562 Andy Mack Kuukpik Corp AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 CD2-361 AOGCC Application for Sundry Intermediate 4 Cement Top Table of Contents ................................................................................................................................................................ 1 1. Well Name (Requirements of 20 AAC 25.005 (f)) ...................................................... 2 2. Location Summary (Requirements of 20 AAC 25.005(c)(2)) .................................... 2 Requirements of 20 AAC 25.050(b) ........................................................................................................ 2 3. Casing and Cementing Program (Requirements of 20 AAC 25.005(c)(6)) ............. 4 4. Drilling Fluid Program (Requirements of 20 AAC 25.005(c)(8)) .............................. 4 5. Proposed Drilling Program (Requirements of 20 AAC 25.005 (c)(13)) ................... 5 6. Attachments ............................................................................................................. 8 Attachment 1 Completion Schematic ...................................................................................................... 8 Attachment 3 – Property Plat .................................................................................................................. 8 Attachment 4 – Property Plat ............................................................................................................. 10 AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 1. Well Name (Requirements of 20 AAC 25.005 (f)) The well for which this application is submitted will be designated as CRU CD2-361. 2. Location Summary (Requirements of 20 AAC 25.005(c)(2)) Location at Surface (CD2-361 Slot) 2,181‘ FNL, 1,770' FEL, Sec. 2, T11N, R4E, UM NAD27 Northings: 5,974,180 Eastings: 371,464 RKB Elevation 70.2’ AMSL Pad Elevation 15.5’ AMSL Location at Productive Horizon (Heel) 5,218' FNL, 950' FEL, Sec. 16, T12N, R4E, UM NAD27 Northings: 5,981,348 Eastings: 369,237 Measured Depth, RKB: 20233.78’ Total Vertical Depth, RKB: 7103’ Total Vertical Depth, SS: 7031’ Location at Total Depth (Toe) 2,112' FNL, 28' FEL, Sec. 8, T12N, R4E, UM NAD27 Northings: 6,001,839 Eastings: 359,331 Measured Depth, RKB: 33662’ Total Vertical Depth, RKB: 7195’ Total Vertical Depth, SS: 7125’ Requirements of 20 AAC 25.050(b) CD2 Pad Layout AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 CD2-361 Well Plat AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 3. Casing and Cementing Program (Requirements of 20 AAC 25.005(c)(6)) Casing and Cementing Program Csg/Tbg OD (in) Hole Size (in) Weight (lb/ft) Grade Conn. Length (ft) Top MD/TVD (ft) Btm MD/TVD (ft) Planned Cement Program 30 56 328 X65 Welded 80 54.5 / 54.5 135 / 135 Cemented to Surface with 13 yds slurry 20 24 133.0 L-80 Hydril W563 2,412 53 / 53 2,478 / 2,420 Cement to Surface with 2,2558 sx DeepCRETE Lead at 11.0ppg, 836 sx Class G Tail at 15.8ppg 17 17-1/2 x 20 88.1 P-110 IC Hydril W521 4,261 2,327 / 2,283 6,400 / 4,398 614 sx Extended Class G Lead at 13.5ppg 498 sx Class G Tail at 15.8ppg 13-5/8 14-3/4 x 17-1/2 88.2 L-80 IC Hydril W563 14,080 52 / 52 12,599 / 5,681 889 sx Class G Tail at 15.8ppg 9-7/8 12-1/4 x 13-1/2 62.8 L-80 Hydril W563 8,400 12,423 / 5645 18,486/ 6,896 684 sx Class G Tail at 15.8ppg 7-5/8 8-½ x 10-1/4 29.7 L-80 Hydril W523 1,695 18,103 / 6,883 20,468 / 7,134 251 sx Class G Tail at 15.8ppg 5 n/a 24.1 L-80 Hydril W563 7,954 46 / 46 8,004 / 4,631 N/A – Upper Part of Tapered Upper Completion Tubing String 4-1/2 n/a 12.6 L-80 Hydril W563 15,931 8,004 / 4,631 20,091 / 7,120 N/A – Lower Part of Tapered Upper Completion Tubing String 4-1/2 6-3/4 12.6 L-80 Hydril W563 9,118 20,318 / 7,120 33,663 / 7,196 N/A – Uncemented Open Hole Liner w/ Pre-Perforated Pup Joints 4. Drilling Fluid Program (Requirements of 20 AAC 25.005(c)(8)) Surface Intermediate #1 Intermediate #2 Intermediate #3 Intermediate #4 Production Hole Size in 24 17-1/2 x 20 14-3/4 x 17- 1/2 12-1/4 x 13-1/2 8-1/2 x 10 1/4 6-3/4 Casing Size in 20 17 13-5/8 9-7/8 7-5/8 4-1/2 Density ppg 9.5 – 10.0 10.5 – 11.0 10-11 10.5 – 12.2 11-12.5 10.0 – 11.5 PV cP 9 – 10 12 – 13 9-10 13 – 21 20-30 11 YP lb./ 100 ft2 45 – 50 25 – 40 25 – 40 20 – 30 30-40 15 - 25 Initial Gels lb./ 100 ft2 46 14 15 10 10 7 10 Minute Gels lb./ 100 ft2 48 15 25 23 13 8 API Fluid Loss cc/ 30 min N.C. – < 10.0 4 – 12 2 – 10 < 6 < 6 < 6 pH 11.0 9.0 – 10.0 9.0 – 10.0 9.0 – 10.5 9.0-10.5 9.0 – 9.5 Production Hole: The Production interval will be drilled with a water-based drill-in fluid (FLO-PRO WBM) weighted appropriately so that MPD can provide a dynamic overbalance of ~10.8ppg EMW while reducing the risk of lost circulation created by high ECDs. There is potential for lost circulation so ensure adequate LCM material is available on location to address any losses. There is a potential for abnormal pressure so AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 ensure adequate weighting material is on location to weight-up as needed. Kill-weight brine will be placed in the well prior to pulling out of hole. Please reference pit diagram on file for Doyon 26. All drilling fluid practices will be in accordance with appropriate regulations stated in 20 AAC 25.033. 5. Proposed Drilling Program (Requirements of 20 AAC 25.005 (c)(13)) The proposed drilling program is listed below. Please refer to Completion Schematic. 1. MIRU Doyon 26 onto CRU CD2-361 over pre-installed 30” x 48” insulated conductor. 2. Dewater cellar, rig-up riser, & test same. 3. Pick-up enough 6-5/8” VX69 drill pipe to drill SURF section and rack-back. 4. Make-up 24” Conductor Clean-Out BHA. Clean-out conductor. 5. Make-up 24” SURF Drilling BHA (LMWD Program: GR/DIR), spud well, & directionally-drill 24” hole to SURF TD estimated at 2,477’ MD / 2,420’ TVD top-setting the C-30 and as per the directional plan. 9.5 – 10ppg DRILPLEX WBM will be used to drill the section. 6. Circulate & condition, flow-check well, and POOH. Lay-down SURF Drilling BHA. 7. Run new 20” 133# L-80 TNS-ER SURF casing centralized as per design to section TD. Circulate & condition, land casing on hanger within wellhead, and back-off upper half of landing joint. 8. Pick-up & TIH with the SURF Inner String BHA, stab into the inner string float collar, and establish circulation. 9. Cement the 20” SURF casing to surface as per the cement program with 500’ of 15.8ppg Class G tail and 11.0ppg DeepCRETE lead to surface. Bump inner string darts, bleed pressure, & check floats. a. CONTINGENCY: If cement is not brought to surface, notify AOGCC and prepare for top job. 10. Flow check well, N/D flow riser & N/U HP Riser & BOPE with the following equipment/configuration: a. 18-5/8” Annular / Upper 4-1/2” x 7-5/8” VBR / Blind/Shear Ram / Lower 4-1/2” x 7-5/8” VBR 11. Test BOPE to 250psi low / 4,000psi high. Test annular to 250psi low / 2,500psi high. (Provide 48 hr. AOGCC notice) 12. Pick-up & TIH with the 17-1/2” x 20” INTRM1 Drilling BHA (LMWD Program: GR/RES/DIR). a. CONTINGENCY: If unable to clean-out SURF casing shoe track with INTRM1 Drilling BHA, drill out SURF casing shoe track with dedicated SURF Casing Clean-Out BHA and perform FIT. 13. Chart 20” SURF casing pressure test to 3,000psi for 30 minutes. 14. Drill-out shoe track, 24” rathole, and 20’ of new hole. Circulate & condition. 15. Perform FIT to minimum 14.0ppg EMW. 16. Displace well to 10.5ppg LSND WBM. 17. Directionally drill 17-1/2” INTRM1 Pilot Hole until the underreamer is below the 20” SURF Casing Shoe and open the underreamer. 18. Directionally drill 17-1/2” x 20” INTRM1 Hole past the Base Qannik. Circulate a minimum 1x bottom’s up and flow check the well to determine if additional overbalance is needed. 19. Directionally drill 17-1/2” x 20” INTRM1 Hole to INTRM1 TD at 6,400’ MD / 4,398’ TVD as per the directional plan. Circulate & condition while weighting up as needed for a trip margin. 20. Observe well for flow 21. POOH and lay-down the 17-1/2” INTRM1 Drilling BHA. 22. Change Upper 4-1/2” x 7-5/8” VBRs to 17” Solid-Body Rams. Test same to 250psi low / 3,000psi high. (Provide 48 hr. AOGCC notice) 23. Run new 17” 88.1# P-110 IC TSH-521 liner centralized as per design. Circulate & condition prior to exiting the SURF Casing Shoe and again before making-up the Liner Hanger. 24. M/U the 17” x 20” INTRM1 Liner Hanger / Running Tool Assembly and TIH with the 17” INTRM1 liner to above rat hole. Once there, circulate & condition as needed in preparation for the cement job. AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 25. Cement the 17” INTRM1 liner with sufficient 13.5ppg Extended Class G led to provide 500’ isolation above the Top Qannik and a 500’ 15.8ppg tail to tack the 17” INTRM1 Liner Shoe. Bump plugs to 500psi over circulating pressure, bleed pressure, & check floats. a. CONTINGENCY: If cement is not circulated above the Qannik, drill, case, cement INTRM2. Intrm 1 is a drilling liner and will be covered by Intrm 2 long string. 26. Set the 17” x 20” TIW XPAK Liner Hanger. Perform overpull test to confirm hanger set. 27. Perform Liner-Top test to 1,000psi. 28. Pick-up to release running tools from Liner Hanger. Circulate & condition. Flow-check well. 29. TOH on elevators. Lay-down INTRM1 Liner Running Tools. 30. Change 17” Solid-Body Rams back to 4-1/2” x 7-5/8” VBRs. Test same to 250 / 4,000psi. (Provide 48 hr. AOGCC notice) 31. Pick-up & TIH with 15-3/4” INTRM1 Clean-Out BHA to the 17” INTRM1 Liner top. 32. Circulate & condition, drill-out pack-off bushing below Liner Hanger, circulate bottom’s up, and continue TIH. 33. Chart 20” casing x 17” liner pressure test to 3,000psi for 30 minutes. 34. Drill-out shoe track, 17-1/2” x 20” rathole, and 20’ of 15 ¾” new hole. Circulate & condition. 35. Perform FIT to minimum 11.2ppg EMW. 36. Circulate & condition, observe well for flow, and TOH. Lay-down the 15-3/4” INTRM1 Clean-Out BHA. 37. Pick-up & TIH with 15-3/4” x 17-1/2” INTRM2 Drilling BHA to the 17” INTRM1 Liner Shoe (LMWD Program: GR/RES/DIR). 38. Displace the well to 10.5ppg LSND WBM. 39. Open underreamer and directionally-drill 15-3/4” x 17-1/2” INTRM2 hole to TD at 14,134’ MD. a. This hole section is the upper part of the original 5 string INT2 hole section, the drilling/tripping out time is estimated to be over 14 days. To avoid the high risk of stuck pipe, ConocoPhillips is requesting to continue the approved Event Based BOP testing schedule from original INT2. Perform full BOP test once BHA out of hole. 40. POOH and lay-down 15-3/4” x 17-1/2” INTRM2 Drilling BHA. 41. Change Upper 4-1/2” x 7-5/8” VBRs to 13-5/8” Solid-Body Rams. Test same to 250psi low / 3,000psi high. (Provide 48 hr. AOGCC notice) 42. Float new 13-5/8” 88.2# L-80 IC TSH-563 INTRM2 Casing centralized as per design to TD; attempt to run on elevators and rotate only if needed to move past a ledge or to break axial friction. 43. Circulate & condition in preparation for the cement job. 44. Cement the 13-5/8” INTRM2 liner with sufficient 15.8ppg Class G to tack the INTRM2 casing shoe with 250’ TVD slurry. 45. Install pack off and displace the 13-5/8” x 17” x 20” annulus to corrosion-inhibited seawater and diesel freeze- protect. 46. Change 13-5/8” solid body rams back to 4-1/2” x 7-5/8” VBRs. Test same to 250 / 4,000psi. (Provide 48 hr. AOGCC notice) 47. Pick-up & TIH with 12-1/4” x 13-1/2” INTRM3 Drilling BHA (LMWD Program: GR/RES/NEU/DEN/SON/DIR). 48. Chart 13-5/8” INTRM2 casing pressure test to 4,000psi for 30 minutes. 49. Drill-out shoe track, 14-3/4” x 17-1/2” rathole, and 20’ of new 12-1/4” hole. 50. Perform FIT to minimum 11.2ppg EMW. 51. Displace well to 11.0ppg LSND WBM. 52. Directionally drill 12-1/4 x 13-1/2” new INTRM3 hole to TD 10’ TVD below the Top HRZ estimated at 18,550’ MD / 6,915’ TVD. a. This hole section is the lower part of the original 5 string INT2 hole section, the drilling/tripping out time is estimated to be over 14 days. To avoid the high risk of stuck pipe, ConocoPhillips is requesting to AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 continue the approved Event Based BOP testing schedule from original INT2. Perform full BOP test once BHA out of hole. 53. Circulate & condition hole while weighting-up to 11.5ppg. Observe well for flow. 54. POOH and lay-down 12-1/4 x 13-1/2” INTRM3 Drilling BHA. 55. Change Upper 4-1/2” x 7-5/8” VBRs to 9-7/8” Solid-Body Rams. Test same to 250psi low / 4,000psi high. (Provide 48 hr. AOGCC notice) 56. Float 9-7/8” 62.8# L-80 TSH-563 new INTRM3 Liner centralized as per design to TD. Cement the same with 15.8ppg Class G to 250’ TVD above the shoe. 57. Set the Liner Hanger. Test the backside to 1,000 psi for integrity. 58. POOH and L/D liner hanger running tool. 59. Change Upper back to 4-1/2” x 7-5/8” VBRs. Test same to 250psi low / 4,000psi high. (Provide 48 hr. AOGCC notice) 60. Pressure tests the 9-7/8” liner and 13-5/8” casing to 4,000psi for 30 minutes. 61. Pick-up & TIH with 8-1/2” x 10-1/4” INTRM4 Drilling BHA (LMWD Program: GR/RES/NEU/DEN/SON/DIR). a. TOC will be logged with Sonic tool 62. Displace well to 11.5ppg NAF SBM. 63. Drill-out shoe track and 20’ of new hole. Perform FIT to minimum 11.1ppg EMW. 64. Directionally drill 8-1/2” x 10-1/4” hole to section TD within the Fiord West Kuparuk C at 20,391’ MD / 7,107’ TVD using MPD to target 13.0-13.2ppg EMW at 7,101’ TVD. 65. SOOH to 9 7/8” shoe. 66. Circulate & weight up the mud to 13.1ppg kill-weight NAF SBM. 67. Flow check, SOOH, and lay-down 8-1/2” x 10-1/4” Drilling BHA. 68. Run new 7-5/8” 29.7# L-80 TSH-523 INTRM3 Liner to TD. 69. Cement the 7-5/8” liner with 15.8ppg tail Class G to 250’ TVD above the top of Kuparuk C reservoir. 70. Set liner hanger and perform 1,000 psi back pressure test. 71. POOH and L/D liner hanger running tool. 72. Pressure test 13-5/8” x 9-7/8” x 7-5/8” Liner pressure test to 4,000psi for 30 minutes. 73. Pick-up & TIH with 6-3/4” PROD Drilling Assembly (LMWD Program: GR/RES/NEU/DEN/DIR). 74. Displace well to new 10.0ppg FLO-PRO WBM. 75. Drill out shoe track, 8-1/2” x 10-1/4” rat hole, and 20’ of new hole. Perform FIT to minimum of 10.8ppg EMW. Perform draw down. Weight up mud to above pore pressure. 76. Directionally drill 6-3/4" hole to the Production TD at 33,663’ MD geo-steering to stay within the Kuparuk C while using MPD to target 10.8 EMW at 7 5/8” Shoe. 77. Circulate & condition. BROOH to the 7-5/8” INTRM3 liner shoe and further as needed to clean up the well. 78. Strip-in back to bottom. 79. Circulate & condition, displace well to kill-weight brine, flow check, & TOH. Lay-down 6-3/4” PROD Drilling BHA. 80. Run new 4-1/2” 12.6# L-80 TSH 563 Liner with pre-perforated pups centralized as per design. 81. Pick-up the 7 5/8” x 5-1/2” Liner Hanger / Packer with Running Tool Assembly to the Rig Floor. Make-up to the liner hanger. 82. TIH with 4-1/2” PROD Liner; rotate as needed to reduce axial friction and run to TD. Circulate as needed through the open circulation sub. 83. With the liner on bottom, set the liner top packer as per equipment specs. 84. Release running tools, perform ~1,000psi liner-top test to confirm packer & liner barrier integrity. 85. TOH on elevators. Lay-down PROD Liner Running Tools. AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 86. Run 5” x 4-1/2” Upper Completion with smart gas lift mandrels. Space out, pick-up, & with the annular closed on landing string, spot diesel freeze-protect. Land tubing hanger & pressure-up to set packer. Confirm connectivity to smart GLMs. a. Production packer will be set at 18,050’MD, just above 7 5/8” liner 87. Install BPV and pressure test hanger seals to 5,000psi, chart test. 88. Nipple down BOPE. 89. Install tubing head adapter assembly and tree. Pressure-test same to 5,000psi, chart test. Remove BPV. 90. Test tubing and tubing-casing annulus separately to 3,500psi / 30 mins, chart tests. 91. Shear circulation valve in GLM. Circulate tubing to diesel & freeze-protect annulus. 92. Set BPV and secure well. RDMO Doyon 26. 93. POST RIG – Ops a. Pressure-up to convert flotation barrier disk & unload well. 6. Attachments Attachment 1 Completion Schematic Attachment 2 Powerpoint supplemental information Attachment 3 – Property Plat AOGCC Sundry Well CRU CD2-361Saved: 1-Mar-23CRU CD2-361 AOGCC SundryPrinted: 1-Mar-23Attachment 3 –Completion SchematicD26 RKB 54.6' Component Description MD (ft) TVD (ft)Length (ft)115-1/2" x 7-5/8" Liner Top Packer / Hanger 20,241' 7,126' 39'125-1/2" Casing Pup Joint 20,271' 7,128' 10'134-1/2" Disappearing Disk Sub (IRSV) 20,281' 7,128' 5'144-1/2" Shoe - Orange peel eccentric nose 33,657' 7,258' 5'Lower Completion Component Details14ABCDHIEG523Component DescriptionLength (ft)5-7/8" HWDP 700'5-7/8" Drill Pipe 7,500'4-1/2" Drill Pipe 18,000'4-1/2" circulation sub (SLB MI Well Commander/ WFT Jet Streams)10'Liner Running Tool 20'Lower Running String Component Details6MD TVD MD TVDACOND 30" X52, 1" thickness 54' 54' 150' 150'BSURF CSG 20" 133#, L80, T-ER 54' 54' 2,478' 2,411'CINT1 LNR 17" 88.1#, P110-IC, HYD521 2,319' 2,305' 6,404' 4,407'DINT2 CSG 13-5/8" 88.2#, L80-IC, HYD563 54' 54' 12,599' 5,681'EINT3 LNR 9-7/8" 62.8#, L80, HYD563 12,423' 5,640' 18,468' 6,896'FINT 4 LNR 7-5/8" 29.7#, L80-IC, HYD523 18,103' 6,820' 20,445' 7,136'GPROD LNR 4-1/2"12.6#, P110S, HYD5631 perf per 2 blank joint20,241' 7,107' 33,663' 7,196'HCOMP TBG 5" 24.1#, L80, HYD563 54' 54' 5,023' 4,080'ICOMP TBG 4-1/2" 12.6#, L80, HYD563 5,023' 4,080' 20,240' 7,107'Casing and Tubing DetailsTop (ft)Bottom (ft)DescriptionSize StringF911-121314Upper Completion Centralizers:5" x 13-5/8" Yellow PolyOil cross coupling clamp 11.75" OD and WFT cross coupling clamp 12" OD4-1/2" x 13-5/8" Blue PolyOil cross coupling clamp 11.75" OD and WFT cross coupling clamp 12" OD4-1/2" x 9-7/8" Blue PolyOil cross coupling clamp 8.00" ODLower Completion Centralizer:4-1/2" x 6-1/8" Volant Hydroform CentralizerUpper Completion Assembly MD (ft) TVD (ft) Inclination13.813" DB Nipple (3.843" lock no go) 2,146' 2,100' 2025" x 1" KBG 4-5 GLM #1 - DV 4,087' 3,652' 5334-1/2" x 5" Crossover 5,023' 4,088' 704-1/2" 3.813" X Nipple (3.813" selective) 5,355' 4,189' 754-1/2" Silverwell Smart GLM #2 5,360' 4,179' 754-1/2" 3.813" ID polish bore sub 5,367' 4,191' 7554-1/2" x 1" KBG 4-5 GLM #3 - DV 6,026' 4,330' 784-1/2" 3.750" DB Nipple (3.785" lock no go) 17,918' 6,781' 784-1/2" Silverwell Smart GLM #4 17,923' 6,782' 784-1/2" 3.750" ID polish bore sub 17,930' 6,784' 7874-1/2" CMD Sliding Sleeve w/3.687" DB Nipple (3.735" lock no go)17,988' 6,796' 7884-1/2" x 9-7/8" Premier Packer with Striker 18,051' 6,810' 7894-1/2" 3.562" DB (3.609" lock no go) 18,121' 6,824' 784-1/2" 3.448" Ball Seat (3.5" Ball) 20,228' 7,125' 894-1/2" Baker KNOB Locator 20,240' 7,126' 894-1/2" EOT w/ Self-Aligning Mule Shoe 20,245' 7,126' 8910647810 AOGCC Sundry Well CRU CD2-361 Saved: 1-Mar-23 CRU CD2-361 AOGCC Sundry Printed: 1-Mar-23 Attachment 4 – Property Plat CD2-361 Intermediate 4 Cement Job & Alternative Design Initial 2.22.22 Email2Doyon 26 lost full returns 3 hours into circulating on depth with our 7 5/8” liner yesterday afternoon. We attempted to regain circulation, but it seems the formation could no longer hold the hydrostatic column in the well seen after the DFIT. No pack offincident was seen. Being on NAF, we have a limited supply, and we were going to be out of NAF the lost rate we were seeing. LCM was limited due to partial size and density that could fit through shoe track. The decision was made to pump cement as there were no other options to stim the losses.The next BHA in the hole will have a sonic login real time. We will log the 9 7/8” and 7 5/8” cement. Since the loss zone is unknown, there are 2 outcomes. 1. We meet the 1,000’MD APD, this was seen on CD2-310. 70% losses were seen but the cement column was 1,500’MD2. We do not meet 1,000’MD APD.Below is a request for pre-approval on option #2. Request:If the sonic log shows less than 1,000’MD, COP requests to continue with operations drilling the lateral based on the following criteria:xCD2-361 is a producing well that is not being fractured.x9 7/8” shoe is inside the confining shale interval above the reservoir.xThe 9 7/8” shoe has an FIT to 14.5ppge, well above the APD of 10.8ppge. If pressure is communicated to intermediate 4 open hole, the DFIT in Intrm 4 showed the open hole (shale and sand) was 13.7ppge. After the test we could only hold a 13.2ppge.xKick tolerance for the production lateral passes with the 9 7/8” FIT value of 14.5ppge at the 9 7/8” shoexThe shales will collapse around the 7 5/8” liner creating a barrier, as seen historically, due to the hydrostatic being insufficient to hold the shales up.xTo ensure the APD was met we pumped 1,500’MD, 150% more than needed. Current State of CD2-36136-3/4" Hole x 4-1/2" 12.6# L80 HYD563 Perforated Liner33,663' MD / 7,196' TVD 90° Inc' CD2-361 6-String Design Schematic(Updated 2/22/2023 MRW Actual)D B30" Conductor @150' MD17-½ x 20" Hole x 17" 88.1# P110IC HYD521 Liner6,404' MD / 4,XXX' TVD 15-¾ x 17-1/2" Hole x 13-5/8" 88.2# L80IC HYD563 Casing12,599' MD / 5,681' TVD12-¼ x 13-1/2" Hole x 9-7/8" 62.8# L80 HYD563 Liner18,468' MD / 6,896' TVD 24" Hole x 20" 133.1# L80 T-ER Casing2,478' MD / ' TVD 8-1/2 x 10-1/4" Hole x 7 5/8" 29.7# L80 HYD523 Liner20,445' MD / 7,134' TVD Red – PlannedBlack - Actual9 7/8" TOC – 17,258' MD / 6,646' TVD13 5/8" TOC – 11,471' MD / 5,448' TVD7 5/8" TOC – 18,945' MD / 6,987' TVD CD2-361 Intermediate 4 Cement Job4 CD2-361 13 5/8” x 9 7/8” x 7 5/8” Casing Test5 INT3 shoe depthINT3 Shoe set in HRZ Shale6Bad log data due to shoeMarker MD TVDSSHRZ from resistivity image 18,235 -6,777HRZ from logs 18,341 -6,799INT3 shoe depth 18,468 -6,826HRZ marker picked from logs (highest GR)Beginning of HRZ shale as seen in resistivity image logsTrack 7TTrack 6Traditional log derived HRZ pick is 22 ft deeper than first appearance of shale via resistivity image log•INT3 shoe is set 49 ft TVD into demonstrated HRZ shale interval ͸Track 1: Very high GR >300 API͸Track 6: Cuttings percentages demonstrate change from claystone dominated to shale dominated͸Track 7: Resistivity image shows stark transition from silts and claystones (bright) to shales (dark)Track 1 CD2-361 Lower Shales to Kuparuk C Sand 7Bad log data due to shoeClaystoneShaleClaystoneystoneSiltstoneSiltstonSiltstonSiltstoSandstoneNEUTNEUTDENSRESGReeeeeeeeeeCuttings %ROP•INT3 shoe is set 49 ft TVD into demonstrated HRZ shale interval͸DFIT was 14.5ppge•Core photos and CT scans from core in CD4-213A (Nanuq Kuparuk field) illustrate nature of HRZ and Kalubik shales below•Lithologies from shoe to Kuparuk C sand represent impermeable shales of varying facies͸Upper Kalubik and Lower Kalubik are deep basinal anoxic marine shales͸HRZ is a slightly siltier shale, also highly anoxic•There are no demonstrated permeable sandstone intervals in CD2-361 between the INT3 shoe and Kuparuk C sandCT images of formations cored in CD4-213A.Core photos of selected formations CD4-213ACT images of Kalubik natural fractures CD4-213A SLB-PrivateObservations:The interval presented to evaluate the cement behind the 9.875 in and 7.625 in casings is from 16286 ft to 20389ft MD. During RT Top of Cement (TOC) operations, the logging speed was kept at an average of 500 ft/hr. The data was logged while Reaming Down with SonicScope475, which had the sonic signal 114.21 ft from the bit. The interpretation is based on the fact that the TOC will be the depth above which ST projection will show strong casing coherence, slowness values correspond to casing slowness values, and most importantly, casing amplitude is high. High casing amplitudes indicate free pipe, while low amplitudes indicate the presence of cement behind the casing. Top of Cement Evaluation SLB-PrivateTop of Cement EvaluationObservations:From ~16724 ft MD in the 9.875in casing and down to the start of the overlap, we observe the following: їCasing amplitudes with zero to near zero values (zero reference is the vertical red dashed line)їThe casing coherence on the projection is weak to absentїConsistent formation arrivals are observedїSlowness values corresponding to compressional values of offset wells.These observations support the presence of a good cement bond behind the single cased 9.875 in section from 16724 ft MD to the top of the overlap section. Therefore, the apparent Top of Cement is ~16724 ft MD. Good Cement Bond SLB-PrivateTop of Cement EvaluationObservations:A poor to absent cement bond is identified by:їHigh casing amplitudeїSlowness value (DTCO_MH_RT) corresponding to casing slowness (~56 us/ft)їStrong casing coherence (red/orange) on the projection trackїWeak (light blue) to absent (white) coherence on the formation arrivalsThe above are observed in the Free Pipe sections. Free Pipe is confirmed in the single 7.625in casing from ~18468 ft to 20281 ft MD (SonicScope sensor depth). 20281 ft18468 ftFree Pipe 15-¾ x 17-1/2" Hole x 13-5/8" 88.2# L80IC HYD563 Casing12,599' MD / 5,681' TVD12-¼ x 13-1/2" Hole x 9-7/8" 62.8# L80 HYD563 Liner18,468' MD / 6,896' TVD 8-1/2 x 10-1/4" Hole x 7 5/8" 29.7# L80 HYD523 Liner20,445' MD / 7,136' TVD 13 5/8" TOC – 11,471' MD / 5,448' TVD9 7/8" ShoeDFIT to 14.5ppge13 5/8" x 9 7/8" x 7 5/8"Casing Test to 3,500psi9 7/8" TOC – 16,724' MD / 6,535' TVD7 5/8" ShoeDFIT to 11.1ppgeConfining the Reservoir11Committed to working with regulators to meet all regulations during abandonment 9 7DFIT The yellow arrows are hydrocarbons coming from the reservoir on both the inside and outside of the 4 ½”The red highlights are well barriers in place to confine the reservoirConfining to Reservoir with Current Well Design 15-¾ x 17-1/2" Hole x 13-5/8" 88.2# L80IC HYD563 Casing12,599' MD / 5,681' TVD12-¼ x 13-1/2" Hole x 9-7/8" 62.8# L80 HYD563 Liner18,468' MD / 6,896' TVD 8-1/2 x 10-1/4" Hole x 7 5/8" 29.7# L80 HYD523 Liner20,445' MD / 7,136' TVD 9 7/8" TOC – 16,724' MD / 6,535' TVD13 5/8" TOC – 11,471' MD / 5,448' TVD9 7/8" ShoeDFIT to 14.5ppge13 5/8" x 9 7/8" x 7 5/8"Casing Test to 3,500psi7 5/8" ShoeDFIT to 11.1ppgeConfining the Reservoir12Committed to working with regulators to meet all regulations during abandonment 9 7DFIT The yellow arrows are hydrocarbons coming from the reservoir on both the inside and outside of the 4 ½”The red highlights are well barriers in place to confine the reservoirAlternative Production Packer PlacementThis design allows for production packer to be place across cement interval if the 7 5/8” cement is not seen7/8" x 7 5/8""st to 3,500psi CD2-361 Completion Schematic -9 7/8” Production Packer13D26 RKB 54.6' Component Description MD (ft) TVD (ft)Length (ft)115-1/2" x 7-5/8" Liner Top Packer / Hanger 20,241' 7,126' 39'125-1/2" Casing Pup Joint 20,271' 7,128' 10'134-1/2" Disappearing Disk Sub (IRSV) 20,281' 7,128' 5'144-1/2" Shoe - Orange peel eccentric nose 33,657' 7,258' 5'Lower Completion Component Details14ABCDHIEG523Component DescriptionLength (ft)5-7/8" HWDP 700'5-7/8" Drill Pipe 7,500'4-1/2" Drill Pipe 18,000'4-1/2" circulation sub (SLB MI Well Commander/ WFT Jet Streams)10'Liner Running Tool 20'Lower Running String Component Details6MD TVD MD TVDACOND 30" X52, 1" thickness 54' 54' 150' 150'BSURF CSG 20" 133#, L80, T-ER 54' 54' 2,478' 2,411'CINT1 LNR 17" 88.1#, P110-IC, HYD521 2,319' 2,305' 6,404' 4,407'DINT2 CSG 13-5/8" 88.2#, L80-IC, HYD563 54' 54' 12,599' 5,681'EINT3 LNR 9-7/8" 62.8#, L80, HYD563 12,423' 5,640' 18,468' 6,896'FINT 4 LNR 7-5/8" 29.7#, L80-IC, HYD523 18,103' 6,820' 20,445' 7,136'GPROD LNR 4-1/2"12.6#, P110S, HYD5631 perf per 2 blank joint20,241' 7,107' 33,663' 7,196'HCOMP TBG 5" 24.1#, L80, HYD563 54' 54' 5,023' 4,080'ICOMP TBG 4-1/2" 12.6#, L80, HYD563 5,023' 4,080' 20,240' 7,107'Casing and Tubing DetailsTop (ft)Bottom (ft)DescriptionSize StringF911-121314Upper Completion Centralizers:5" x 13-5/8" Yellow PolyOil cross coupling clamp 11.75" OD and WFT cross coupling clamp 12" OD4-1/2" x 13-5/8" Blue PolyOil cross coupling clamp 11.75" OD and WFT cross coupling clamp 12" OD4-1/2" x 9-7/8" Blue PolyOil cross coupling clamp 8.00" ODLower Completion Centralizer:4-1/2" x 6-1/8" Volant Hydroform CentralizerUpper Completion Assembly MD (ft) TVD (ft) Inclination13.813" DB Nipple (3.843" lock no go) 2,146' 2,100' 2025" x 1" KBG 4-5 GLM #1 - DV 4,087' 3,652' 5334-1/2" x 5" Crossover 5,023' 4,088' 704-1/2" 3.813" X Nipple (3.813" selective) 5,355' 4,189' 754-1/2" Silverwell Smart GLM #2 5,360' 4,179' 754-1/2" 3.813" ID polish bore sub 5,367' 4,191' 7554-1/2" x 1" KBG 4-5 GLM #3 - DV 6,026' 4,330' 784-1/2" 3.750" DB Nipple (3.785" lock no go) 17,918' 6,781' 784-1/2" Silverwell Smart GLM #4 17,923' 6,782' 784-1/2" 3.750" ID polish bore sub 17,930' 6,784' 7874-1/2" CMD Sliding Sleeve w/3.687" DB Nipple (3.735" lock no go)17,988' 6,796' 7884-1/2" x 9-7/8" Premier Packer with Striker 18,051' 6,810' 7894-1/2" 3.562" DB (3.609" lock no go) 18,121' 6,824' 784-1/2" 3.448" Ball Seat (3.5" Ball) 20,228' 7,125' 894-1/2" Baker KNOB Locator 20,240' 7,126' 894-1/2" EOT w/ Self-Aligning Mule Shoe 20,245' 7,126' 8910647810 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION BOPE Test Report for: Reviewed By: P.I. Suprv Comm ________COLVILLE RIV UNIT CD2-361 JBR 02/21/2023 MISC. INSPECTIONS: FLOOR SAFTY VALVES:CHOKE MANIFOLD:BOP STACK: ACCUMULATOR SYSTEM:MUD SYSTEM: P/F P/F P/FP/FP/F Visual Alarm QuantityQuantity Time/Pressure SizeQuantity Number of Failures:1 Tested with 5 7/8 and 6 5/8 test joints. FP on lower rams with 6 5/8 test joint. Cycled rams several times and retested (pass). We did a little housekeeping along the way to stay busy between tests. Test Results TEST DATA Rig Rep:Kevin HinrichsOperator:ConocoPhillips Alaska, Inc.Operator Rep:Einer Fleagle Rig Owner/Rig No.:Doyon 26 PTD#:2211160 DATE:1/17/2023 Type Operation:DRILL Annular: 250/2500Type Test:BIWKLY Valves: 250/4000 Rams: 250/4000 Test Pressures:Inspection No:bopSTS230115100753 Inspector Sully Sullivan Inspector Insp Source Related Insp No: INSIDE REEL VALVES: Quantity P/F (Valid for Coil Rigs Only) Remarks: Test Time 11 MASP: 3579 Sundry No: Control System Response Time (sec) Time P/F Housekeeping:P PTD On Location P Standing Order Posted P Well Sign P Hazard Sec.P Test Fluid W Misc NA Upper Kelly 1 P Lower Kelly 1 P Ball Type 4 P Inside BOP 2 P FSV Misc 0 NA 16 PNo. Valves 1 PManual Chokes 1 PHydraulic Chokes 0 NACH Misc Stripper 0 NA Annular Preventer 1 18 3/4"P #1 Rams 1 4 1/2"x7 5/8"P #2 Rams 1 Blind /Shear P #3 Rams 1 3 1/2"x6 5/8"FP #4 Rams 0 NA #5 Rams 0 NA #6 Rams 0 NA Choke Ln. Valves 1 3 1/8"P HCR Valves 2 3 1/16" & 3 1/P Kill Line Valves 2 3 1/16"P Check Valve 0 NA BOP Misc 0 NA System Pressure P2900 Pressure After Closure P1650 200 PSI Attained P26 Full Pressure Attained P138 Blind Switch Covers:Pall stations Bottle precharge P Nitgn Btls# &psi (avg)P10@4000 ACC Misc NA0 P PTrip Tank P PPit Level Indicators P PFlow Indicator P PMeth Gas Detector P PH2S Gas Detector 0 NAMS Misc Inside Reel Valves 0 NA Annular Preventer P14 #1 Rams P15 #2 Rams P17 #3 Rams P15 #4 Rams NA0 #5 Rams NA0 #6 Rams NA0 HCR Choke P2 HCR Kill P2 FP Tested with 5 7/8 and 6 5/8 test joints. FP on lower rams with 6 5/8 test joint. Cycled rams several times and retested (pass). Doyon 26 CD2-361 1-17-23 Test Sequence 5-7/8 Test Joint #1. Annular #2. UPR/ Valves 1,14,15,16/ kill valve 3/ upper IBOP #3. Valves 10,13/ HCR kill/ Lower IBOP #4. Valves 4,9,12/ Manual kill #5. Valves 6,8,11/ 6-5/8 FOSV #1 #6. Valves 5,7/ 6-5/8 FOSV #2 #7. Valve 2/ 6-5/8 dart #8. HCR choke/ 5-7/8 FOSV #1 #9. Manual choke/ 5-7/8 FOSV #2 #10. LPR #11. Blind rams/ valves 3,4,6 6-5/8 Test Joint #12. Annular #13. UPR #14. LPR #15. Choke A #16. Choke B DOYON RIG 26 ACCUMULATOR DRAW DOWN WORKSHEET WELL: CD2-361 DATE: 1/17/22 ACCUMULATOR PSI 2900 MANIFOLD PSI 1480 FUNCTION RAMS/ANNULAR/ HCR'S, DON'T FUNCTION BLINDS! FUNCTION ONE RAM TWICE LET PRSSURE STABILIZE AND RECORD BACK UP NITROGEN BOTTLE'S ACCUMULATOR PSI 1650 NITROGEN BOTTLE'S 10ea 4000psi Avg. TURN ON ELEC. PUMP, SEC FOR 200 PSI = 26 *used 1 of 2 electric pumps for th TURN ON AIR PUMP'S TIME FOR FULL CHARGE = 138 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION BOPE Test Report for: Reviewed By: P.I. Suprv Comm ________COLVILLE RIV UNIT CD2-361 JBR 01/26/2023 MISC. INSPECTIONS: FLOOR SAFTY VALVES:CHOKE MANIFOLD:BOP STACK: ACCUMULATOR SYSTEM:MUD SYSTEM: P/F P/F P/FP/FP/F Visual Alarm QuantityQuantity Time/Pressure SizeQuantity Number of Failures:1 Kam witnessed the PVTs and gas alarms earlier in the day when he did the rig inspection. Had to wait for hours for them to break in new rams as per NOV. F/P on top set of rams, had to increase Accu pressure to get them to hold. 10 min high tests were done for BLM regs. Test Results TEST DATA Rig Rep:NewmanOperator:ConocoPhillips Alaska, Inc.Operator Rep:Arthur Rig Owner/Rig No.:Doyon 26 PTD#:2211160 DATE:12/19/2022 Type Operation:DRILL Annular: 250/3500Type Test:INIT Valves: 250/5000 Rams: 250/5000 Test Pressures:Inspection No:bopRCN221221173514 Inspector Bob Noble Inspector Insp Source Related Insp No: INSIDE REEL VALVES: Quantity P/F (Valid for Coil Rigs Only) Remarks: Test Time 9 MASP: 3579 Sundry No: Control System Response Time (sec) Time P/F Housekeeping:P PTD On Location P Standing Order Posted P Well Sign P Hazard Sec.P Test Fluid W Misc NA Upper Kelly 1 P Lower Kelly 1 P Ball Type 1 P Inside BOP 1 P FSV Misc 0 NA 16 PNo. Valves 1 PManual Chokes 1 PHydraulic Chokes 0 NACH Misc Stripper 0 none NA Annular Preventer 1 18 3/4"P #1 Rams 1 4 1/2" x 7 5/8 FP #2 Rams 1 Blind/Shear P #3 Rams 1 3 1/2" x 6 5/8 P #4 Rams 0 none NA #5 Rams 0 none NA #6 Rams 0 none NA Choke Ln. Valves 1 3 1/8"P HCR Valves 2 3 1/16"P Kill Line Valves 2 3" and 3 1/16 P Check Valve 0 none NA BOP Misc 0 none NA System Pressure P2950 Pressure After Closure P1750 200 PSI Attained P25 Full Pressure Attained P77 Blind Switch Covers:PAll stations Bottle precharge P Nitgn Btls# &psi (avg)P10X 4000 ACC Misc NA0 P PTrip Tank P PPit Level Indicators P PFlow Indicator P PMeth Gas Detector P PH2S Gas Detector NA NAMS Misc Inside Reel Valves 0 NA Annular Preventer P22 #1 Rams P17 #2 Rams P16 #3 Rams P18 #4 Rams NA0 #5 Rams NA0 #6 Rams NA0 HCR Choke P2 HCR Kill P2 FP break in new rams as per NOV. F/P on top set of rams, had to increase Accu pressure to get them to hold. 10 min high tests 7\SHRI5HTXHVW $EDQGRQ 3OXJ3HUIRUDWLRQV )UDFWXUH6WLPXODWH 5HSDLU:HOO 2SHUDWLRQVVKXWGRZQ 6XVSHQG 3HUIRUDWH 2WKHU6WLPXODWH 3XOO7XELQJ &KDQJH$SSURYHG3URJUDP 3OXJIRU5HGULOO 3HUIRUDWH1HZ3RRO 5HHQWHU6XVS:HOO $OWHU&DVLQJ 2WKHUBB1HZ'LUHFWLRQDO3ODQBB 2SHUDWRU1DPH &XUUHQW:HOO&ODVV 3HUPLWWR'ULOO1XPEHU ([SORUDWRU\ 'HYHORSPHQW $GGUHVV6WUDWLJUDSKLF 6HUYLFH $3,1XPEHU ,ISHUIRUDWLQJ:HOO1DPHDQG1XPEHU :KDW5HJXODWLRQRU&RQVHUYDWLRQ2UGHUJRYHUQVZHOOVSDFLQJLQWKLVSRRO" :LOOSODQQHGSHUIRUDWLRQVUHTXLUHDVSDFLQJH[FHSWLRQ" <HV 1R 3URSHUW\'HVLJQDWLRQ/HDVH1XPEHU )LHOG3RROV &ROYLOOH5LEHU8QLW$OSLQH3RRO 7RWDO'HSWK0'IW 7RWDO'HSWK79'IW (IIHFWLYH'HSWK0' (IIHFWLYH'HSWK79' 0363SVL 3OXJV0' -XQN0' &DVLQJ &ROODSVH 6WUXFWXUDO &RQGXFWRU 6XUIDFH ,QWHUPHGLDWH 3URGXFWLRQ /LQHU 3DFNHUVDQG66697\SH 3DFNHUVDQG66690'IWDQG79'IW $WWDFKPHQWV 3URSRVDO6XPPDU\ :HOOERUHVFKHPDWLF :HOO&ODVVDIWHUSURSRVHGZRUN 'HWDLOHG2SHUDWLRQV3URJUDP %236NHWFK ([SORUDWRU\ 6WUDWLJUDSKLF 'HYHORSPHQW 6HUYLFH (VWLPDWHG'DWHIRU :HOO6WDWXVDIWHUSURSRVHGZRUN &RPPHQFLQJ2SHUDWLRQV 2,/ :,1- :'63/6XVSHQGHG 9HUEDO$SSURYDO 'DWH *$6 :$* *6725 63/8* $2*&&5HSUHVHQWDWLYH*,1-2S6KXWGRZQ $EDQGRQHG &RQWDFW1DPH 0DWW1DJHO 0DWW1DJHO &RQWDFW(PDLO &RQWDFW3KRQH $XWKRUL]HG7LWOH 'ULOOLQJ(QJLQHHU &RQGLWLRQVRIDSSURYDO1RWLI\$2*&&VRWKDWDUHSUHVHQWDWLYHPD\ZLWQHVV 6XQGU\1XPEHU 3OXJ,QWHJULW\ %237HVW 0HFKDQLFDO,QWHJULW\7HVW /RFDWLRQ&OHDUDQFH 2WKHU 3RVW,QLWLDO,QMHFWLRQ0,75HT G"<HV 1R 6SDFLQJ([FHSWLRQ5HTXLUHG"<HV 1R 6XEVHTXHQW)RUP5HTXLUHG $33529('%< $SSURYHGE\ &200,66,21(5 7+($2*&& 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEHGHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO $XWKRUL]HG1DPHDQG 'LJLWDO6LJQDWXUHZLWK'DWH $2*&&86(21/< PDWWEQDJHO#FRSFRP 7XELQJ*UDGH 7XELQJ0'IW3HUIRUDWLRQ'HSWK79'IW 7XELQJ6L]H 35(6(17:(//&21',7,216800$5< 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 $33/,&$7,21)25681'5<$33529$/6 $$& $'/$'/$'/$$$'/ $'/$'/$'/$'/ 32%R[$QFKRUDJH$ODVND &RQRFR3KLOOLSV$ODVND,QF &' /HQJWK 6L]H 79' %XUVW0' 3HUIRUDWLRQ'HSWK0'IW 3HUIRUDWH 5HSDLU:HSDLU:HOO ([SORUDWRU\ 6WUDWLJUDSKLF 'HYHORSPHQW 6HUYLFH %237HVW0HFKDQLFDO,QWHJULW\7HVW /RFDWLRQ&OHDUDQFH 1R 1R )RUP5HYLVHG$SSURYHGDSSOLFDWLRQLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDO By Samantha Carlisle at 8:06 am, Aug 30, 2022 '65 6)' $'/$'/$'/$'/ $$$'/$'/6)' 6)' 6)' %23 WHVW WR SVLJ $QQXODU SUHYHQWHU WHVW WR SVLJ ; )LOH ZLWK 37' ; 97/ 127( $OO WKH QRWHV DQG FRQGLWLRQV RI DSSURYDO RQ WKH RULJLQDO DSSURYHG 37' DSSO\ LQFOXGLQJ $2*&& QRWHV ZULWWHQ WKURXJKRXW WKH 37' DQG LQ WKH 'ULOOLQJ SURFHGXUH GWV -/& Jeremy Price Digitally signed by Jeremy Price Date: 2022.09.14 14:06:20 -08'00' RBDMS JSB 091422 &RQRFR3KLOOLSV$ODVND,QF 3RVW2IILFH%R[ $QFKRUDJH$ODVND 7HOHSKRQH $XJXVW $ODVND2LODQG*DV&RQVHUYDWLRQ&RPPLVVLRQ :HVWWK$YHQXH6XLWH $QFKRUDJH$ODVND 5H 6XQGU\IRU&58&''LUHFWLRQDODQG2SHUDWLRQDO&KDQJHV 'HDU6LURU0DGDP &RQRFR3KLOOLSV$ODVND,QFKHUHE\DSSOLHVIRUDFKDQJHWRWKHDSSURYHG3HUPLWWR'ULOODQRQVKRUHSURGXFHUZHOOIURPWKH&' GULOOLQJSDG7KHFKDQJHVLQFOXGHGDGLUHFWLRQDOFKDQJHDQGRSHUDWLRQDOXSGDWHVLQFOXGLQJPXGW\SHFKDQJHV7KHLQWHQGHGVSXGGDWHIRUWKLV ZHOOLV'HFHPEHUXVLQJ'R\RQ5LJWRGULOOWKHZHOO &'LVSODQQHGWREHDODWHUDO.XSDUXN&SURGXFHU7KH´6XUIDFHVHFWLRQZLOO7'DERYHWKH&VDQGDQGWKHQ´FDVLQJZLOOEHVHW DQGFHPHQWHGWRVXUIDFH7KHLQWHUPHGLDWHKROHZLOOEHGULOOHGLQIRXUVHFWLRQVWRPLWLJDWHLVVXHVZLWKGULOOLQJWKHH[WHQGHGRYHUEXUGHQ VHFWLRQ 7KH´[´,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGWR¶0'DQGODQGHGDWDQLQFOLQDWLRQRI$´OLQHUZLOOEHVHWDQG FHPHQWHGIURP7'WRVHFXUHWKHVKRHLVRODWHWKH4DQQLNUHVHUYRLU7KH´[´,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGDW LQFOLQDWLRQWKURXJKWKH$OELDQ7KH´FDVLQJZLOOEHVHWDQGFHPHQWHGWR¶79'DERYHWKHVKRH7KH´[´ ,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGDWLQFOLQDWLRQWR¶79'LQWRWKH+5=0DQDJHG3UHVVXUH'ULOOLQJWHFKQRORJ\ZLOOEHXWLOL]HGWR PLWLJDWHZHOOERUHLQVWDELOLW\DQGORVWFLUFXODWLRQDFURVVWKLVLQWHUYDO$´OLQHUZLOOEHVHWDQGFHPHQWHGWR¶79'DERYHWKHVKRH 7KHò´[ó´GULOOHGWKURXJKWKH+5=DQG.DOXELNDQGZLOOODQGZLWKLQWKH.XSDUXN&WDUJHWUHVHUYRLU$´OLQHUZLOOEHVHWDQG FHPHQWHGWR¶0'DERYHWKHWRS.XSDUXN&0DQDJHG3UHVVXUH'ULOOLQJWHFKQRORJ\ZLOOEHXWLOL]HGWRPLWLJDWHZHOOERUHLQVWDELOLW\DQG ORVWFLUFXODWLRQDFURVVWKLVLQWHUYDO 7KH´3URGXFWLRQVHFWLRQZLOOEHJHRVWHHUHGZLWKLQWKH.XSDUXN&WDUJHWUHVHUYRLUZLWK7'SRWHQWLDOO\EHLQJDGMXVWHGDVSHUUHVHUYRLU H[WHQWDQGTXDOLW\7KHZHOOZLOOEHFRPSOHWHGDVDSURGXFHU$´SUHSHUIRUDWHGOLQHUZLOOEHVHWDQGWKHZHOOZLOOEHFRPSOHWHGZLWKD WDSHUHG´[´WXELQJXSSHUFRPSOHWLRQVWULQJ 3OHDVHILQGDWWDFKHGWKHLQIRUPDWLRQUHTXLUHGE\$&&DDQGFIRU\RXUUHYLHZ3HUWLQHQWLQIRUPDWLRQDWWDFKHGWRWKLV DSSOLFDWLRQLQFOXGHVWKHIROORZLQJ )RUP $SURSRVHGGULOOLQJSURJUDP $SURSRVHGFRPSOHWLRQGLDJUDP $GULOOLQJIOXLGVSURJUDPVXPPDU\ 3UHVVXUHLQIRUPDWLRQDVUHTXLUHGE\$&&G 'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFHLQIRUPDWLRQDVUHTXLUHGE\$&&E ,QIRUPDWLRQSHUWLQHQWWRWKHDSSOLFDWLRQWKDWLVSUHVHQWO\RQILOHDWWKH$2*&& 'LDJUDPVRIWKH%23HTXLSPHQWGLYHUWHUHTXLSPHQWDQGFKRNHPDQLIROGOD\RXWDVUHTXLUHGE\$&&D DQGE $GHVFULSWLRQRIWKHGULOOLQJIOXLGVKDQGOLQJV\VWHP 'LDJUDPRIULVHUVHWXS ,I\RXKDYHDQ\TXHVWLRQVRUUHTXLUHIXUWKHULQIRUPDWLRQSOHDVHFRQWDFW0DWW:LHQVDW 0DWW5:LHQV#&RQRFR3KLOOLSVFRPRU&KULV%ULOORQDW 6LQFHUHO\ FF &':HOO)LOH-HQQD7D\ORU$72 'DYLG/HH$72 &KULV%ULOORQ $72 0DWW:LHQV/D\OD8QJHU$72 6HQLRU'ULOOLQJ(QJLQHHU*UHJ+REEV$72 $QG\0DFN.XXNSLN&RUS LVRODWHWKH4DQQLNUHVHUYRLU $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 1 of 23 Printed: 25-Aug-22 &' AOGCC Application for Permit to Drill Document 7DEOHRI&RQWHQWV :HOO1DPH(Requirements of 20 AAC 25.005 (f)) .................................................................................... /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) %ORZRXW3UHYHQWLRQ(TXLSPHQW,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(3)) 'ULOOLQJ+D]DUGV,QIRUPDWLRQRequirements of 20 AAC 25.005 (c)(4)) 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV Requirements of 20 AAC 25.005 (c)(5)) &DVLQJDQG&HPHQWLQJ3URJUDP(Requirements of 20 AAC 25.005(c)(6)) 'LYHUWHU6\VWHP,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) 'ULOOLQJ)OXLG3URJUDPRequirements of 20 AAC 25.005(c)(8)) $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) 3URSRVHG'ULOOLQJ3URJUDP(Requirements of 20 AAC 25.005 (c)(13)) 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) $WWDFKPHQWV Attachment 1 Cement Summary Attachment 2 Drilling Hazards Summary Attachment 3 Completion Schematic Attachment 4 Property Plat Attachment 5 Directional Plan CD2-361 $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 2 of 23 Printed: 25-Aug-22 :HOO1DPH(Requirements of 20 AAC 25.005 (f)) 7KHZHOOIRUZKLFKWKLVDSSOLFDWLRQLVVXEPLWWHGZLOOEHGHVLJQ DWHGDV&58&' /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) /RFDWLRQDW6XUIDFH(CD2-361 Slot)µ)1/ )(/6HF715(80 NAD27 Northings: 5,974,180 Eastings: 371,464 RKB Elevation ¶$06/ Pad Elevation ¶$06/ /RFDWLRQDW3URGXFWLYH+RUL]RQ+HHO )1/ )(/6HF715(80 NAD27 Northings:5,981,348 Eastings: 369,237 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ /RFDWLRQDW7RWDO'HSWK7RH )1/ )(/6HF715(80 NAD27 Northings: 6,001,839 Eastings: 359,331 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ Requirements of 20 AAC 25.050(b) 3OHDVHVHH$WWDFKPHQW&'ZS'LUHFWLRQDO3ODQ 7KH$SSOLFDQWLVWKHRQO\DIIHFWHGRZQHU $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 3 of 23 Printed: 25-Aug-22 &'3DG/D\RXW $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 4 of 23 Printed: 25-Aug-22 &':HOO3ODW $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 5 of 23 Printed: 25-Aug-22 %ORZRXW3UHYHQWLRQ(TXLSPHQW,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(3)) 3OHDVHUHIHUHQFH%23DQGGLYHUWHUVFKHPDWLFVRQILOHIRU'R\RQ 'ULOOLQJ+D]DUGV,QIRUPDWLRQRequirements of 20 AAC 25.005 (c)(4)) 7KHIROORZLQJVKRZVWKHFDOFXODWLRQUHVXOWVRIDQWLFLSDWHGVXUIDFHSUHVVXUH$63ZKLOHGULOOLQJWKLVZHOO &DVLQJ6L]H LQ &DVLQJ6HW'HSWK 0'79'IW )UDFWXUH *UDGLHQW SSJ 3RUH 3UHVVXUH SVL $63'ULOOLQJ SVL 1$ 352&('85()25&$/&8/$7,1*$17,&3$7('685)$&(35(6685($63 $63LVGHWHUPLQHGDVWKHOHVVHURIVXUIDFHSUHVVXUHDWEUHDNGRZQRIWKHIRUPDWLRQFDVLQJVHDWZLWKD JDVJUDGLHQWWRWKHVXUIDFHRUIRUPDWLRQSRUHSUHVVXUHDWWKHQH[WFDVLQJSRLQWOHVVDJDVJUDGLHQWWR WKHVXUIDFHDVIROORZV $63 >)*[@[' :KHUH $63 $QWLFLSDWHG6XUIDFHSUHVVXUHLQSVL )* )UDFWXUHJUDGLHQWDWWKHFDVLQJVHDWLQOEJDO &RQYHUVLRQIURPOEJDOWRSVLIW *DVJUDGLHQWLQSVLIW ' WUXH9HUWLFDOGHSWKRIFDVLQJVHDWLQIW5.% 25 $63 )33±[' :KHUH )33 )RUPDWLRQ3RUH3UHVVXUHDWWKHQH[WFDVLQJSRLQW )33 SVLIW[79'DERYH+5= SVLIWEHORZ+5=XQOHVVRWKHUZLVHVSHFLILHG (A) ASP Calculations Per Interval 'ULOOLQJ%HORZ´&RQGXFWRU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL 'ULOOLQJ%HORZ´6XUIDFH&DVLQJ $63 >)*[±@[' >[±@[¶ SVL 25 $63 )33±[' ±[¶ SVL 1RWH33LVDVVXPHGIRU4DQQLNDWSSJWKLVLVZRUVWFDVH $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 6 of 23 Printed: 25-Aug-22 'ULOOLQJ%HORZ´,QWHUPHGLDWH'ULOOLQJ/LQHU $63 >)*[±@[' >[±@[¶ SVL 25 $63 )33±[' ±[¶ SVL 'ULOOLQJ%HORZ´,QWHUPHGLDWH3URGXFWLRQ/LQHU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL 'ULOOLQJ%HORZ´,QWHUPHGLDWH3URGXFWLRQ/LQHU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL NOTE: 10.5ppg Kuparuk C Pressure at TD (B) data on potential gas zones; 7KHZHOOERUHLVQRWH[SHFWHGWRSHQHWUDWHDQ\K\GUDWHVQRUJDV]RQHV (C) data concerning potential causes of hole problems such as abnormally geo-pressured strata, lost circulation zones, and zones that have a propensity for differential sticking; 3OHDVHVHH$WWDFKPHQW'ULOOLQJ+D]DUGV6XPPDU\ 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWVRequirements of 20 AAC 25.005 (c)(5)) 'ULOORXWFDVLQJRUOLQHUVKRHDQGSHUIRUP/27WHVWRU),7LQDFFRUGDQFHZLWKWKH&23(5'/27),7 SURFHGXUHWKDW&RQRFR3KLOOLSV$ODVNDKDVRQILOHZLWKWKH&RPPLVVLRQ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 7 of 23 Printed: 25-Aug-22 &DVLQJDQG&HPHQWLQJ3URJUDP(Requirements of 20 AAC 25.005(c)(6)) &DVLQJDQG&HPHQWLQJ3URJUDP Csg/Tbg OD (in) Hole Size (in) Weight (lb/ft) Grade Conn. Length (ft) Top MD/TVD (ft) Btm MD/TVD (ft) Planned Cement Program ;:HOGHG&HPHQWHGWR6XUIDFHZLWK \GVVOXUU\ /+\GULO : &HPHQWWR6XUIDFHZLWK V['HHS&5(7(/HDGDWSSJ V[&ODVV*7DLODWSSJ [ 3 ,& +\GULO :V[([WHQGHG&ODVV*/HDGDWSSJ V[&ODVV*7DLODWSSJ [ / ,& +\GULO :V[&ODVV*7DLODWSSJ [ /+\GULO :V[&ODVV*7DLODWSSJ ò[ /+\GULO :V[&ODVV*7DLODWSSJ QD/+\GULO :N/A – Upper Part of Tapered Upper Completion Tubing String QD/+\GULO :N/A – Lower Part of Tapered Upper Completion Tubing String /+\GULO :N/A – Uncemented Open Hole Liner w/ Pre-Perforated Pup Joints 'LYHUWHU6\VWHP,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) &3$,UHTXHVWVDYDULDQFHWRWKHGLYHUWHUUHTXLUHPHQWXQGHU$$&KEHJUDQWHG &'PHHWVWKHUHTXLUHPHQWVDVRXWOLQHGEHORZ 1. The well is a development well drilled by Doyon 26 from an existing drill site. D &'LVDGHYHORSPHQWZHOOEHLQJGULOOHGE\'R\RQIURP &' 2. At least one previously drilled borehole has penetrated the horizontal circle with a radius of 500 feet centered on the proposed location of the surface casing shoe of the well to be drilled. D 7KHUHDUHHLJKWZHOOVZLWKLQD¶UDGLXVRIWKHSURSRVHG&'VXUIDFHVKRHDW ¶0'&'a¶&'a¶&'a¶&'a¶&' a¶&'a¶&'a¶DQG&'a¶ 3. There have been no significant gas shows or well control events while any borehole was drilled to the depth of the surface casing shoe within the 500-foot radius circle. D 7KHUHDUHILIW\WKUHHZHOOVZLWKLQD¶UDGLXVDFURVVWKH&'VXUIDFHKROHLQWHUYDO 7KHUHKDYHEHHQQRVLJQLILFDQWLQGLFDWLRQVRIVKDOORZJDVRUJDVK\GUDWHVZKLOHGULOOLQJ IURP&'SDGLQFOXGLQJRQ&'ZKHUHDVXUIDFHKROHZDVGULO OHGWR¶79'LQ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 8 of 23 Printed: 25-Aug-22 'ULOOLQJ)OXLG3URJUDPRequirements of 20 AAC 25.005(c)(8)) 6XUIDFH,QWHUPHGLDWH ,QWHUPHGLDWH ,QWHUPHGLDWH ,QWHUPHGLDWH 3URGXFWLRQ +ROH6L]Hin [[ [ [ &DVLQJ 6L]Hin 'HQVLW\ppg ±± ±± 39cP ±± ± <3 lb./ 100 ft2 ±±±± ,QLWLDO *HOV lb./ 100 ft2 0LQXWH *HOV lb./ 100 ft2 $3,)OXLG /RVV cc/ 30 min 1&± ± ± S+±±±± 6XUIDFH+ROH 7KH6XUIDFHLQWHUYDOZLOOEHGULOOHGZLWKDPL[HGPHWDOR[LGHIUHVKZDWHUGULOOLQJIOXLG'5,/3/(;:%0 .HHSIORZOLQHYLVFRVLW\DWrVHFTWZKLOHGULOOLQJDQGUXQQLQJFDVLQJ5HGXFHYLVFRVLW\SULRUWR FHPHQWLQJ0DLQWDLQPXGZHLJKWSSJWKURXJKWKHEDVHRI3HUPDIURVWDQGLQFUHDVHWRSSJSULRU WR7'&RQWURO/*6XVLQJVROLGVFRQWUROV\VWHPDQGGLOXWLRQVZKHUHQHFHVVDU\ ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDIUHVKZDWHUJHOSRO\PHUGULOOLQJIOXLG/61':%0 (QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJIOXLGDQQXODUYHORFLW\DQGURWDU\VSHHG0DLQWDLQPXGZHLJKW IURP±SSJIRUVKDOORZLQVWDELOLW\DQGEHSUHSDUHGWRDGGORVVFLUFXODWLRQPDWHULDORUZHLJKWXS DVQHHGHGIRUDFWXDO4DQQLNSRUHSUHVVXUH*RRGILOWHUFDNHTXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFHRI ORZJUDYLW\GULOOVROLGVE\GLOXWLQJDVUHTXLUHGZLOODOOEHLPSRUWDQWLQPDLQWDLQLQJJRRGKROHFRQGLWLRQV ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDIUHVKZDWHUJHOSRO\PHUGULOOLQJIOXLG/61':%0 (QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJIOXLGDQQXODUYHORFLW\DQGURWDU\VSHHG0DLQWDLQPXGZHLJKW IURP±SSJIRULQVWDELOLW\03'PD\EHXVHGWRSUHYHQWF\FOLQJRQWKHIRUPDWLRQ*RRGILOWHUFDNH TXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFHRIORZJUDYLW\GULOOVRO LGVE\GLOXWLQJDVUHTXLUHGZLOODOOEH LPSRUWDQWLQPDLQWDLQLQJJRRGKROHFRQGLWLRQV ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKIUHVKZDWHUJHOSRO\PHUGULOOLQJIOXLG/61':%0WR SURSHUO\FRQGLWLRQWKHKROHIRUWKHIORDWHGOLQHUUXQ(QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJIOXLGDQQXODU YHORFLW\DQGDGMXVWLQJGULOOLQJSDUDPHWHUV&RQGLWLRQWKHPXGX VLQJGLOXWLRQVDVUHTXLUHGWRPDLQWDLQORZ JUDYLW\GULOOVROLGV:HLJKWXSWRSSJDW7'DQGDGMXVWWULSSLQJSDUDPHWHUVWRHQVXUHFOHDQKROH SULRUWRIORDWLQJWKH´OLQHUWRERWWRP03'ZLOOXVHGRQWKLVKROHVHFWLRQWRPLQLPL]HF\FOLQJDQG LPSURYHLQVWDELOLW\ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 9 of 23 Printed: 25-Aug-22 ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDQV\QWKHWLFEDVHGPXG1$)6%0WRPLWLJDWHZHOOERUH LQVWDELOLW\DQGWRSURSHUO\FRQGLWLRQWKHKROHIRUWKHOLQHUUXQ(QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJ IOXLGDQQXODUYHORFLW\7KHUHLVSRWHQWLDOIRUORVWFLUFXODWLRQVRHQVXUHDGHTXDWH/&0PDWHULDOLVDYDLODEOH RQORFDWLRQWRDGGUHVVDQ\XQH[SHFWHGORVVHV*RRGILOWHUFDNHTXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFH RIORZJUDYLW\GULOOVROLGVE\GLOXWLQJDVUHTXLUHGZLOODOOEHLPSRUWDQWLQPDLQWDLQLQJJRRGKROHFRQGLWLRQV 0LWLJDWHZHOOERUHLQVWDELOLW\ZLWK03'WDUJHWLQJaSSJ(0:DQG/RZHU6KDOHVSHFLILFPXGDGGLWLYHV :HLJKWXSDVQHHGHGDW´VKRHWRWKHJUHDWHURISSJ(0:IRUZHOOERUHLQVWDELOLW\PLWLJDWLRQ RUDVQHHGHGIRU.XSDUXN&SRUHSUHVVXUH 3URGXFWLRQ+ROH 7KH3URGXFWLRQLQWHUYDOZLOOEHGULOOHGZLWKDZDWHUEDVHGGULOOLQIOXLG)/2352:%0ZHLJKWHG DSSURSULDWHO\VRWKDW03'FDQSURYLGHDG\QDPLFRYHUEDODQFHRIaSSJ(0:ZKLOHUHGXFLQJWKHULVN RIORVWFLUFXODWLRQFUHDWHGE\KLJK(&'V7KHUHLVSRWHQWLDOIRUORVWFLUFXODWLRQVRHQVXUHDGHTXDWH/&0 PDWHULDOLVDYDLODEOHRQORFDWLRQWRDGGUHVVDQ\ORVVHV7KHUHLVDSRWHQWLDOIRUDEQRUPDOSUHVVXUHVR HQVXUHDGHTXDWHZHLJKWLQJPDWHULDOLVRQORFDWLRQWRZHLJKWXSDVQHHGHG.LOOZHLJKWEULQHZLOOEHSODFHG LQWKHZHOOSULRUWRSXOOLQJRXWRIKROH 3OHDVHUHIHUHQFHSLWGLDJUDPRQILOHIRU'R\RQ$OOGULOOLQJIOXLGSUDFWLFHVZLOOEHLQDFFRUGDQFHZLWK DSSURSULDWHUHJXODWLRQVVWDWHGLQ$$& $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) 1$$SSOLFDWLRQLVQRWIRUDQRIIVKRUHZHOO (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) (YLGHQFHRIERQGLQJIRU&RQRFR3KLOOLSV$ODVND,QFLVRQILOHZLWKWKH&RPPLVVLRQ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 10 of 23 Printed: 25-Aug-22 3URSRVHG'ULOOLQJ3URJUDP(Requirements of 20 AAC 25.005 (c)(13)) 7KHSURSRVHGGULOOLQJSURJUDPLVOLVWHGEHORZ3OHDVHUHIHUWR&RPSOHWLRQ6FKHPDWLF 0,58'R\RQRQWR&58&'RYHUSUHLQVWDOOHG´[´LQVXODWHGFRQGXFWRU 'HZDWHUFHOODUULJXSULVHU WHVWVDPH 3LFNXSHQRXJK´9;GULOOSLSHWRGULOO685)VHFWLRQDQGUDFNEDFN 0DNHXS´&RQGXFWRU&OHDQ2XW%+$&OHDQRXWFRQGXFWRU 0DNHXS´685)'ULOOLQJ%+$(LMWD Program: GR/DIR)VSXGZHOO GLUHFWLRQDOO\GULOO´KROHWR 685)7'HVWLPDWHGDW¶0'¶79'WRSVHWWLQJWKH&DQGDVSHUWKHGLUHFWLRQDOSODQ ±SSJ'5,/3/(;:%0ZLOOEHXVHGWRGULOOWKHVHFWLRQ &LUFXODWH FRQGLWLRQIORZFKHFNZHOODQG322+/D\GRZQ685)'ULOOLQJ%+$ 5XQQHZ´/716(5685)FDVLQJFHQWUDOL]HGDVSHUGHVLJQWRVHFWLRQ7'&LUFXODWH FRQGLWLRQ ODQGFDVLQJRQKDQJHUZLWKLQZHOOKHDGDQGEDFNRIIXSSHUKDOIRIODQGLQJMRLQW 3LFNXS 7,+ZLWKWKH685),QQHU6WULQJ%+$VWDELQWRWKHLQQHUVWULQJIORDWFROODUDQGHVWDEOLVKFLUFXODWLRQ &HPHQWWKH´685)FDVLQJWRVXUIDFHDVSHUWKHFHPHQWSURJUDPZLWK¶RISSJ&ODVV*WDLODQG SSJ'HHS&5(7(OHDGWRVXUIDFH%XPSLQQHUVWULQJGDUWVEOHHGSUHVVXUH FKHFNIORDWV a. CONTINGENCY: If cement is not brought to surface, notify AOGCC and prepare for top job. )ORZFKHFNZHOO1'IORZULVHU 18+35LVHU %23(ZLWKWKHIROORZLQJHTXLSPHQWFRQILJXUDWLRQ D ´$QQXODU8SSHU´[´9%5%OLQG6KHDU5DP/RZHU´[´9%5 7HVW%23(WRSVLORZSVLKLJK7HVWDQQXODUWRSVLORZSVLKLJK(Provide 48 hr. AOGCC notice) 3LFNXS 7,+ZLWKWKH´[´,1750'ULOOLQJ%+$(LMWD Program: GR/RES/DIR) a. CONTINGENCY: If unable to clean-out SURF casing shoe track with INTRM1 Drilling BHA, drill out SURF casing shoe track with dedicated SURF Casing Clean-Out BHA and perform FIT. &KDUW´685)FDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFN´UDWKROHDQG¶RIQHZKROH&LUFXODWH FRQGLWLRQ 3HUIRUP),7WRPLQLPXPSSJ(0: 'LVSODFHZHOOWRSSJ/61':%0 'LUHFWLRQDOO\GULOO´,17503LORW+ROHXQWLOWKHXQGHUUHDPHULVEHORZWKH´685)&DVLQJ6KRHDQGRSHQ WKHXQGHUUHDPHU 'LUHFWLRQDOO\GULOO´[´,1750+ROHSDVWWKH%DVH4DQQLN&LUFXODWHDPLQLPXP[ERWWRP¶VXSDQGIORZ FKHFNWKHZHOOWRGHWHUPLQHLIDGGLWLRQDORYHUEDODQFHLVQHHGHG 'LUHFWLRQDOO\GULOO´[´,1750+ROHWR,17507'DW¶0'¶79'DVSHUWKH GLUHFWLRQDOSODQ&LUFXODWH FRQGLWLRQZKLOHZHLJKWLQJXSDVQ HHGHGIRUDWULSPDUJLQ 2EVHUYHZHOOIRUIORZ 322+DQGOD\GRZQWKH´,1750'ULOOLQJ%+$ &KDQJH8SSHU´[´9%5VWR´6ROLG%RG\5DPV7HVWVDPHWRSVLORZSVLKLJK(Provide 48 hr. AOGCC notice) 5XQQHZ´3,&76+OLQHUFHQWUDOL]HGDVSHUGHVLJQ&LUFXODWH FRQGLWLRQSULRUWRH[LWLQJWKH 685)&DVLQJ6KRHDQGDJDLQEHIRUHPDNLQJXSWKH/LQHU+DQJHU 08WKH´[´,1750/LQHU+DQJHU5XQQLQJ7RRO$VVHPEO\DQG7,+ZLWKWKH´,1750OLQHUWRDERYH UDWKROH2QFHWKHUHFLUFXODWH FRQGLWLRQDVQHHGHGLQSUHSDUDWLRQIRUWKHFHPHQWMRE &HPHQWWKH´,1750OLQHUZLWKVXIILFLHQWSSJ([WHQGHG&ODVV*OHGWRSURYLGH¶LVRODWLRQDERYHWKH 7RS4DQQLNDQGD¶SSJWDLOWRWDFNWKH´,1750/LQHU6KRH%XPSSOXJVWRSVLRYHUFLUFXODWLQJ SUHVVXUHEOHHGSUHVVXUH FKHFNIORDWV a. CONTINGENCY: If cement is not circulated above the Qannik, drill, case, cement INTRM2. Intrm 1 is a drilling liner and will be covered by Intrm 2 long string. $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 11 of 23 Printed: 25-Aug-22 6HWWKH´[´7,:;3$./LQHU+DQJHU3HUIRUPRYHUSXOOWHVWWRFRQILUPKDQJHUVHW 3HUIRUP/LQHU7RSWHVWWRSVL 3LFNXSWRUHOHDVHUXQQLQJWRROVIURP/LQHU+DQJHU&LUFXODWH FRQGLWLRQ)ORZFKHFNZHOO 72+RQHOHYDWRUV/D\GRZQ,1750/LQHU5XQQLQJ7RROV &KDQJH´6ROLG%RG\5DPVEDFNWR´[´9%5V7HVWVDPHWRSVL(Provide 48 hr. AOGCC notice) 3LFNXS 7,+ZLWK´,1750&OHDQ2XW%+$WRWKH´,1750/LQHUWRS &LUFXODWH FRQGLWLRQGULOORXWSDFNRIIEXVKLQJEHORZ/LQHU+DQJHUFLUFXODWHERWWRP¶VXSDQGFRQWLQXH7,+ &KDUW´FDVLQJ[´OLQHUSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFN´[´UDWKROHDQG¶RIô´QHZKROH&LUFXODWH FRQGLWLRQ 3HUIRUP),7WRPLQLPXPSSJ(0: &LUFXODWH FRQGLWLRQREVHUYHZHOOIRUIORZDQG72+/D\GRZQWKH´,1750&OHDQ2XW%+$ 3LFNXS 7,+ZLWK´[´,1750'ULOOLQJ%+$WRWKH´,1750/LQHU6KRH(LMWD Program: GR/RES/DIR) 'LVSODFHWKHZHOOWRSSJ/61':%0 2SHQXQGHUUHDPHUDQGGLUHFWLRQDOO\GULOO´[´,1750KROHWR7'DW¶0' D 7KLVKROHVHFWLRQLVWKHXSSHUSDUWRIWKHRULJLQDOVWULQJ,17KROHVHFWLRQWKHGULOOLQJWULSSLQJRXWWLPH LVHVWLPDWHGWREHRYHUGD\V7RDYRLGWKHKLJKULVNRIVWXFNSLSH&RQRFR3KLOOLSVLVUHTXHVWLQJWR FRQWLQXHWKHDSSURYHG(YHQW%DVHG%23WHVWLQJVFKHGXOHIURPRULJLQDO,173HUIRUPIXOO%23WHVW RQFH%+$RXWRIKROH 322+DQGOD\GRZQ´[´,1750'ULOOLQJ%+$ &KDQJH8SSHU´[´9%5VWR´6ROLG%RG\5DPV7HVWVDPHWRSVLORZSVLKLJK (Provide 48 hr. AOGCC notice) )ORDWQHZ´/,&76+,1750&DVLQJFHQWUDOL]HGDVSHUGHVLJQWR7'DWWHPSWWRUXQRQ HOHYDWRUVDQGURWDWHRQO\LIQHHGHGWRPRYHSDVWDOHGJHRUWREUHDND[LDOIULFWLRQ &LUFXODWH FRQGLWLRQLQSUHSDUDWLRQIRUWKHFHPHQWMRE &HPHQWWKH´,1750OLQHUZLWKVXIILFLHQWSSJ&ODVV*WRWDFNWKH,1750FDVLQJVKRHZLWK¶79' VOXUU\ ,QVWDOOSDFNRIIDQGGLVSODFHWKH´[´[´DQQXOXVWRFRUURVLRQLQKLELWHGVHDZDWHUDQGGLHVHOIUHH]H SURWHFW &KDQJH´VROLGERG\UDPVEDFNWR´[´9%5V7HVWVDPHWRSVL(Provide 48 hr. AOGCC notice) 3LFNXS 7,+ZLWK´[´,1750'ULOOLQJ%+$(LMWD Program: GR/RES/NEU/DEN/SON/DIR) &KDUW´,1750FDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFN´[´UDWKROHDQG¶RIQHZ´KROH 3HUIRUP),7WRPLQLPXPSSJ(0: 'LVSODFHZHOOWRSSJ/61':%0 'LUHFWLRQDOO\GULOO[´QHZ,1750KROHWR7'¶79'EHORZWKH7RS+5=HVWLPDWHGDW¶0' ¶79' D 7KLVKROHVHFWLRQLVWKHORZHUSDUWRIWKHRULJLQDOVWULQJ,17KROHVHFWLRQWKHGULOOLQJWULSSLQJRXWWLPH LVHVWLPDWHGWREHRYHUGD\V7RDYRLGWKHKLJKULVNRIVWXFNSLSH&RQRFR3KLOOLSVLVUHTXHVWLQJWR FRQWLQXHWKHDSSURYHG(YHQW%DVHG%23WHVWLQJVFKHGXOHIURPRULJLQDO,173HUIRUPIXOO%23WHVW RQFH%+$RXWRIKROH &LUFXODWH FRQGLWLRQKROHZKLOHZHLJKWLQJXSWRSSJ2EVHUYHZHOOIRUIORZ 322+DQGOD\GRZQ[´,1750'ULOOLQJ%+$ &KDQJH8SSHU´[´9%5VWR´6ROLG%RG\5DPV7HVWVDPHWRSVLORZSVLKLJK (Provide 48 hr. AOGCC notice) $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 12 of 23 Printed: 25-Aug-22 )ORDW´/76+QHZ,1750/LQHUFHQWUDOL]HGDVSHUGHVLJQWR7'&HPHQWWKHVDPHZLWK SSJ&ODVV*WR¶79'DERYHWKHVKRH 6HWWKH/LQHU+DQJHU7HVWWKHEDFNVLGHWRSVLIRULQWHJULW\ 322+DQG/'OLQHUKDQJHUUXQQLQJWRRO &KDQJH8SSHUEDFNWR´[´9%5V7HVWVDPHWRSVLORZSVLKLJK(Provide 48 hr. AOGCC notice) 3UHVVXUHWHVWVWKH´OLQHUDQG´FDVLQJWRSVLIRUPLQXWHV 3LFNXS 7,+ZLWK´[´,1750'ULOOLQJ%+$(LMWD Program: GR/RES/NEU/DEN/SON/DIR) D 72&ZLOOEHORJJHGZLWK6RQLFWRRO 'LVSODFHZHOOWRSSJ1$)6%0 'ULOORXWVKRHWUDFNDQG¶RIQHZKROH3HUIRUP),7WRPLQLPXPSSJ(0: 'LUHFWLRQDOO\GULOO´[´KROHWRVHFWLRQ7'ZLWKLQWKH)LRUG:HVW.XSDUXN&DW¶0'¶79' XVLQJ03'WRWDUJHWSSJ(0:DW¶79' 622+WR´VKRH &LUFXODWH ZHLJKWXSWKHPXGWRSSJNLOOZHLJKW1$)6%0 )ORZFKHFN622+DQGOD\GRZQ´[´'ULOOLQJ%+$ 5XQQHZ´/76+,1750/LQHUWR7' &HPHQWWKH´OLQHUZLWKSSJWDLO&ODVV*WR¶79'DERYHWKHWRSRI.XSDUXN&UHVHUYRLU 6HWOLQHUKDQJHUDQGSHUIRUPSVLEDFNSUHVVXUHWHVW 322+DQG/'OLQHUKDQJHUUXQQLQJWRRO 3UHVVXUHWHVW´[´[´/LQHUSUHVVXUHWHVWWRSVLIRUPLQXWHV 3LFNXS 7,+ZLWK´352''ULOOLQJ$VVHPEO\(LMWD Program: GR/RES/NEU/DEN/DIR) 'LVSODFHZHOOWRQHZSSJ)/2352:%0 'ULOORXWVKRHWUDFN´[´UDWKROHDQG¶RIQHZKROH3HUIRUP),7WRPLQLPXPRISSJ(0: 3HUIRUPGUDZGRZQ:HLJKWXSPXGWRDERYHSRUHSUHVVXUH 'LUHFWLRQDOO\GULOOKROHWRWKH3URGXFWLRQ7'DW¶0'JHRVWHHULQJWRVWD\ZLWKLQWKH.XSDUXN&ZKLOH XVLQJ03'WRWDUJHW(0:DW´6KRH &LUFXODWH FRQGLWLRQ%522+WRWKH´,1750OLQHUVKRHDQGIXUWKHUDVQHHGHGWRFOHDQ XSWKHZHOO 6WULSLQEDFNWRERWWRP &LUFXODWH FRQGLWLRQGLVSODFHZHOOWRNLOOZHLJKWEULQHIORZFKHFN 72+/D\GRZQ´352''ULOOLQJ%+$ 5XQQHZ´/76+/LQHUZLWKSUHSHUIRUDWHGSXSVFHQWUDOL]HGDV SHUGHVLJQ 3LFNXSWKH´[´/LQHU+DQJHU3DFNHUZLWK5XQQLQJ7RRO$VVHPEO\WRWKH5LJ)ORRU0DNHXSWRWKH OLQHUKDQJHU 7,+ZLWK´352'/LQHUURWDWHDVQHHGHGWRUHGXFHD[LDOIULFWLRQDQGUXQWR7'&LUFXODWHDVQHHGHGWKURXJK WKHRSHQFLUFXODWLRQVXE :LWKWKHOLQHURQERWWRPVHWWKHOLQHUWRSSDFNHUDVSHUHTXLSPHQWVSHFV 5HOHDVHUXQQLQJWRROVSHUIRUPaSVLOLQHUWRSWHVWWRFRQILUPSDFNHU OLQHUEDUULHULQWHJULW\ 72+RQHOHYDWRUV/D\GRZQ352'/LQHU5XQQLQJ7RROV 5XQ´[´8SSHU&RPSOHWLRQZLWKVPDUWJDVOLIWPDQGUHOV6SDFHRXWSLFNXS ZLWKWKHDQQXODUFORVHGRQ ODQGLQJVWULQJVSRWGLHVHOIUHH]HSURWHFW/DQGWXELQJKDQJHU SUHVVXUHXSWRVHWSDFNHU&RQILUPFRQQHFWLYLW\ WRVPDUW*/0V ,QVWDOO%39DQGSUHVVXUHWHVWKDQJHUVHDOVWRSVLFKDUWWHVW 1LSSOHGRZQ%23( ,QVWDOOWXELQJKHDGDGDSWHUDVVHPEO\DQGWUHH3UHVVXUHWHVWVDPHWRSVLFKDUWWHVW5HPRYH%39 $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 13 of 23 Printed: 25-Aug-22 7HVWWXELQJDQGWXELQJFDVLQJDQQXOXVVHSDUDWHO\WRSVLPLQVFKDUWWHVWV 6KHDUFLUFXODWLRQYDOYHLQ*/0&LUFXODWHWXELQJWRGLHVHO IUHH]HSURWHFWDQQXOXV 6HW%39DQGVHFXUHZHOO5'02'R\RQ 32675,*±2SV D 3UHVVXUHXSWRFRQYHUWIORWDWLRQEDUULHUGLVN XQORDGZHOO 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) ,QFLGHQWDOIOXLGVGHYHORSHGIURP&'GULOOLQJRSHUDWLRQVZL OOEHKDXOHGWRWKH$OSLQH*ULQG ,QMHFW )DFLOLW\DQGLQMHFWHGLQWRWKHGHGLFDWHG&ODVVGLVSRVDOZHOO&'$RULIFRPSOHWHG&'$RQ&' 3DG %HFDXVHRIWKH´,QWHUPHGLDWH/LQHU+DQJHUEORFNLQJWKH´6XUIDFH&DVLQJ6KRH&'LVQRWD FDQGLGDWHIRUIXWXUHDQQXODUGLVSRVDO $WWDFKPHQWV Attachment 1 Cement Summary Attachment 2 Drilling Hazards Summary Attachment 3 Completion Schematic Attachment 4 Directional Plan $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 14 of 23 Printed: 25-Aug-22 Dͬds <KW ϮϲZ<ϱϰ͘ϱΖ ϯϬΗŽŶĚƵĐƚŽƌͲϭϱϬΖ ϵ͘ϱƉƉŐ ϰϬϬΖD'͘>͘ϭϱ͘ϱΖ ϮϰΗ^hZ&,ŽůĞ Z/>W>ytD Ϭ͘ϳϱͲϭ͘ϮϱΣ ϮϬΗϭϯϯη>ϴϬdͲZ &ŝŶĂůdƌŝƉKƵƚ ͬϭϬϬĨƚ ϭϬ͘ϬƉƉŐ ϭϬΣŝŶĐ ϭϯϬϴͬϭϯϬϰ ĂƐĞWĞƌŵ dKΛ^ƵƌĨĂĐĞ Z/>W>ytD ϯϰϭ͘ϳΣĂǌŝ ϮϱϮϮͬϮϰϲϬ ͲϯϬ ϮϰϳϳͬϮϰϮϬ ϯϯΣŝŶĐ ϮϵϭϬͬϮϳϵϳ ͲϮϬ ^ ϭ͘ϱͲϮΣ ϯϮϬϬͬϯϬϯϮ ͲϭϬ ϭϬ͘ϱͲϭϭ͘ϬƉƉŐ ͬϭϬϬĨƚ ϰϱϬϴͬϯϴϲϲ <Ͳϯ ϭϳΗ>ŝŶĞƌϴϴ͘ϭη &tWtD WϭϭϬ/,zϱϮϭ ϭ͘ϳϱΣͬϭϬϬĨƚ ϱϬϯϳͬϰϬϴϱ dK>ΛϮϯϮϳD&ŝŶĂůdƌŝƉKƵƚ dKΛϰϰϰϱͬϯϴϯϱ ϭϭ͘ϬƉƉŐ ϳϴΣŝŶĐ ϱϳϰϵͬϰϮϲϲ ^Ƶď<ͲϮtĞƚ^^ ϯϰϭ͘ϳΣĂǌŝ ϲϰϬϬͬϰϯϵϴ ϭϱͲϯͬϰΗǆϭϳͲϭͬϮΗ ƌŝůůŝŶŐ ϳϴΣŝŶĐ /EdZDϮ,ŽůĞ ϭϭ͘ϬƉƉŐ ϯϰϱ͘ϲΣĂǌŝ ϭϯͲϱͬϴΗĂƐŝŶŐ &tWtD ϭΣͬϭϬϬĨƚ DWƉƉůŝĞĚ ϭϭϰϰϴͬϱϰϭϵ ůďŝĂŶϵϳ ϭϭ͘ϬƉƉŐĞ &ŝŶĂůdƌŝƉKƵƚ dKΛϭϭϰϳϭͬϱϰϰϴ ϭϭ͘ϬƉƉŐ ϭϮϲϴϬͬϱϲϵϴ ϯ ϭϮͲϭͬϰΗǆϭϯͲϭͬϮΗ /EdZDϯ,ŽůĞ ƌŝůůŝŶŐ ϭϰϬϱϱͬϱϵϴϯ ůďŝĂŶϵϲ ϵϳͬϴΗ>ŝŶĞƌ ϭϭ͘ϬƉƉŐ &tWtD DWƉƉůŝĞĚ dK>ΛϭϮϱϯϬ ϭϮ͘ϱƉƉŐĞ ϭϲϭϯϲͬϲϰϭϰ ůďŝĂŶϵϱ &ŝŶĂůdƌŝƉKƵƚ dKΛϭϳϯϰϲͬϲϲϲϱ ϭϭ͘ϱƉƉŐ ϭϴϮϰϮͬϲϴϱϭ &^&tWtD ϳϴΣŝŶĐ ϭϴϯϱϲͬϲϴϳϰ dŽƉ,ZϭϴϱϱϬͬϲϵϭϱ ϯϰϱ͘ϲΣĂǌŝ ϴͲϭͬϮΗǆϭϬͲϭͬϰΗ ϬΣͬϭϬϬĨƚ ϭϴϱϱϰͬϲϵϭϱ /EdZDϰ,ŽůĞ hƉƉĞƌ<ĂůƵďŝŬ ϳϱͬϴΗ>ŝŶĞƌ ϭϴϴϴϲͬϲϵϴϬ Ϯϵ͘ϳη>ͲϴϬ,zϱϮϯ ϭϭ͘ϱ dK>ΛϭϴϰϬϬ E& ϴϴΣŝŶĐ DWƉƉůŝĞĚ ϯϮϱ͘ϲĂǌŝ dKΛϭϵϯϵϭͬϳϬϱϯ ϭϯ͘ϯͲϭϯ͘ϱƉƉŐĞ Ϭ͘ϳϱΣͬϭϬϬĨƚ ϮϬϭϬϵͬϳϭϬϭ DdůĞŶŐƚŚ ϴϵ͘ϲΣŝŶĐ <ƵƉĂƌƵŬϭ͕ϬϬϬΖD&ŝŶĂůdƌŝƉKƵƚ ϭϯ͘ϬͲϭϯ͘ϮƉƉŐƐŐ ϮϬϯϵϭͬϳϭϬϳ ϭϭ͘ϱƉƉŐK, ϲͲϯͬϰΗWZK,ŽůĞ ϰϭͬϮΗ>ŝŶĞƌ ϭϮ͘ϲηWͲϭϭϬ,zϱϲϯ ĂŬĞƌdK>ΛϮϬϮϰϭ &>KWZKtD ϴϵ͘ϲΣŝŶĐ ϯϮϱ͘ϲΣĂǌŝ ƌŝůůŝŶŐ ϭϬ͘ϴƉƉŐ &>KWZKtD dƌŝƉtƚ͘ϭϬ͘ϴƉƉŐ ϴϵ͘ϲΣŝŶĐ &>KWZKtD ϯϮϱ͘ϲΣĂǌŝ ϯϯϲϲϯͬϳϭϵϲ ;WŽƌĞWƌĞƐƐĞƉͿ ϬǌŝϯϲϬ WůĂŶ Ϭ/ŶĐϵϬ Dͬds'ĞŽdŽƉƐ ĂƐŝŶŐͬĞŵĞŶƚ ,ŽůĞͬĂƐŝŶŐ^ŝǌĞ DƵĚ &ƌĞƐŚǁĂƚĞƌďĂƐĞĚ WŽůǇĞƌDƵĚ;&tWͿ <ϭͲ>ŽǁĞƌ <ĂůƵďŝŬ ϭϳͲϭͬϮΗǆϮϬΗ /EdZDϭ,ŽůĞ ϲϮ͘ϴη>ͲϴϬ,zϱϲϯ <ͲϮ;YĂŶŶŝŬͿ ϴϴ͘Ϯη>ͲϴϬ/ ,zϱϲϯ /ŶŝƚŝĂů ŝƐƉůĂĐĞŵĞŶƚ ϭϬ͘ϬƉƉŐ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 15 of 23 Printed: 25-Aug-22 $WWDFKPHQW±&HPHQW6XPPDU\ ´6XUIDFH&DVLQJWR¶0'¶79' &HPHQWIURP¶WR 0'¶ZLWKSSJ&ODVV*WDLODQGIURP WRVXUIDFHZLWK SSJ'HHS&5(7(OHDG$VVXPHH[FHVVDQQXODUYROXPHLQ3H UPDIURVWH[FHVVEHORZ WKH3HUPDIURVWDQGQRH[FHVVZLWKLQWKH´FRQGXFWRU /HDG6OXUU\IURP¶0'WR6XUIDFHZLWKSSJ'HHS&5(7( &RQGXFWRU ¶±¶;IWIW;H[FHVV IW 3HUPDIURVWWR&RQGXFWRU ¶±¶;IWIW;H[FHVV IW 7RSRI7DLOWR3HUPDIURVW ¶±¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ'HHS&5(7(#IWVN 7DLO6OXUU\IURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI7DLO ¶±;IWIW;H[FHVV IW 6KRH-RLQWV ¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN ´,QWHUPHGLDWH/LQHUWR¶0'¶79' &HPHQWIURP¶WR¶0'¶ZLWKSSJ&ODVV*WDLODQGIURP¶WR¶79'! ¶0'DERYHWKHWRSRIWKH.4DQQLNUHVHUYRLUZLWKSSJ([WHQGHG&ODVV*OHDGDVVXPLQJ H[FHVVDQQXODUYROXPH /HDG6OXUU\IURP0'WR¶0'ZLWKSSJ([WHQGHG&ODVV*DGGLWLYHV 7RSRI7DLOWR¶79'$ERYH .4DQQLN7RSDW¶0'¶±¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ([WHQGHG&ODVV*DGGLWLYHV#IWVN 7DLO6OXUU\IURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI7DLO ¶±¶;IWIW;H[FHVV IW 6KRH-RLQWV¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 16 of 23 Printed: 25-Aug-22 ´,QWHUPHGLDWH&DVLQJWR¶0'¶79' &HPHQWIURP¶WR¶79'DERYHOLQHUVKRH ZLWKSSJ&ODVV*DVVXPLQJH[FHVV DQQXODUYROXPH &HPHQWIURP0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI&HPHQW ¶±¶;IWIW;H[FHVV IW 6KRH-RLQW ¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN ´,QWHUPHGLDWH/LQHUWR¶0'¶79' &HPHQWIURP¶WR¶79'DERYHWKH.XSDUXN&ZLWKSSJ&ODVV*DVVXPLQJH[FHVV DQQXODUYROXPH &HPHQWIURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI&HPHQW ¶±¶;IWIW;H[FHVV IW 6KRH-RLQW ¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN ´,QWHUPHGLDWH/LQHUWR¶0'¶79' *Due to high angle and short open hole section the required 250’ TVD TOC is above our liner hanger and in the shoe of the 9 7/8” casing. This is a high risk as our liner hanger is set against the plugs. If the plugs don’t bump we have to wait on cement. Intrm 4 is a drilling liner. A cement Intrm 3 shoe and Intrm 4 packer test provide isolation of the formation. &23UHTXHVWWRXVHWKH¶0'ࡱRSHQKROHYROXPH &HPHQWIURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI&HPHQW ¶±¶;IWIW;H[FHVV IW 6KRH-RLQW¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 17 of 23 Printed: 25-Aug-22 $WWDFKPHQW±'ULOOLQJ+D]DUGV6XPPDU\ 7REHSRVWHGLQ5LJ)ORRU'RJKRXVH3ULRUWR6SXG +ROH´&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ &RQGXFWRU%URDFK/RZ0RQLWRUFHOODUFRQWLQXRXVO\GXULQJLQWHUYDO :HOO&ROOLVLRQ +LJK &ORVHO\PRQLWRUWUDYHOLQJF\OLQGHUXSGDWHDV QHHGHG8WLOL]HJ\URHTXLSPHQWDVQHHGHGWRYHULI\ ZHOOERUHORFDWLRQ&ORVHO\IROORZ&3$,$QWL &ROOLVLRQSROLFLHV6KXWLQRIIVHWZHOOVDVUHTXLUHG 5LJXSGLYHUWHUIRUFROOLVLRQULVNPLWLJDWLRQ *DV+\GUDWHV /RZ 'LYHUWHUGULOOVDQGLIREVHUYHG±FRQWUROGULOOUHGXFH SXPSUDWHVDQGFLUFXODWLQJWLPHUHGXFHPXG WHPSHUDWXUHV6KDOORZKD]DUGVWXG\QRWHGPLQLPDO ULVNRQ&'SDG $EQRUPDO3UHVVXUHLQ 6XUIDFH)RUPDWLRQV/RZ'LYHUWHUGULOOVLQFUHDVHGPXGZHLJKW6KDOORZ KD]DUGVWXG\QRWHGPLQLPDOULVNRQ&'SDG $EQRUPDO3UHVVXUHLQ& &'$QQXODU,QMHFWLRQ/RZ 7RSVHW&IRUPDWLRQ1RDQQXODULQMHFWLRQ SHUIRUPHGRQSDGVLQFHQRUDEQRUPDO SUHVVXUHHQFRXQWHUHGLQ&RQ&' &OD\%DOOLQJ +LJK 0DLQWDLQSODQQHGPXGSDUDPHWHUVDQGIORZUDWHV 8VHSURDFWLYHDQWLEDOOLQJVZHHSVDQGPXG SURGXFWDGGLWLRQV /RVW&LUFXODWLRQ /RZ 5HGXFHSXPSUDWHVPXGUKHRORJ\DGGORVW FLUFXODWLRQPDWHULDO FRQWUROSLSHUXQQLQJVSHHGV ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVPRQLWRU UHDOWLPH(&'VDGMXVWPXGUKHRORJ\DQGDGGORVW FLUFXODWLRQPDWHULDODVQHHGHG $EQRUPDO3UHVVXUHLQ 4DQQLN+LJK (PSOR\4DQQLN3UHVVXUH0DQDJHPHQW3ODQ 3HUIRUPZHOOFRQWUROGULOOVIORZFKHFNDVQHHGHG 03'ILQJHUSULQWLISRVVLEOHLQFUHDVHPXGZHLJKW $EQRUPDO3UHVVXUHLQ 2YHUEXUGHQ)RUPDWLRQV/RZ3HUIRUPZHOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVDQGLQFUHDVHPXGZHLJKWDVQHHGHG +ROH&OHDQLQJ /RZ 0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO DQGXVHEHVWKROHFOHDQLQJSUDFWLFHVDQG EDFNUHDPWRFOHDQKROHSULRUWROLQHUUXQ 6ZDEELQJRQ7ULSV 0HGLXP 5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV PRQLWRUKROHILOOSXPSRXWRIKROHPRQLWRUUHDOWLPH (&'VDQGXVH03'LISRVVLEOH 'LIIHUHQWLDO6WLFNLQJ 0HGLXP 0RQLWRUIRUVHHSDJHORVVHVPRQLWRUVWDWLF7 ' IRUFHVUXQ/&0DVQHHGHGDQGHPSOR\SURSHU FHQWUDOL]DWLRQWRSURYLGHVHPLIOXVKOLQHUVWDQGRII 4DQQLN&HPHQW,VRODWLRQ0HGLXP &HQWUDOL]HIRU!6WDQG2IIXVH/HDG7DLO VOXUU\GHVLJQWRUHGXFH(&'VFUHDWHPXGVSDFHU VOXUU\WUDLQWRDOORZHIIHFWLYHGLVSODFHPHQWDQGEH SUHSDUHGIRUOLQHUWRSVTXHH]HFRQWLQJHQF\ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 18 of 23 Printed: 25-Aug-22 ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ +ROH&OHDQLQJ /RZ 0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO XVHEHVWKROHFOHDQLQJSUDFWLFHVDQGEDFNUHDPWR FOHDQKROHSULRUWROLQHUUXQ %+$)DLOXUH 0HGLXP3URDFWLYHO\SODQ%+$WULSWRDOORZIRUWRROZHDU HYDOXDWLRQDQGPRQLWRUVKRFNDQGYLEUDWLRQ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG &DVLQJ:HDU 0HGLXP0RGHOSUHYLRXVOLQHUFDVLQJZHDUKDYH15'33V DYDLODEOH XVH&3$,FDVLQJZHDUEHVWSUDFWLFHV 6WXFN3LSH 0HGLXP 8VHJRRGGULOOLQJSUDFWLFHVPRQLWRU7 'WUHQGV UXQ%+$GLVFRQQHFWVXELIQHFHVVDU\KDYHILVKLQJ NLWSUHLGHQWLILHG 'LIIHUHQWLDO6WLFNLQJ 0HGLXP 0RQLWRUIRUVHHSDJHORVVHVUXQ/&0DVQHHGHG PRQLWRUVWDWLF7 'IRUFHVFHQWUDOL]HOLQHUDV QHHGHGWRSUHYHQWGLIIHUHQWLDOVWLFNLQJ )ORDWHG/LQHU5XQ +LJK (PSOR\&'DQG&'/HVVRQV/HDUQHG LPSOHPHQWIORWDWLRQVSHFLILFZHOOFRQWUROGULOOV XVH IORDWHGOLQHUGHFLVLRQWUHHIRULVVXHVHQFRXQWHUHG ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ +ROH&OHDQLQJ /RZ 0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO XVHEHVWKROHFOHDQLQJSUDFWLFHVDQGEDFNUHDPWR FOHDQKROHSULRUWROLQHUUXQ %+$)DLOXUH 0HGLXP3URDFWLYHO\SODQ%+$WULSWRDOORZIRUWRROZHDU HYDOXDWLRQDQGPRQLWRUVKRFNDQGYLEUDWLRQ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG &DVLQJ:HDU 0HGLXP0RGHOSUHYLRXVOLQHUFDVLQJZHDUKDYH15'33V DYDLODEOH XVH&3$,FDVLQJZHDUEHVWSUDFWLFHV 6WXFN3LSH 0HGLXP 8VHJRRGGULOOLQJSUDFWLFHVPRQLWRU7 'WUHQGV UXQ%+$GLVFRQQHFWVXELIQHFHVVDU\KDYHILVKLQJ NLWSUHLGHQWLILHG 'LIIHUHQWLDO6WLFNLQJ 0HGLXP 0RQLWRUIRUVHHSDJHORVVHVUXQ/&0DVQHHGHG PRQLWRUVWDWLF7 'IRUFHVFHQWUDOL]HOLQHUDV QHHGHGWRSUHYHQWGLIIHUHQWLDOVWLFNLQJ )ORDWHG/LQHU5XQ +LJK (PSOR\&'DQG&'/HVVRQV/HDUQHG LPSOHPHQWIORWDWLRQVSHFLILFZHOOFRQWUROGULOOV XVH IORDWHGOLQHUGHFLVLRQWUHHIRULVVXHVHQFRXQWHUHG $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 19 of 23 Printed: 25-Aug-22 ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ :HOOERUH,QVWDELOLW\ +LJK ,VRODWHGLQVWDEOHVKDOHVZLWKGHGLFDWHGKROH VHFWLRQHPSOR\&'DQG&'LQVWDELOLW\ PLWLJDWLRQVXQGHUUHDPHUSURSHU(0:WRSUHYHQW VKHDUIDLOXUH03' LQKLELWHGIOXLGPRQLWRUUHDO WLPHGULOOLQJGDWD8VH&3$,/RZHU6KDOHLQVWDELOLW\ PLWLJDWLRQGULOOLQJEHVWSUDFWLFHV /RVW&LUFXODWLRQ +LJK 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG8VH03'WRUHGXFH(&'V $EQRUPDO5HVHUYRLU 3UHVVXUH+LJK :HOOFRQWUROGULOOVIORZFKHFNGXULQJFRQQHFWLRQV XVH03'WRILQJHUSULQWSURYLGHG\QDPLF RYHUEDODQFHLQFUHDVHPXGZHLJKWDVQHHGHGWR PDLQWDLQRYHUEDODQFHGXULQJWULSSLQJDFWLYLWLHV /DQGLQJLQ7KLQ.XSDUXN&+LJK 8VH&'DQG&'GDWDWRUHGXFHGHSWK XQFHUWDLQW\8VH8OWUD'HHS$]LPXWKDO5HVLVWLYLW\ WRLGHQWLI\.XSDUXN&DQGDVVLVWZLWKDGMXVWLQJ ODQGLQJ 6ZDEELQJRQ7ULSV 0HGLXP 5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ XVH03'LISRVVLEOH &HPHQWDURXQGOLQHU KDQJHUIURP¶79' UHJXDOWLRQ +LJK 'XHWRKLJKDQJOHDQGVKRUWRSHQKROHVHFWLRQWKH UHTXLUHG¶79'72&LVDERYHRXUOLQHUKDQJHU DQGLQWKHVKRHRIWKH´FDVLQJ7KLVLVDKLJK ULVNDVRXUOLQHUKDQJHULVVHWDJDLQVWWKHSOXJV,I WKHSOXJVGRQ¶WEXPSZHKDYHWRZDLWRQFHPHQW 5HGXFHFHPHQWFROXPQWR¶0'RURIWKH RSHQKROHYROXPH %DULWH6DJ +LJK 8VHXOWUDILQHEDULWHWRUHGXFHVDJULVN(PSOR\ EDULWHVDJPLWLJDWLRQEHVWSUDFWLFHV ´+ROH´3UH3HUIRUDWHG/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG8VH03'WRUHGXFH(&'V $EQRUPDO5HVHUYRLU 3UHVVXUH+LJK :HOOFRQWUROGULOOVIORZFKHFNGXULQJFRQQHFWLRQV XVH03'WRILQJHUSULQWSURYLGHG\QDPLF RYHUEDODQFHLQFUHDVHPXGZHLJKWDVQHHGHGWR PDLQWDLQRYHUEDODQFHGXULQJWULSSLQJDFWLYLWLHV 6WD\LQJLQ.XSDUXN&+LJK 8VHJHRVWHHULQJEHVWSUDFWLFHVIURPRIIVHW1DQXT .XSDUXN&XVH'HHS5HDGLQJ$]LPXWKDO 5HVLVWLYLW\WRROWRDVVLVWZLWKUHVHUYRLU LQWHUSUHWDWLRQDQGFUHDWHGHFLVLRQWUHHUHVSRQGLQJ WRIRUUHVHUYRLUH[FXUVLRQV :HOOERUH,QVWDELOLW\+LJK (PSOR\&'DQG&'LQVWDELOLW\ PLWLJDWLRQVXQGHUUHDPHUSURSHU(0:WRSUHYHQW VKHDUIDLOXUH03' LQKLELWHGIOXLGPRQLWRUUHDO WLPHGULOOLQJGDWD8VH&3$,/RZHU6KDOHLQVWDELOLW\ PLWLJDWLRQGULOOLQJEHVWSUDFWLFHV %DULWH6DJ+LJK8VHZHLJKWHGNLOOZHLJKWEULQHIRUWULSSLQJ RSHUDWLRQV $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 20 of 23 Printed: 25-Aug-22 6ZDEELQJRQ7ULSV 0HGLXP 5HGXFHWULSVSHHGVXVHZHLJKWHGNLOOZHLJKWEULQH WRUHGXFHVZDESUHVVXUHPRQLWRUWULSWDQNV XVH 03'LISRVVLEOH :HOO3UR[LPLW\5LVNV &'ZLOOEHWKHVHYHQW\VHYHQWKWKZHOOGULOOHGRQWKHSDG'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFH LQIRUPDWLRQDVUHTXLUHGE\$&&ELVSURYLGHGLQWKH IROORZLQJDWWDFKPHQWV 'ULOOLQJ$UHD5LVNV 4DQQLN .XSDUXN&5HVHUYRLU3UHVVXUH2IIVHWLQMHFWLRQKDVWKHSRWHQWLDOWRLQFUHDVHWKHUHVHUYRLU SUHVVXUH+HLJKWHQHGDZDUHQHVVDQGJRRGZHOOFRQWUROSUDFWLFHVZLOOEHXVHGWRSUHYHQWDZHOOFRQWURO VFHQDULR,IDZHOOFRQWUROVFHQDULRLVHQFRXQWHUHGZHOOFRQWUROGULOOVZLOOEHXVHGWRUHGXFHVKXWLQWLPHV DQGHQRXJKNLOOZHLJKWPDWHULDOZLOOEHRQORFDWLRQWRNLOOWKHZHOODVUHTXLUHG :HDN2YHUEXUGHQ6DQG6WULQJHUV±&OHDQVDQGVWULQJHUVIURPVORSHGHSRVLWVZHUHLQWHUPLWWHQWO\ GHSRVLWHGRQWKHVORSHVKHOYHVRIWKH7RURNDQG$OELDQ7KHVHFOHDQVDQGVKDYHUHGXFHGIUDFWXUH JUDGLHQWVUHODWLYHWRWKHVLOWVDQGFOD\VWKDWPDNHXSPRVWRIWKHRYHUEXUGHQ/&0PDWHULDOZLOOEH DYDLODEOHWRPLWLJDWHORVVHVLQWKHLQWHUPHGLDWHVHFWLRQV /RZHU6KDOH6WDELOLW\7KH+5=DQG.DOXELNLQWKH,QWHUPHGLDWHKROHVHFWLRQZLOOUHTXLUHKLJKHUPXG ZHLJKWVWKDQKLVWRULFDOO\XVHGWRHQKDQFHZHOOERUHVWDELOLW\0DQDJHG3UHVVXUH'ULOOLQJZLOOEHXVHGLQ FRQMXQFWLRQZLWKDVWULQJFDVLQJGHVLJQWRPLWLJDWH+5= .DOXELNVKDOHLQVWDELOLW\/&0PDWHULDODQG ZHOOERUHVWUHQJWKHQLQJSLOOVDUHH[SHFWHGWREHHIIHFWLYHLQGHDOLQJZLWKORVWFLUFXODWLRQDVUHTXLUHGWR PDLQWDLQVXIILFLHQWRYHUEDODQFHIRUZHOOERUHLQVWDELOLW\PLWLJD WLRQ )RUDOOVHFWLRQVJRRGWULSSLQJSUDFWLFHVZLOOEHVWUHVVHGWRPLQLPL]HWKHSRWHQWLDORIWDNLQJVZDEEHGNLFNV $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&'6DYHG$XJ CRU CD2-361 AOGCC APD Page 21 of 23 Printed: 25-Aug-22 $WWDFKPHQW±&RPSOHWLRQ6FKHPDWLF $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 22 of 23 Printed: 25-Aug-22 $WWDFKPHQW±3URSHUW\3ODW 6XSHUVHGHG 6)' $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG$XJ CRU CD2-361 AOGCC APD Page 23 of 23 Printed: 25-Aug-22 $WWDFKPHQW±'LUHFWLRQDO3ODQ&' &'ZS 2EMHFWLYH3ODQQHGILQDOZHOOSDWKIRU)LRUG:HVW.XSDUXNSUHSURGXFHGLQMHFWRU&' SURGXFHU6)' &'ZS3ODQ6XPPDU\ 'RJOHJ6HYHULW\ 0HDVXUHG'HSWK [ [ [ [ [ [ $]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XV IWLQ@ &'3% &' &' &' &' &' &' ZS 7UXH9HUWLFDO'HSWK 9HUWLFDO6HFWLRQDW [ [ [ [ [ [ &HQWUHWR&HQWUH6HSDUDWLRQ 0HDVXUHG'HSWK (TXLYDOHQW0DJQHWLF'LVWDQFH '', 6859(< 352*5$0 'DWH79DOLGDWHG<HV9HUVLRQ 'HSWK)URP 'HSWK 7R 6XUYH\3ODQ 7RRO &'ZS&' *<'*&66 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*06 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*0 6 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*0 6 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*0 6 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*06 *URXQG &$6,1* '(7$,/6 79'0'1DPH [ [ [ [ [ [ 0DJ0RGHO 'DWH %**0 1RY 0DJQHWLF1RUWKLV(DVWRI7UXH1RUWK0DJQHWLF'HFOLQDWLR 0DJ'LS )LHOG6WUHQJWK Q7 6(&7,21 '(7$,/6 6HF 0' ,QF $]L 79' 16 (: 'OHJ 7)DFH 96HFW 7DUJHW $QQRWDWLRQ 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUWKROGDW0' 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUWKROGDW0' 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW'/67)2 6WDUWKROGDW0' 6WDUW'/67)2 &'7$& 6WDUW'/67)2 6WDUWKROGDW0' 6WDUW'/67)2 6WDUWKROGDW0' &'7+ 6WDUWKROGDW0' 6WDUW'/67)2 6WDUWKROGDW0' &'77 7'DW )250$7,21723'(7$,/6 79'3DWK )RUPDWLRQ %DVH)UR]HQ6DQG %DVH3HUP & & & & . 7RS4DQQLN. %DVH4DQQLN.%DVH 7RS.:HW6DQG %DVH.:HW6DQG $OE $OE $OE )&6 +5=,QVLWX 8SSHU.DOXELN /RZHU.DOXELN. .XS& %\VLJQLQJWKLV,DFNQRZOHGJHWKDW,KDYHEHHQLQIRUPHGRIDOOULVNVFKHFNHGWKDWWKHGDWDLVFRUUHFWHQVXUHGLW VFRPSOHWHQHVVDQGDOOVXUURXQGLQJZHOOVDUHDVVLJQHGWRWKHSURSHUSRVLWLRQDQG,DSSURYHWKHVF DQDQGFROOLVLRQDYRLGDQFHSODQDVVHWRXWLQWKHDXGLWSDFN,DSSURYHLWDVWKHEDVLLV IRUWKHILQDOZHOOSODQDQGZHOOVLWHGUDZLQJV,DOVRDFNQRZOHGJHWKDWXQOHVVQRWLILHGRWKHUZLVHDOOWDUJHWVKDYHDIHHWODWHUDOWROHUDQFH 3UHSDUHGE\&KHFNHGE\$FFHSWHGE\$SSURYHGE\ 3ODQ#XVIW'R\RQ 7UXH9HUWLFDO'HSWK 9HUWLFDO6HFWLRQDW[[[[[[&'ZS%DVH)UR]HQ6DQG%DVH3HUP&&&&.7RS4DQQLN.%DVH4DQQLN.%DVH7RS.:HW6DQG%DVH.:HW6DQG$OE$OE$OE)&6+5=,QVLWX8SSHU.DOXELN/RZHU.DOXELN..XS&&'ZS-XO\6HFWLRQ9LHZ 0500010000150002000025000South(-)/North(+)-25000 -20000 -15000 -10000 -5000 0 5000 10000West(-)/East(+)20 x 2417 x 17-1/2 - 2013-5/8 x 14-3/4 - 17-1/29 7/8 x 12-1/4 - 13-1/27-5/8 x 8-1/2 - 10-1/44 1/2 x 6-3/4CD2-361 wp19.3While drilling production section, stay within 100 feet laterally of plan, unless notified otherwise.9:33, July 15 20223ODQ9LHZ Alaska Oil and Gas Conservation Commission 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov Chris Brillon Wells Engineering Manager ConocoPhillips Alaska, Inc. PO Box 100360 Anchorage, AK, 99510-0360 Re: Colville River Field, Alpine Oil Pool, CRU CD2-361 ConocoPhillips Alaska, Inc. Permit to Drill Number: 221-116 Surface Location: 2181’ FNL, 1770’ FEL, Sec. 2, T11N, R4E, Umiat Bottomhole Location: 2112’ FNL, 28’ FEL, Sec. 8, T12N, R4E, Umiat Dear Mr. Brillon: Enclosed is the approved application for the permit to drill the above referenced well. This permit to drill does not exempt you from obtaining additional permits or an approval required by law from other governmental agencies and does not authorize conducting drilling operations until all other required permits and approvals have been issued. In addition, the AOGCC reserves the right to withdraw the permit in the event it was erroneously issued. Operations must be conducted in accordance with AS 31.05 and Title 20, Chapter 25 of the Alaska Administrative Code unless the AOGCC specifically authorizes a variance. Failure to comply with an applicable provision of AS 31.05, Title 20, Chapter 25 of the Alaska Administrative Code, or an AOGCC order, or the terms and conditions of this permit may result in the revocation or suspension of the permit. Sincerely, Jeremy M. Price Chair DATED this ___ day of January, 2022. Jeremy Price Digitally signed by Jeremy Price Date: 2022.01.20 17:47:39 -09'00' D7\SHRI:RUN E3URSRVHG:HOO&ODVV ([SORUDWRU\*DV 6HUYLFH:$* 6HUYLFH'LVS F6SHFLI\LIZHOOLVSURSRVHGIRU 'ULOO /DWHUDO 6WUDWLJUDSKLF7HVW 'HYHORSPHQW2LO 6HUYLFH:LQM 6LQJOH=RQH &RDOEHG*DV *DV+\GUDWHV 5HGULOO 5HHQWU\ ([SORUDWRU\2LO 'HYHORSPHQW*DV 6HUYLFH6XSSO\ 0XOWLSOH=RQH *HRWKHUPDO 6KDOH*DV 2SHUDWRU1DPH %RQG %ODQNHW 6LQJOH:HOO :HOO1DPHDQG1XPEHU %RQG1R $GGUHVV 3URSRVHG'HSWK )LHOG3RROV 0' 79' D/RFDWLRQRI:HOO*RYHUQPHQWDO6HFWLRQ 3URSHUW\'HVLJQDWLRQ 6XUIDFH 7RSRI3URGXFWLYH+RUL]RQ '15$SSURYDO1XPEHU $SSUR[LPDWH6SXG'DWH 7RWDO'HSWK$FUHVLQ3URSHUW\'LVWDQFHWR1HDUHVW3URSHUW\ WR$'/ E/RFDWLRQRI:HOO6WDWH%DVH3ODQH&RRUGLQDWHV1$' .%(OHYDWLRQDERYH06/IW 'LVWDQFHWR1HDUHVW:HOO2SHQ 6XUIDFH[\=RQH WR6DPH3RRO WR7HPSWDWLRQ$ 'HYLDWHGZHOOV .LFNRIIGHSWK IHHW 0D[LPXP3RWHQWLDO3UHVVXUHVLQSVLJVHH$$& 0D[LPXP+ROH$QJOH GHJUHHV 'RZQKROH 6XUIDFH +ROH &DVLQJ :HLJKW *UDGH &RXSOLQJ /HQJWK 0' 79' 0' 79' ; :HOGHG / 716(5 3,& 716: /,& 716: / 716: V[SSJ&ODVV*7DLO / 716: V[SSJ&ODVV*7DLO / 716: 35(6(17:(//&21',7,216800$5<7REHFRPSOHWHGIRU5HGULOODQG5H(QWU\2SHUDWLRQV -XQNPHDVXUHG 79' +\GUDXOLF)UDFWXUHSODQQHG" <HV 1R $WWDFKPHQWV 3URSHUW\3ODW %236NHWFK 'ULOOLQJ3URJUDP 7LPHY'HSWK3ORW 6KDOORZ+D]DUG$QDO\VLV 'LYHUWHU6NHWFK 6HDEHG5HSRUW 'ULOOLQJ)OXLG3URJUDP $$&UHTXLUHPHQWV &RQWDFW1DPH 0DWW:LHQV &KULV%ULOORQ &RQWDFW(PDLO0DWW5:LHQV#&RQFR3KLOOLSVFRP :HOOV(QJLQHHULQJ0DQDJHU &RQWDFW3KRQH 'DWH 3HUPLWWR'ULOO $3,1XPEHU 3HUPLW$SSURYDO 1XPEHU'DWH &RQGLWLRQVRIDSSURYDO ,IER[LVFKHFNHGZHOOPD\QRWEHXVHGWRH[SORUHIRUWHVWRUSURGXFHFRDOEHGPHWKDQHJDVK\GUDWHVRUJDVFRQWDLQHGLQVKDOHV 6DPSOHVUHT G<HV1R 0XGORJUHT G<HV1R +6PHDVXUHV<HV1R 'LUHFWLRQDOVY\UHT G<HV1R 6SDFLQJH[FHSWLRQUHT G<HV1R ,QFOLQDWLRQRQO\VY\UHT G<HV1R 3RVWLQLWLDOLQMHFWLRQ0,7UHT G<HV1R $33529('%< $SSURYHGE\ &200,66,21(5 7+(&200,66,21 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ &58&' &ROYLOOH5LYHU)LHOG $OSLQH2LO3RRO &HPHQW4XDQWLW\FIRUVDFNV &RPPLVVLRQ8VH2QO\ 6HHFRYHUOHWWHUIRURWKHU UHTXLUHPHQWV 7RWDO'HSWK0'IW 7RWDO'HSWK79'IW 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 3(50,772'5,// $$& V[SSJ([WHQGHG&ODVV* /HDGV[SSJ&ODVV*7DLO )1/ )(/6HF715(80 )1/ )(/6HF715(80 /216 32%R[$QFKRUDJH$. &RQRFR3KLOOLSV )1/ )(/6HF715(80 $'/$'/$'/$$ $'/$'/$'/$'/ $'/ &DVLQJ3URJUDP 7RS6HWWLQJ'HSWK%RWWRP6SHFLILFDWLRQV &HPHQW9ROXPH 0'6L]H 3OXJVPHDVXUHG LQFOXGLQJVWDJHGDWD \GV6OXUU\ V[SSJ'HHS&5(7(/HDG V[SSJ&ODVV*7DLO &RQGXFWRU6WUXFWXUDO /HQJWK&DVLQJ $XWKRUL]HG7LWOH $XWKRUL]HG6LJQDWXUH 3URGXFWLRQ /LQHU ,QWHUPHGLDWH $XWKRUL]HG1DPH ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEH GHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO 6XUIDFH 3HUIRUDWLRQ'HSWK79'IW */%)(OHYDWLRQDERYH06/IW 3HUIRUDWLRQ'HSWK0'IW V[SSJ&ODVV*7DLO 8QFHPHQWHG/LQHU%HQHDWK3DFNHU (IIHFW'HSWK0'IW (IIHFW'HSWK79'IW 6WUDWLJUDSKLF7HVW 1R 0XGORJUHT G<HV1R 1R 'LUHFWLRQDOVY\UHT G<HV1R 6HDEHG5HSRUW'ULOOLQJ)OXLG3URJUDP $$&UHTXLUHPHQWV %236NHWFK'ULOOLQJ3URJUDP 7LPHY'HSWK3ORW 6KDOORZ+D]DUG$QDO\VLV 6LQJOH:HOO *DV+\GUDWHV 1R ,QFOLQDWLRQRQO\VY\UHT G<HV1R ([SORUDWRU\2LO 'HYHORSPHQW*DV 6HUYLFH6XSSO\0XOWLSOH=RQH *HRWKHUPDO 1R 1R )RUP5HYLVHG7KLVSHUPLWLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDOSHU$$&J By Samantha Carlisle at 12:06 pm, Dec 29, 2021 'LJLWDOO\VLJQHGE\&KULV%ULOORQ '1& 8628 :HOOV(QJLQHHULQJ2 &RQRFR3KLOOLSV$ODVND&1 &KULV%ULOORQ ( FKULVOEULOORQ#FRQRFRSKLOOLSVFRP 5HDVRQ,DPDSSURYLQJWKLVGRFXPHQW /RFDWLRQ$QFKRUDJH$ODVND 'DWH )R[LW3')(GLWRU9HUVLRQ &KULV%ULOORQ X may require a cement quality log specified by AOGCC BOP test pressure to 4000 psig Annular preventer pressure to 2500 psig A variance to 20 AAC 25.035(c)(1)(B) is granted. Doyon 26 may use the 16" diameter diverter line based on meeting all the requirements in OTH-17-048(attached) BOP testing frequency is two weeks. A variance for an event based BOP test frequency is approved as attached in Conditions of Approval.(20 AAC 25.035(h) LOT/FIT results transmitted to AOGCC as soon as available. Indications of improper cementing may require a cement quality log. (20 AAC 25.030(d)(5)) Results of cement job and interpretation submitted to AOGCC as soon as available. A sonic log may be used per conditions of approval attached, however any indications of improper cementing DSR-1/3/22VTL 01/20/22 X X X 221-116 X X X SFD 12/30/2021 50-103-20836-00-00 X dts 1/20/2022 JLC 1/20/2022 1/20/2022 Jeremy Price Digitally signed by Jeremy Price Date: 2022.01.20 17:48:03 -09'00' CRU CD2-361 (PTD 221-116) Conditions of Approval: Approval is granted to run the LWD-Sonic on upcoming well CRU CD2-361 with the following provisions: 1. CPAI will provide a written log evaluation/interpretation to the AOGCC along with the log as soon as they become available. The evaluation is to include/highlight the intervals of competent cement (and lengths) that CPAI is using to meet the objective requirements for annular isolation, reservoir isolation, or confining zone isolation etc. Providing the log without an evaluation/interpretation is not acceptable. 2. LWD sonic logs must show free pipe and Top of Cement, just as the e-line log does. CPAI must start the log at a depth to ensure the free pipe above the TOC is captured as well as the TOC. Starting the log below the actual TOC based on calculations predicting a different TOC will not be acceptable. 3. CPAI will provide a cement job summary report and evaluation along with the cement log and evaluation to the AOGCC when they become available 4. CPAI will provide the results of the FIT when available. 5. Depending on the cement job results indicated by the cement job report, the logs and the FIT, remedial measures or additional logging may be required. CONDITIONS OF APPROVAL BOP Testing Frequency – Approval of Event Based Frequency CRU CD2-361 PTD 221-116 CPAI has requested a variance to the 14-day BOPE testing frequency while drilling the Intermediate 2 and Intermediate 3 sections of the CD2-361 well. The best maintenance of hole conditions while drilling, tripping and floated liner operations will occur when BOPE testing occurs while the tools are out of hole. This will not coincide with the required 14-day BOPE test interval (20 AAC 25.035(e)(10)(A)). Without the requested variance, extension requests by CPAI to the 14-day BOPE test interval while drilling the Intermediate 2 and Intermediate 3 sections would occur to avoid BOPE testing that could contribute to hole instability, difficult drilling operations and a potential well control event. While drilling the Intermediate 2 and the Intermediate 3 sections, this modification to the BOPE test frequency is equally effective to the 14 day BOPE test frequency. A variance is granted to the two week BOP test frequency requirement while drilling the Intermediate 2 and Intermediate 3 sections. (20 AAC 25.035(h)). This variance is allowed under the following conditions: 1. BOPE testing to occur when the tools are out of the hole 2. A BOPE test must be conducted immediately prior to drilling the Intermediate 2 and the Intermediate 3 sections. 3. Daily drilling status updates to the AOGCC are required while drilling the Intermediate 2 and Intermediate 3 sections. BOPE tests shall occur at intervals not exceeding 14 days between tests when drilling sections other than the Intermediate 2 and Intermediate 3 sections. January 13, 2022 Alaska Oil and Gas Conservation Commission 333 West 7th Avenue, Suite 100 Anchorage, Alaska 99501 Re: CD2-361 (PTD 221-116) Event Based BOP Testing Interval To: Victoria Loepp On the recently submitted drilling permit application for the subject well, event-based BOP testing was requested in steps 39 and 52 of the Proposed Drilling Program within the permit package. This request applied to the Intermediate 2 and Intermediate 3 sections of the well. ConocoPhillips Alaska provides the following information to support event-based BOP testing on the BOP equipment in the Intermediate 2 and Intermediate 3 sections of the CD2-361 well: 1. The section has no over pressure or hydrocarbon zones, proved in well CD2-162 and the recently drilled CD2-310 well. 2. The section was originally drilled as a single interval in CD2-310 and was completed in two sections after two attempts failed on the single section planned. 3. Experience from CD2-310 shows that both Intermediate 2 and Intermediate 3 sections require managed pressure drilling, backreaming and floated liners for successful completion. Attached is the breakdown of BOP tests completed on CD2-310 in 2021. The event- based testing variance allowed three intervals(highlighted) of 22, 28 and 31 days respectively that were critical to the completion of the well to that point. By testing prior to these events and drilling/tripping and completing the interval without a time constraint, focus was held on hole conditions and best maintenance of them. Swab/surge issues on the formation stability were minimized by eliminating hang-off in casing for testing. Please call me at 263-4749 if you need further information to support the permit request. G. S. Hobbs Regulatory Engineer Wells P.O. Box 100360 Anchorage, AK 99510-0360 Phone: 907-263-4749 Sincerely, G. S. Hobbs Regulatory Engineer Attachments: CD2-310 BOP Test Intervals CD2-310 BOP Test Intervals &RQRFR3KLOOLSV$ODVND,QF 3RVW2IILFH%R[ $QFKRUDJH$ODVND 7HOHSKRQH 'HFHPEHU $ODVND2LODQG*DV&RQVHUYDWLRQ&RPPLVVLRQ :HVWWK$YHQXH6XLWH $QFKRUDJH$ODVND 5H $SSOLFDWLRQIRU3HUPLWWR'ULOO&58&' 'HDU6LURU0DGDP &RQRFR3KLOOLSV$ODVND,QFKHUHE\DSSOLHVIRUD3HUPLWWR'ULOODQRQVKRUHSURGXFHUZHOOIURPWKH&'GULOOLQJSDG7KHLQWHQGHGVSXGGDWH IRUWKLVZHOOLV)HEUXDU\XVLQJ'R\RQ5LJWRGULOOWKHZHOO &'LVSODQQHGWREHDODWHUDO.XSDUXN&SURGXFHU7KH´6XUIDFHVHFWLRQZLOO7'DERYHWKH&VDQGDQGWKHQ´FDVLQJZLOOEHVHW DQGFHPHQWHGWRVXUIDFH7KHLQWHUPHGLDWHKROHZLOOEHGULOOHGLQIRXUVHFWLRQVWRPLWLJDWHLVVXHVZLWKGULOOLQJWKHH[WHQGHGRYHUEXUGHQ VHFWLRQ 7KH´[´,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGWR¶0'DQGODQGHGDWDQLQFOLQDWLRQRI$´OLQHUZLOOEHVHWDQG FHPHQWHGIURP7'WRVHFXUHWKHVKRHLVRODWHWKH4DQQLNUHVHUYRLU7KH´[´,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGDW LQFOLQDWLRQWKURXJKWKH$OELDQDQGVHWDW¶0'7KH´FDVLQJZLOOEHVHWDQGFHPHQWHGWR¶79'DERYHWKHVKRH7KH ´[´,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGDWLQFOLQDWLRQWR¶79'LQWRWKH+5=0DQDJHG3UHVVXUH'ULOOLQJWHFKQRORJ\ZLOO EHXWLOL]HGWRPLWLJDWHZHOOERUHLQVWDELOLW\DQGORVWFLUFXODWLRQDFURVVWKLVLQWHUYDO$´OLQHUZLOOEHVHWDQGFHPHQWHGWR¶79'DERYH WKHVKRH 7KHò´[ó´GULOOHGWKURXJKWKH+5=DQG.DOXELNDQGZLOOODQGZLWKLQWKH.XSDUXN&WDUJHWUHVHUYRLU$´OLQHUZLOOEHVHWDQG FHPHQWHGWR¶0'DERYHWKHWRS.XSDUXN&0DQDJHG3UHVVXUH'ULOOLQJWHFKQRORJ\ZLOOEHXWLOL]HGWRPLWLJDWHZHOOERUHLQVWDELOLW\DQG ORVWFLUFXODWLRQDFURVVWKLVLQWHUYDO 7KH´3URGXFWLRQVHFWLRQZLOOEHJHRVWHHUHGZLWKLQWKH.XSDUXN&WDUJHWUHVHUYRLUZLWK7'SRWHQWLDOO\EHLQJDGMXVWHGDVSHUUHVHUYRLU H[WHQWDQGTXDOLW\7KHZHOOZLOOEHFRPSOHWHGDVDSURGXFHU$´SUHSHUIRUDWHGOLQHUZLOOEHVHWDQGWKHZHOOZLOOEHFRPSOHWHGZLWKD WDSHUHG´[´WXELQJXSSHUFRPSOHWLRQVWULQJ ,WLVUHTXHVWHGWKDWDGLYHUWRUZDLYHU$$&KEHJUDQWHGDV&'LVEHLQJGULOOHGIURPDQH[LVWLQJGULOOVLWHZLWKHLJKWZHOOV ZLWKLQ¶UDGXLVZLWKQRJDVVKRZV 3OHDVHILQGDWWDFKHGWKHLQIRUPDWLRQUHTXLUHGE\$&&DDQGFIRU\RXUUHYLHZ3HUWLQHQWLQIRUPDWLRQDWWDFKHGWRWKLV DSSOLFDWLRQLQFOXGHVWKHIROORZLQJ )RUP$33/,&$7,21)253HUPLWWR'ULOOSHU$&&D $SURSRVHGGULOOLQJSURJUDP $SURSRVHGFRPSOHWLRQGLDJUDP $GULOOLQJIOXLGVSURJUDPVXPPDU\ 3UHVVXUHLQIRUPDWLRQDVUHTXLUHGE\$&&G 'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFHLQIRUPDWLRQDVUHTXLUHGE\$&&E ,QIRUPDWLRQSHUWLQHQWWRWKHDSSOLFDWLRQWKDWLVSUHVHQWO\RQILOHDWWKH$2*&& 'LDJUDPVRIWKH%23HTXLSPHQWGLYHUWHUHTXLSPHQWDQGFKRNHPDQLIROGOD\RXWDVUHTXLUHGE\$&&D DQGE $GHVFULSWLRQRIWKHGULOOLQJIOXLGVKDQGOLQJV\VWHP 'LDJUDPRIULVHUVHWXS ,I\RXKDYHDQ\TXHVWLRQVRUUHTXLUHIXUWKHULQIRUPDWLRQSOHDVHFRQWDFW0DWW:LHQVDW 0DWW5:LHQV#&RQRFR3KLOOLSVFRPRU&KULV%ULOORQDW 6LQFHUHO\ FF &':HOO)LOH-HQQD7D\ORU $72 'DYLG/HH$72 &KULV%ULOORQ $72 0DWW:LHQV /D\OD8QJHU $72 6HQLRU'ULOOLQJ(QJLQHHU *UHJ+REEV $72 $QG\0DFN.XXNSLN&RUS 'LJLWDOO\VLJQHGE\0DWW:LHQV '1&1 0DWW:LHQV( PDWWUZLHQV#FRSFRP& 86 5HDVRQ,DPWKHDXWKRURIWKLVGRFXPHQW /RFDWLRQ\RXUVLJQLQJORFDWLRQKHUH 'DWH )R[LW3')(GLWRU9HUVLRQ 0DWW:LHQV SFD 12/29/2021 Recommend granting diverter waiver: Confirmed that there are at least 8 other surface casing shoes set between -2287' and -3010' TVDSS within 500' of the planned surface casing shoe for CD2-361 at -2340' TVDSS. No evidence of shallow drilling hazards or shallow gas was found during review of daily drilling operations reports from 13 offset wells. SFD 12/30/2021 DGLYHUWRUZDLYHU 7KH´[´,QWHUPHGLDWHVHFWLRQZLOOEHGULOOHGWR¶0'DQGODQGHGDWDQLQFOLQDWLRQRI$´OLQHUZLOOEHVHWDQG FHPHQWHGIURP7'WRVHFXUHWKHVKRHLVRODWHWKH4DQQLNUHVHUYRLU Qannik will be cement isolated. $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 1 of 21 Printed: 29-Dec-21 &' AOGCC Application for Permit to Drill Document 7DEOHRI&RQWHQWV :HOO1DPH(Requirements of 20 AAC 25.005 (f)) .................................................................................... /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) %ORZRXW3UHYHQWLRQ(TXLSPHQW,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(3)) 'ULOOLQJ+D]DUGV,QIRUPDWLRQRequirements of 20 AAC 25.005 (c)(4)) 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV Requirements of 20 AAC 25.005 (c)(5)) &DVLQJDQG&HPHQWLQJ3URJUDP(Requirements of 20 AAC 25.005(c)(6)) 'LYHUWHU6\VWHP,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) 'ULOOLQJ)OXLG3URJUDPRequirements of 20 AAC 25.005(c)(8)) $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) 3URSRVHG'ULOOLQJ3URJUDP(Requirements of 20 AAC 25.005 (c)(13)) 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) $WWDFKPHQWV Attachment 1 Cement Summary Attachment 2 Drilling Hazards Summary Attachment 3 Completion Schematic Attachment 4 Property Plat Attachment 5 Directional Plan CD2-361 $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 2 of 21 Printed: 29-Dec-21 :HOO1DPH(Requirements of 20 AAC 25.005 (f)) 7KHZHOOIRUZKLFKWKLVDSSOLFDWLRQLVVXEPLWWHGZLOOEHGHVLJQDWHGDV&58&' /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) /RFDWLRQDW6XUIDFH(CD2-361 Slot)µ)1/ )(/6HF715(80 NAD27 Northings: 5,974,180 Eastings: 371,464 RKB Elevation ¶$06/ Pad Elevation ¶$06/ /RFDWLRQDW3URGXFWLYH+RUL]RQ+HHO )1/ )(/6HF715(80 NAD27 Northings:5,992,432 Eastings: 362,020 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ /RFDWLRQDW7RWDO'HSWK7RH )1/ )(/6HF715(80 NAD27 Northings: 6,000,899 Eastings: 357,798 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ Requirements of 20 AAC 25.050(b) 3OHDVHVHH$WWDFKPHQW&'ZS'LUHFWLRQDO3ODQ 7KH$SSOLFDQWLVWKHRQO\DIIHFWHGRZQHU %ORZRXW3UHYHQWLRQ(TXLSPHQW,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(3)) 3OHDVHUHIHUHQFH%23DQGGLYHUWHUVFKHPDWLFVRQILOHIRU'R\RQ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 3 of 21 Printed: 29-Dec-21 'ULOOLQJ+D]DUGV,QIRUPDWLRQRequirements of 20 AAC 25.005 (c)(4)) 7KHIROORZLQJVKRZVWKHFDOFXODWLRQUHVXOWVRIDQWLFLSDWHGVXUIDFHSUHVVXUH$63ZKLOHGULOOLQJWKLVZHOO &DVLQJ6L]H LQ &DVLQJ6HW'HSWK 0'79'IW )UDFWXUH *UDGLHQW SSJ 3RUH 3UHVVXUH SVL $63'ULOOLQJ SVL 1$ 352&('85()25&$/&8/$7,1*$17,&3$7('685)$&(35(6685($63 $63LVGHWHUPLQHGDVWKHOHVVHURIVXUIDFHSUHVVXUHDWEUHDNGRZQRIWKHIRUPDWLRQFDVLQJVHDWZLWKD JDVJUDGLHQWWRWKHVXUIDFHRUIRUPDWLRQSRUHSUHVVXUHDWWKHQH[WFDVLQJSRLQWOHVVDJDVJUDGLHQWWR WKHVXUIDFHDVIROORZV $63 >)*[@[' :KHUH $63 $QWLFLSDWHG6XUIDFHSUHVVXUHLQSVL )* )UDFWXUHJUDGLHQWDWWKHFDVLQJVHDWLQOEJDO &RQYHUVLRQIURPOEJDOWRSVLIW *DVJUDGLHQWLQSVLIW ' WUXH9HUWLFDOGHSWKRIFDVLQJVHDWLQIW5.% 25 $63 )33±[' :KHUH )33 )RUPDWLRQ3RUH3UHVVXUHDWWKHQH[WFDVLQJSRLQW )33 SVLIW[79'DERYH+5= SVLIWEHORZ+5=XQOHVVRWKHUZLVHVSHFLILHG (A)ASP Calculations Per Interval 'ULOOLQJ%HORZ´&RQGXFWRU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL 'ULOOLQJ%HORZ´6XUIDFH&DVLQJ $63 >)*[±@[' >[±@[¶ SVL 25 $63 )33±[' ±[¶ SVL $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 4 of 21 Printed: 29-Dec-21 'ULOOLQJ%HORZ´,QWHUPHGLDWH'ULOOLQJ/LQHU $63 >)*[±@[' >[±@[¶ SVL 25 $63 )33±[' ±[¶ SVL 'ULOOLQJ%HORZ´,QWHUPHGLDWH3URGXFWLRQ/LQHU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL 'ULOOLQJ%HORZ´,QWHUPHGLDWH3URGXFWLRQ/LQHU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL NOTE: 11.5ppg Kuparuk C Pressure 'ULOOLQJ%HORZ´,QWHUPHGLDWH3URGXFWLRQ/LQHU $63 >)*[±@[' >[±@[ SVL 25 $63 )33±[' ±[ SVL NOTE: 11.5ppg Kuparuk C Pressure (B) data on potential gas zones; 7KHZHOOERUHLVQRWH[SHFWHGWRSHQHWUDWHDQ\K\GUDWHVQRUJDV]RQHV (C) data concerning potential causes of hole problems such as abnormally geo-pressured strata, lost circulation zones, and zones that have a propensity for differential sticking; 3OHDVHVHH$WWDFKPHQW'ULOOLQJ+D]DUGV6XPPDU\ 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWVRequirements of 20 AAC 25.005 (c)(5)) 'ULOORXWFDVLQJRUOLQHUVKRHDQGSHUIRUP/27WHVWRU),7LQDFFRUGDQFHZLWKWKH&23(5'/27),7 SURFHGXUHWKDW&RQRFR3KLOOLSV$ODVNDKDVRQILOHZLWKWKH&RPPLVVLRQ S S 11.5ppg Kuparuk C Pressure 11.5ppg Kuparuk C Pressure $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 5 of 21 Printed: 29-Dec-21 &DVLQJDQG&HPHQWLQJ3URJUDP(Requirements of 20 AAC 25.005(c)(6)) &DVLQJDQG&HPHQWLQJ3URJUDP Csg/Tbg OD (in) Hole Size (in) Weight (lb/ft) Grade Conn. Length (ft) Top MD/TVD (ft) Btm MD/TVD (ft) Planned Cement Program ;:HOGHG&HPHQWHGWR6XUIDFHZLWK \GVVOXUU\ /+\GULO : &HPHQWWR6XUIDFHZLWK V['HHS&5(7(/HDGDWSSJ V[&ODVV*7DLODWSSJ [ 3 ,& +\GULO :V[([WHQGHG&ODVV*/HDGDWSSJ V[&ODVV*7DLODWSSJ [ / ,& +\GULO :V[&ODVV*7DLODWSSJ [ /+\GULO :V[&ODVV*7DLODWSSJ ò[ /+\GULO :V[&ODVV*7DLODWSSJ QD/+\GULO :N/A – Upper Part of Tapered Upper Completion Tubing String QD/+\GULO :N/A – Lower Part of Tapered Upper Completion Tubing String /+\GULO :N/A – Uncemented Open Hole Liner w/ Pre-Perforated Pup Joints 'LYHUWHU6\VWHP,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) &3$,UHTXHVWVDYDULDQFHWRWKHGLYHUWHUUHTXLUHPHQWXQGHU$$&KEHJUDQWHG &'PHHWVWKHUHTXLUHPHQWVDVRXWOLQHGEHORZ 1. The well is a development well drilled by Doyon 26 from an existing drill site. D &'LVDGHYHORSPHQWZHOOEHLQJGULOOHGE\'R\RQIURP&' 2. At least one previously drilled borehole has penetrated the horizontal circle with a radius of 500 feet centered on the proposed location of the surface casing shoe of the well to be drilled. D 7KHUHDUHHLJKWZHOOVZLWKLQD¶UDGLXVRIWKHSURSRVHG&'VXUIDFHVKRHDW ¶0'&'a¶&'a¶&'a¶&'a¶&' a¶&'a¶&'a¶DQG&'a¶ 3.There have been no significant gas shows or well control events while any borehole was drilled to the depth of the surface casing shoe within the 500-foot radius circle. D 7KHUHDUHILIW\WKUHHZHOOVZLWKLQD¶UDGLXVDFURVVWKH&'VXUIDFHKROHLQWHUYDO 7KHUHKDYHEHHQQRVLJQLILFDQWLQGLFDWLRQVRIVKDOORZJDVRUJDVK\GUDWHVZKLOHGULOOLQJ IURP&'SDGLQFOXGLQJRQ&'ZKHUHDVXUIDFHKROHZDVGULOOHGWR¶79'LQ g ILIW\WKUHH ZHOOV pp g HLJKWZHOOVZLWKLQD¶UDGLXVRIWKHSURSRVHG &'VXUIDFHVKRH QRVLJQLILFDQWLQGLFDWLRQVRIVKDOORZJDVRUJDVK\GUDWHVZKLOHGULOOLQJ IURP&'SDGL &3$,UHTXHVWVDYDULDQFHWRWKHGLYHUWHUUHTXLUHPHQW $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 6 of 21 Printed: 29-Dec-21 'ULOOLQJ)OXLG3URJUDPRequirements of 20 AAC 25.005(c)(8)) 6XUIDFH,QWHUPHGLDWH ,QWHUPHGLDWH ,QWHUPHGLDWH ,QWHUPHGLDWH 3URGXFWLRQ +ROH6L]Hin [[ [ [ &DVLQJ 6L]Hin 'HQVLW\ppg ±± ±± 39 cP ±± ± <3 lb./ 100 ft2 ±± ± ± ,QLWLDO *HOV lb./ 100 ft2 0LQXWH *HOV lb./ 100 ft2 $3,)OXLG /RVV cc/ 30 min 1&± ± ± S+ ± ±±± 6XUIDFH+ROH 7KH6XUIDFHLQWHUYDOZLOOEHGULOOHGZLWKDPL[HGPHWDOR[LGHIUHVKZDWHUGULOOLQJIOXLG'5,/3/(;:%0 .HHSIORZOLQHYLVFRVLW\DWrVHFTWZKLOHGULOOLQJDQGUXQQLQJFDVLQJ5HGXFHYLVFRVLW\SULRUWR FHPHQWLQJ0DLQWDLQPXGZHLJKWSSJWKURXJKWKHEDVHRI3HUPDIURVWDQGLQFUHDVHWRSSJSULRU WR7'&RQWURO/*6XVLQJVROLGVFRQWUROV\VWHPDQGGLOXWLRQVZKHUHQHFHVVDU\ ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDIUHVKZDWHUJHOSRO\PHUGULOOLQJIOXLG/61':%0 (QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJIOXLGDQQXODUYHORFLW\DQGURWDU\VSHHG0DLQWDLQPXGZHLJKW IURP±SSJIRUVKDOORZLQVWDELOLW\DQGEHSUHSDUHGWRDGGORVVFLUFXODWLRQPDWHULDORUZHLJKWXS DVQHHGHGIRUDFWXDO4DQQLNSRUHSUHVVXUH*RRGILOWHUFDNHTXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFHRI ORZJUDYLW\GULOOVROLGVE\GLOXWLQJDVUHTXLUHGZLOODOOEHLPSRUWDQWLQPDLQWDLQLQJJRRGKROHFRQGLWLRQV ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDIUHVKZDWHUJHOSRO\PHUGULOOLQJIOXLG/61':%0 (QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJIOXLGDQQXODUYHORFLW\DQGURWDU\VSHHG0DLQWDLQPXGZHLJKW IURP±SSJIRULQVWDELOLW\03'PD\EHXVHGWRSUHYHQWF\FOLQJRQWKHIRUPDWLRQ*RRGILOWHUFDNH TXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFHRIORZJUDYLW\GULOOVROLGVE\GLOXWLQJDVUHTXLUHGZLOODOOEH LPSRUWDQWLQPDLQWDLQLQJJRRGKROHFRQGLWLRQV ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDQLQKLELWLYHVDOWGULOOLQJIOXLG./$6+,(/':%0WR SURSHUO\FRQGLWLRQWKHKROHIRUWKHIORDWHGOLQHUUXQ(QVXUHJRRGKROHFOHDQLQJE\PD[LPL]LQJIOXLGDQQXODU YHORFLW\DQGDGMXVWLQJGULOOLQJSDUDPHWHUV&RQGLWLRQWKHPXGXVLQJGLOXWLRQVDVUHTXLUHGWRPDLQWDLQORZ JUDYLW\GULOOVROLGV:HLJKWXSWRSSJDW7'DQGDGMXVWWULSSLQJSDUDPHWHUVWRHQVXUHFOHDQKROH SULRUWRIORDWLQJWKH´OLQHUWRERWWRP03'ZLOOXVHGRQWKLVKROHVHFWLRQWRPLQLPL]HF\FOLQJDQG LPSURYHLQVWDELOLW\ M SS J S 03'ZLOOXVHGRQWKLVKROHVHFWLRQ J ±SSJ J ±SSJ SSJSSJ J U ZHLJKWXS\ DVQHHGHGIRUDFWXDO4DQQLNSRUHSUHVVXUH SSJ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 7 of 21 Printed: 29-Dec-21 ,QWHUPHGLDWH 7KH,QWHUPHGLDWHLQWHUYDOZLOOEHGULOOHGZLWKDQLQKLELWLYHVDOWGULOOLQJIOXLG./$6+,(/':%0WR PLWLJDWHZHOOERUHLQVWDELOLW\DQGWRSURSHUO\FRQGLWLRQWKHKROHIRUWKHIORDWHGOLQHUUXQ(QVXUHJRRGKROH FOHDQLQJE\PD[LPL]LQJIOXLGDQQXODUYHORFLW\7KHUHLVSRWHQWLDOIRUORVWFLUFXODWLRQVRHQVXUHDGHTXDWH /&0PDWHULDOLVDYDLODEOHRQORFDWLRQWRDGGUHVVDQ\XQH[SHFWHGORVVHV*RRGILOWHUFDNHTXDOLW\KROH FOHDQLQJDQGPDLQWHQDQFHRIORZJUDYLW\GULOOVROLGVE\GLOXWLQJDVUHTXLUHGZLOODOOEHLPSRUWDQWLQ PDLQWDLQLQJJRRGKROHFRQGLWLRQV0LWLJDWHZHOOERUHLQVWDELOLW\ZLWK03'WDUJHWLQJaSSJ(0:DQG /RZHU6KDOHVSHFLILFPXGDGGLWLYHV:HLJKWXSDVQHHGHGDW´VKRHWRWKHJUHDWHURISSJ (0:IRUZHOOERUHLQVWDELOLW\PLWLJDWLRQRUDVQHHGHGIRU.XSDUXN&SRUHSUHVVXUH 3URGXFWLRQ+ROH 7KH3URGXFWLRQLQWHUYDOZLOOEHGULOOHGZLWKDZDWHUEDVHGGULOOLQIOXLG)/2352:%0ZHLJKWHG DSSURSULDWHO\VRWKDW03'FDQSURYLGHDG\QDPLFRYHUEDODQFHRIaSSJ(0:ZKLOHUHGXFLQJWKHULVN RIORVWFLUFXODWLRQFUHDWHGE\KLJK(&'V7KHUHLVSRWHQWLDOIRUORVWFLUFXODWLRQVRHQVXUHDGHTXDWH/&0 PDWHULDOLVDYDLODEOHRQORFDWLRQWRDGGUHVVDQ\ORVVHV7KHUHLVDSRWHQWLDOIRUDEQRUPDOSUHVVXUHVR HQVXUHDGHTXDWHZHLJKWLQJPDWHULDOLVRQORFDWLRQWRZHLJKWXSDVQHHGHG.LOOZHLJKWEULQHZLOOEHSODFHG LQWKHZHOOSULRUWRSXOOLQJRXWRIKROH 3OHDVHUHIHUHQFHSLWGLDJUDPRQILOHIRU'R\RQ$OOGULOOLQJIOXLGSUDFWLFHVZLOOEHLQDFFRUGDQFHZLWK DSSURSULDWHUHJXODWLRQVVWDWHGLQ$$& $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) 1$$SSOLFDWLRQLVQRWIRUDQRIIVKRUHZHOO (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) (YLGHQFHRIERQGLQJIRU&RQRFR3KLOOLSV$ODVND,QFLVRQILOHZLWKWKH&RPPLVVLRQ ISSJSJS J (0:IRUZHOOERUHLQVWDELOLW\PLWLJDWLRQRUDVQHHGHGIRU.XSDUXN&SRUHSUHVVXUH J\ \JT S 0LWLJDWHZHOOERUHLQVWDELOLW\ZLWK03'WDUJHWLQJaSSJ(0:SJ J 03'FDQSURYLGHDG\QDPLFRYHUEDODQFHRIaSSJ(0:ZKLOHUHGXFLQJWKHULVNSS S \ S RIORVWFLUFXODWLRQFUHDWHGE\KLJK(&'V $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 8 of 21 Printed: 29-Dec-21 3URSRVHG'ULOOLQJ3URJUDP(Requirements of 20 AAC 25.005 (c)(13)) 7KHSURSRVHGGULOOLQJSURJUDPLVOLVWHGEHORZ3OHDVHUHIHUWR&RPSOHWLRQ6FKHPDWLF 0,58'R\RQRQWR&58&'RYHUSUHLQVWDOOHG´[´LQVXODWHGFRQGXFWRU 'HZDWHUFHOODUULJXSULVHU WHVWVDPH 3LFNXSHQRXJK´9;GULOOSLSHWRGULOO685)VHFWLRQDQGUDFNEDFN 0DNHXS´&RQGXFWRU&OHDQ2XW%+$&OHDQRXWFRQGXFWRU 0DNHXS´685)'ULOOLQJ%+$(LMWD Program: GR/DIR)VSXGZHOO GLUHFWLRQDOO\GULOO´KROHWR685)7' HVWLPDWHGDW¶0'¶79'WRSVHWWLQJWKH&DQGDVSHUWKHGLUHFWLRQDOSODQ±SSJ'5,/3/(; :%0ZLOOEHXVHGWRGULOOWKHVHFWLRQ &LUFXODWH FRQGLWLRQIORZFKHFNZHOODQG322+/D\GRZQ685)'ULOOLQJ%+$ 5XQQHZ´/716(5685)FDVLQJFHQWUDOL]HGDVSHUGHVLJQWRVHFWLRQ7'&LUFXODWH FRQGLWLRQ ODQGFDVLQJRQKDQJHUZLWKLQZHOOKHDGDQGEDFNRIIXSSHUKDOIRIODQGLQJMRLQW 3LFNXS 7,+ZLWKWKH685),QQHU6WULQJ%+$VWDELQWRWKHLQQHUVWULQJIORDWFROODUDQGHVWDEOLVKFLUFXODWLRQ &HPHQWWKH´685)FDVLQJWRVXUIDFHDVSHUWKHFHPHQWSURJUDPZLWK¶RISSJ&ODVV*WDLODQG SSJ'HHS&5(7(OHDGWRVXUIDFH%XPSLQQHUVWULQJGDUWVEOHHGSUHVVXUH FKHFNIORDWV a. CONTINGENCY: If cement is not brought to surface, notify AOGCC and prepare for top job. )ORZFKHFNZHOO1'IORZULVHU 18+35LVHU %23(ZLWKWKHIROORZLQJHTXLSPHQWFRQILJXUDWLRQ D ´$QQXODU8SSHU´[´9%5%OLQG6KHDU5DP/RZHU´[´9%5 7HVW%23(WRSVLORZSVLKLJK7HVWDQQXODUWRSVLORZSVLKLJK(Provide 48 hr. AOGCC notice) 3LFNXS 7,+ZLWKWKH´[´,1750'ULOOLQJ%+$(LMWD Program: GR/RES/DIR) a. CONTINGENCY: If unable to clean-out SURF casing shoe track with INTRM1 Drilling BHA, drill out SURF casing shoe track with dedicated SURF Casing Clean-Out BHA and perform FIT. &KDUW´685)FDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFN´UDWKROHDQG¶RIQHZKROH&LUFXODWH FRQGLWLRQ 3HUIRUP),7WRPLQLPXPSSJ(0: 'LVSODFHZHOOWRSSJ/61':%0 'LUHFWLRQDOO\GULOO´,17503LORW+ROHXQWLOWKHXQGHUUHDPHULVEHORZWKH´685)&DVLQJ6KRHDQGRSHQ WKHXQGHUUHDPHU 'LUHFWLRQDOO\GULOO´[´,1750+ROHSDVWWKH%DVH4DQQLN &LUFXODWHDPLQLPXP[ERWWRP¶VXSDQGIORZ FKHFNWKHZHOOWRGHWHUPLQHLIDGGLWLRQDORYHUEDODQFHLVQHHGHG 'LUHFWLRQDOO\GULOO´[´,1750+ROHWR,17507'DW¶0'¶79'DVSHUWKHGLUHFWLRQDO SODQ&LUFXODWH FRQGLWLRQZKLOHZHLJKWLQJXSDVQHHGHGIRUDWULSPDUJLQ 2EVHUYHZHOOIRUIORZZKLOHURWDWLQJDWUSPWRDYRLGGLIIHUHQWLDOVWLFNLQJ 322+DQGOD\GRZQWKH´,1750'ULOOLQJ%+$ &KDQJH8SSHU´[´9%5VWR´6ROLG%RG\5DPV7HVWVDPHWRSVLORZSVLKLJK(Provide 48 hr. AOGCC notice) 5XQQHZ´3,&76+OLQHUFHQWUDOL]HGDVSHUGHVLJQ&LUFXODWH FRQGLWLRQSULRUWRH[LWLQJWKH 685)&DVLQJ6KRHDQGDJDLQEHIRUHPDNLQJXSWKH/LQHU+DQJHU 08WKH´[´,1750/LQHU+DQJHU5XQQLQJ7RRO$VVHPEO\DQG7,+ZLWKWKH´,1750OLQHUWRDERYH UDWKROH2QFHWKHUHFLUFXODWH FRQGLWLRQDVQHHGHGLQSUHSDUDWLRQIRUWKHFHPHQWMRE &HPHQWWKH´,1750OLQHUZLWKVXIILFLHQWSSJ([WHQGHG&ODVV*OHGWRSURYLGH¶LVRODWLRQDERYHWKH 7RS4DQQLNDQGD¶SSJWDLOWRWDFNWKH´,1750/LQHU6KRH%XPSSOXJVWRSVLRYHUFLUFXODWLQJ SUHVVXUHEOHHGSUHVVXUH FKHFNIORDWV a. CONTINGENCY: If cement is not circulated above the Qannik, drill, case, cement INTRM2. Intrm 1 is a drilling liner and will be covered by Intrm 2 long string. 6HWWKH´[´7,:;3$./LQHU+DQJHU3HUIRUPRYHUSXOOWHVWWRFRQILUPKDQJHUVHW Indications of improper cementing may require a cement quality log. (20 AAC 25.030(d)(5)) LOT. 4000 psi 4000 psi (LMWD Program: GR/RES/DIR) (LMWD Program: GR/D Min rqd to drill ahead. SURYLGH¶LVRODWLRQDERYHWKH 7RS4DQQLND Cement job results & interpretation due to AOGCC as soon as available. Refer to AOGCC Industry Guidance Bulletin 13-01:Remedial Cementing for Surface Casing.VTL 1/12/22 $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 9 of 21 Printed: 29-Dec-21 3HUIRUP/LQHU7RSWHVWWRSVL 3LFNXSWRUHOHDVHUXQQLQJWRROVIURP/LQHU+DQJHU&LUFXODWH FRQGLWLRQ)ORZFKHFNZHOO 72+RQHOHYDWRUV/D\GRZQ,1750/LQHU5XQQLQJ7RROV &KDQJH´6ROLG%RG\5DPVEDFNWR´[´9%5V7HVWVDPHWRSVL(Provide 48 hr. AOGCC notice) 3LFNXS 7,+ZLWK´,1750&OHDQ2XW%+$WRWKH´,1750/LQHUWRS &LUFXODWH FRQGLWLRQGULOORXWSDFNRIIEXVKLQJEHORZ/LQHU+DQJHUFLUFXODWHERWWRP¶VXSDQGFRQWLQXH7,+ &KDUW´FDVLQJ[´OLQHUSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFN´[´UDWKROHDQG¶RI ô´QHZKROH&LUFXODWH FRQGLWLRQ 3HUIRUP),7WRPLQLPXPSSJ(0: &LUFXODWH FRQGLWLRQREVHUYHZHOOIRUIORZDQG72+/D\GRZQWKH´,1750&OHDQ2XW%+$ 3LFNXS 7,+ZLWK´[´,1750'ULOOLQJ%+$WRWKH´,1750/LQHU6KRH(LMWD Program: GR/RES/DIR) 'LVSODFHWKHZHOOWRSSJ/61':%0 2SHQXQGHUUHDPHUDQGGLUHFWLRQDOO\GULOO´[´,1750KROHWR7'DW¶0' D 7KLVKROHVHFWLRQLVWKHXSSHUSDUWRIWKHRULJLQDOVWULQJ,17KROHVHFWLRQWKHGULOOLQJWULSSLQJRXWWLPH LVHVWLPDWHGWREHRYHUGD\V7RDYRLGWKHKLJKULVNRIVWXFNSLSH&RQRFR3KLOOLSVLVUHTXHVWLQJWR FRQWLQXHWKHDSSURYHG(YHQW%DVHG%23WHVWLQJVFKHGXOHIURPRULJLQDO,173HUIRUPIXOO%23WHVW RQFH%+$RXWRIKROH 322+DQGOD\GRZQ´[´,1750'ULOOLQJ%+$ &KDQJH8SSHU´[´9%5VWR´6ROLG%RG\5DPV7HVWVDPHWRSVLORZSVLKLJK (Provide 48 hr. AOGCC notice) )ORDWQHZ´/,&76+,1750&DVLQJFHQWUDOL]HGDVSHUGHVLJQWR7'DWWHPSWWRUXQRQ HOHYDWRUVDQGURWDWHRQO\LIQHHGHGWRPRYHSDVWDOHGJHRUWREUHDND[LDOIULFWLRQ &LUFXODWH FRQGLWLRQLQSUHSDUDWLRQIRUWKHFHPHQWMRE &HPHQWWKH´,1750OLQHUZLWKVXIILFLHQWSSJ&ODVV*WRWDFNWKH,1750FDVLQJVKRHZLWK¶79' VOXUU\ ,QVWDOOSDFNRIIDQGGLVSODFHWKH´[´[´DQQXOXVWRFRUURVLRQLQKLELWHGVHDZDWHUDQGGLHVHOIUHH]H SURWHFW &KDQJH´VROLGERG\UDPVEDFNWR´[´9%5V7HVWVDPHWRSVL(Provide 48 hr. AOGCC notice) 3LFNXS 7,+ZLWK´[´,1750'ULOOLQJ%+$(LMWD Program: GR/RES/NEU/DEN/SON/DIR) &KDUW´,1750FDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFN´[´UDWKROHDQG¶RIQHZ´KROH 3HUIRUP),7WRPLQLPXPSSJ(0: 'LVSODFHZHOOWRSSJ./$6+,(/':%0 'LUHFWLRQDOO\GULOO[´QHZ,1750KROHWR7'¶79'EHORZWKH7RS+5=HVWLPDWHGDW¶0' ¶79' D 7KLVKROHVHFWLRQLVWKHORZHUSDUWRIWKHRULJLQDOVWULQJ,17KROHVHFWLRQWKHGULOOLQJWULSSLQJRXWWLPH LVHVWLPDWHGWREHRYHUGD\V7RDYRLGWKHKLJKULVNRIVWXFNSLSH&RQRFR3KLOOLSVLVUHTXHVWLQJWR FRQWLQXHWKHDSSURYHG(YHQW%DVHG%23WHVWLQJVFKHGXOHIURPRULJLQDO,173HUIRUPIXOO%23WHVW RQFH%+$RXWRIKROH &LUFXODWH FRQGLWLRQKROHZKLOHZHLJKWLQJXSWRSSJ2EVHUYHZHOOIRUIORZ 322+DQGOD\GRZQ[´,1750'ULOOLQJ%+$ &KDQJH8SSHU´[´9%5VWR´6ROLG%RG\5DPV7HVWVDPHWRSVLORZSVLKLJK (Provide 48 hr. AOGCC notice) (LMWD Program: GR/RES/NEU/DEN/SON/DIR) min rqd LOT (LMWD Program:S GR/RES/DIR) Cement job results & interpretation due to AOGCC as soon as available. 4000 psi 4000 psi $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 10 of 21 Printed: 29-Dec-21 )ORDW´/76+QHZ,1750/LQHUFHQWUDOL]HGDVSHUGHVLJQWR7'&HPHQWWKHVDPHZLWK SSJ&ODVV*WR¶79'DERYHWKHVKRH 6HWWKH/LQHU+DQJHU7HVWWKHEDFNVLGHWRSVLIRULQWHJULW\ 322+DQG/'OLQHUKDQJHUUXQQLQJWRRO &KDQJH8SSHUEDFNWR´[´9%5V7HVWVDPHWRSVLORZSVLKLJK(Provide 48 hr. AOGCC notice) 3UHVVXUHWHVWVWKH´OLQHUDQG´FDVLQJWRSVLIRUPLQXWHV 3LFNXS 7,+ZLWK´[´,1750'ULOOLQJ%+$(LMWD Program: GR/RES/NEU/DEN/SON/DIR) D 72&ZLOOEHORJJHGZLWK6RQLFWRRO 'LVSODFHZHOOWRSSJ.OD6KLHOG 'ULOORXWVKRHWUDFNDQG¶RIQHZKROH3HUIRUP),7WRPLQLPXPSSJ(0: 'LUHFWLRQDOO\GULOO´[´KROHWRVHFWLRQ7'ZLWKLQWKH)LRUG:HVW.XSDUXN&DW¶0'¶79' XVLQJ03'WRWDUJHWSSJ(0:DW¶79' 622+WR´VKRH &LUFXODWH ZHLJKWXSWKHPXGWRSSJNLOOZHLJKW./$6+,(/':%0 )ORZFKHFN622+DQGOD\GRZQ´[´'ULOOLQJ%+$ 5XQQHZ´/76+,1750/LQHUWR7' &HPHQWWKH´OLQHUZLWKSSJWDLO&ODVV*WR¶79'DERYHWKHWRSRI.XSDUXN&UHVHUYRLU 6HWOLQHUKDQJHUDQGSHUIRUPSVLEDFNSUHVVXUHWHVW 322+DQG/'OLQHUKDQJHUUXQQLQJWRRO 3UHVVXUHWHVW´[´[´/LQHUSUHVVXUHWHVWWRSVLIRUPLQXWHV 3LFNXS 7,+ZLWK´352''ULOOLQJ$VVHPEO\(LMWD Program: GR/RES/NEU/DEN/DIR) 'LVSODFHZHOOWRQHZSSJ)/2352:%0 'ULOORXWVKRHWUDFN´[´UDWKROHDQG¶RIQHZKROH3HUIRUP),7WRPLQLPXPRISSJ(0: 'LUHFWLRQDOO\GULOOKROHWRWKH3URGXFWLRQ7'DW¶0'JHRVWHHULQJWRVWD\ZLWKLQWKH.XSDUXN&ZKLOH XVLQJ03'WRWDUJHW(0:DW´6KRH &LUFXODWH FRQGLWLRQ%522+WRWKH´,1750OLQHUVKRHDQGIXUWKHUDVQHHGHGWRFOHDQXSWKHZHOO 6WULSLQEDFNWRERWWRP &LUFXODWH FRQGLWLRQGLVSODFHZHOOWRNLOOZHLJKWEULQHIORZFKHFN 72+/D\GRZQ´352''ULOOLQJ%+$ 5XQQHZ´/76+/LQHUZLWKSUHSHUIRUDWHGSXSVFHQWUDOL]HGDVSHUGHVLJQ 3LFNXSWKH´[´/LQHU+DQJHU3DFNHUZLWK5XQQLQJ7RRO$VVHPEO\WRWKH5LJ)ORRU0DNHXSWRWKH OLQHUKDQJHU 7,+ZLWK´352'/LQHUURWDWHDVQHHGHGWRUHGXFHD[LDOIULFWLRQDQGUXQWR7'&LUFXODWHDVQHHGHGWKURXJK WKHRSHQFLUFXODWLRQVXE :LWKWKHOLQHURQERWWRPVHWWKHOLQHUWRSSDFNHUDVSHUHTXLSPHQWVSHFV 5HOHDVHUXQQLQJWRROVSHUIRUPaSVLOLQHUWRSWHVWWRFRQILUPSDFNHU OLQHUEDUULHULQWHJULW\ 72+RQHOHYDWRUV/D\GRZQ352'/LQHU5XQQLQJ7RROV 5XQ´[´8SSHU&RPSOHWLRQZLWKVPDUWJDVOLIWPDQGUHOV6SDFHRXWSLFNXS ZLWKWKHDQQXODUFORVHGRQ ODQGLQJVWULQJVSRWGLHVHOIUHH]HSURWHFW/DQGWXELQJKDQJHU SUHVVXUHXSWRVHWSDFNHU&RQILUPFRQQHFWLYLW\ WRVPDUW*/0V ,QVWDOO%39DQGSUHVVXUHWHVWKDQJHUVHDOVWRSVLFKDUWWHVW 1LSSOHGRZQ%23( ,QVWDOOWXELQJKHDGDGDSWHUDVVHPEO\DQGWUHH3UHVVXUHWHVWVDPHWRSVLFKDUWWHVW5HPRYH%39 7HVWWXELQJDQGWXELQJFDVLQJDQQXOXVVHSDUDWHO\WRSVLPLQVFKDUWWHVWV (LMWD Program: GR/RES/NEU/DEN/SON/DIR) Indications of improper cementing may require a cement quality log.(20 AAC 25.030(d)(5)) (LMWD Program: GR/RES/NEU/DEN/DIR) Cement job results & interpretation due to AOGCC as soon as available. Cement job results & interpretation due to AOGCC as soon as available. Indications of improper cementing may require a cement quality log. (20 AAC 25.030(d)(5)) $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 11 of 21 Printed: 29-Dec-21 6KHDUFLUFXODWLRQYDOYHLQ*/0&LUFXODWHWXELQJWRGLHVHO IUHH]HSURWHFWDQQXOXV 6HW%39DQGVHFXUHZHOO5'02'R\RQ 32675,*±2SV D 3UHVVXUHXSWRFRQYHUWIORWDWLRQEDUULHUGLVN XQORDGZHOO 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) ,QFLGHQWDOIOXLGVGHYHORSHGIURP&'GULOOLQJRSHUDWLRQVZLOOEHKDXOHGWRWKH$OSLQH*ULQG ,QMHFW )DFLOLW\DQGLQMHFWHGLQWRWKHGHGLFDWHG&ODVVGLVSRVDOZHOO&'$RQ&'3DG %HFDXVHRIWKH´,QWHUPHGLDWH/LQHU+DQJHUEORFNLQJWKH´6XUIDFH&DVLQJ6KRH&'LVQRWD FDQGLGDWHIRUIXWXUHDQQXODUGLVSRVDO $WWDFKPHQWV Attachment 1 Cement Summary Attachment 2 Drilling Hazards Summary Attachment 3 Completion Schematic Attachment 4 Directional Plan $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 12 of 21 Printed: 29-Dec-21 $WWDFKPHQW±&HPHQW6XPPDU\ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 13 of 21 Printed: 29-Dec-21 ´6XUIDFH&DVLQJWR¶0'¶79' &HPHQWIURP¶WR 0'¶ZLWKSSJ&ODVV*WDLODQGIURP WRVXUIDFHZLWK SSJ'HHS&5(7(OHDG$VVXPHH[FHVVDQQXODUYROXPHLQ3HUPDIURVWH[FHVVEHORZ WKH3HUPDIURVWDQGQRH[FHVVZLWKLQWKH´FRQGXFWRU /HDG6OXUU\IURP¶0'WR6XUIDFHZLWKSSJ'HHS&5(7( &RQGXFWRU ¶±¶;IWIW;H[FHVV IW 3HUPDIURVWWR&RQGXFWRU ¶±¶;IWIW;H[FHVV IW 7RSRI7DLOWR3HUPDIURVW ¶±¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ'HHS&5(7(#IWVN 7DLO6OXUU\IURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI7DLO ¶±;IWIW;H[FHVV IW 6KRH-RLQWV ¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN ´,QWHUPHGLDWH/LQHUWR¶0'¶79' &HPHQWIURP¶WR¶0'¶ZLWKSSJ&ODVV*WDLODQGIURP¶WR¶79'! ¶0'DERYHWKHWRSRIWKH.4DQQLNUHVHUYRLUZLWKSSJ([WHQGHG&ODVV*OHDGDVVXPLQJ H[FHVVDQQXODUYROXPH /HDG6OXUU\IURP¶0'WR¶0'ZLWKSSJ([WHQGHG&ODVV*DGGLWLYHV 7RSRI7DLOWR¶79'$ERYH .4DQQLN7RSDW¶0'¶±¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ([WHQGHG&ODVV*DGGLWLYHV#IWVN 7DLO6OXUU\IURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI7DLO ¶±¶;IWIW;H[FHVV IW 6KRH-RLQWV¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 14 of 21 Printed: 29-Dec-21 ´,QWHUPHGLDWH&DVLQJWR¶0'¶79' &HPHQWIURP¶WR¶79'DERYHOLQHUVKRH ZLWKSSJ&ODVV*DVVXPLQJH[FHVV DQQXODUYROXPH &HPHQWIURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI&HPHQW ¶±¶;IWIW;H[FHVV IW 6KRH-RLQW ¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN ´,QWHUPHGLDWH/LQHUWR¶0'¶79' &HPHQWIURP¶WR¶79'DERYHWKH.XSDUXN&ZLWKSSJ&ODVV*DVVXPLQJH[FHVV DQQXODUYROXPH &HPHQWIURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI&HPHQW ¶±¶;IWIW;H[FHVV IW 6KRH-RLQW ¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN ´,QWHUPHGLDWH/LQHUWR¶0'¶79' *Due to high angle and short open hole section the required 250’ TVD TOC is above our liner hanger and in the shoe of the 9 7/8” casing. This is a high risk as our liner hanger is set against the plugs. If the plugs don’t bump we have to wait on cement. Intrm 4 is a drilling liner. A cement Intrm 3 shoe and Intrm 4 packer test provide isolation of the formation. &23UHTXHVWWRXVHWKH¶0'ࡱRSHQKROHYROXPH &HPHQWIURP¶0'WR¶0'ZLWKSSJ&ODVV*DGGLWLYHV 6KRHWR7RSRI&HPHQW ¶±¶;IWIW;H[FHVV IW 6KRH-RLQW¶;IWIW;H[FHVV IW 7RWDO9ROXPH IW !V[RISSJ&ODVV*DGGLWLYHV#IWVN $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 15 of 21 Printed: 29-Dec-21 $WWDFKPHQW±'ULOOLQJ+D]DUGV6XPPDU\ 7REHSRVWHGLQ5LJ)ORRU'RJKRXVH3ULRUWR6SXG +ROH´&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ &RQGXFWRU%URDFK/RZ0RQLWRUFHOODUFRQWLQXRXVO\GXULQJLQWHUYDO :HOO&ROOLVLRQ +LJK &ORVHO\PRQLWRUWUDYHOLQJF\OLQGHUXSGDWHDV QHHGHG8WLOL]HJ\URHTXLSPHQWDVQHHGHGWRYHULI\ ZHOOERUHORFDWLRQ&ORVHO\IROORZ&3$,$QWL &ROOLVLRQSROLFLHV6KXWLQRIIVHWZHOOVDVUHTXLUHG 5LJXSGLYHUWHUIRUFROOLVLRQULVNPLWLJDWLRQ *DV+\GUDWHV /RZ 'LYHUWHUGULOOVDQGLIREVHUYHG±FRQWUROGULOOUHGXFH SXPSUDWHVDQGFLUFXODWLQJWLPHUHGXFHPXG WHPSHUDWXUHV6KDOORZKD]DUGVWXG\QRWHGPLQLPDO ULVNRQ&'SDG $EQRUPDO3UHVVXUHLQ 6XUIDFH)RUPDWLRQV/RZ'LYHUWHUGULOOVLQFUHDVHGPXGZHLJKW6KDOORZ KD]DUGVWXG\QRWHGPLQLPDOULVNRQ&'SDG $EQRUPDO3UHVVXUHLQ& &'$QQXODU,QMHFWLRQ/RZ 7RSVHW&IRUPDWLRQ1RDQQXODULQMHFWLRQ SHUIRUPHGRQSDGVLQFHQRUDEQRUPDO SUHVVXUHHQFRXQWHUHGLQ&RQ&' &OD\%DOOLQJ +LJK 0DLQWDLQSODQQHGPXGSDUDPHWHUVDQGIORZUDWHV 8VHSURDFWLYHDQWLEDOOLQJVZHHSVDQGPXG SURGXFWDGGLWLRQV /RVW&LUFXODWLRQ /RZ 5HGXFHSXPSUDWHVPXGUKHRORJ\DGGORVW FLUFXODWLRQPDWHULDO FRQWUROSLSHUXQQLQJVSHHGV ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVPRQLWRU UHDOWLPH(&'VDGMXVWPXGUKHRORJ\DQGDGGORVW FLUFXODWLRQPDWHULDODVQHHGHG $EQRUPDO3UHVVXUHLQ 4DQQLN+LJK (PSOR\4DQQLN3UHVVXUH0DQDJHPHQW3ODQ 3HUIRUPZHOOFRQWUROGULOOVIORZFKHFNDVQHHGHG 03'ILQJHUSULQWLISRVVLEOHLQFUHDVHPXGZHLJKW $EQRUPDO3UHVVXUHLQ 2YHUEXUGHQ)RUPDWLRQV/RZ3HUIRUPZHOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVDQGLQFUHDVHPXGZHLJKWDVQHHGHG +ROH&OHDQLQJ /RZ 0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO DQGXVHEHVWKROHFOHDQLQJSUDFWLFHVDQG EDFNUHDPWRFOHDQKROHSULRUWROLQHUUXQ 6ZDEELQJRQ7ULSV 0HGLXP 5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV PRQLWRUKROHILOOSXPSRXWRIKROHPRQLWRUUHDOWLPH (&'VDQGXVH03'LISRVVLEOH 'LIIHUHQWLDO6WLFNLQJ 0HGLXP 0RQLWRUIRUVHHSDJHORVVHVPRQLWRUVWDWLF7 ' IRUFHVUXQ/&0DVQHHGHGDQGHPSOR\SURSHU FHQWUDOL]DWLRQWRSURYLGHVHPLIOXVKOLQHUVWDQGRII 4DQQLN&HPHQW,VRODWLRQ0HGLXP &HQWUDOL]HIRU!6WDQG2IIXVH/HDG7DLO VOXUU\GHVLJQWRUHGXFH(&'VFUHDWHPXGVSDFHU VOXUU\WUDLQWRDOORZHIIHFWLYHGLVSODFHPHQWDQGEH SUHSDUHGIRUOLQHUWRSVTXHH]HFRQWLQJHQF\ 03'ILQJHUSULQWLISRVVLEOH 4DQQLN3UHVVXUH0DQDJHPHQW3ODQ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 16 of 21 Printed: 29-Dec-21 ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ +ROH&OHDQLQJ /RZ 0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO XVHEHVWKROHFOHDQLQJSUDFWLFHVDQGEDFNUHDPWR FOHDQKROHSULRUWROLQHUUXQ %+$)DLOXUH 0HGLXP3URDFWLYHO\SODQ%+$WULSWRDOORZIRUWRROZHDU HYDOXDWLRQDQGPRQLWRUVKRFNDQGYLEUDWLRQ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG &DVLQJ:HDU 0HGLXP0RGHOSUHYLRXVOLQHUFDVLQJZHDUKDYH15'33V DYDLODEOH XVH&3$,FDVLQJZHDUEHVWSUDFWLFHV 6WXFN3LSH 0HGLXP 8VHJRRGGULOOLQJSUDFWLFHVPRQLWRU7 'WUHQGV UXQ%+$GLVFRQQHFWVXELIQHFHVVDU\KDYHILVKLQJ NLWSUHLGHQWLILHG 'LIIHUHQWLDO6WLFNLQJ 0HGLXP 0RQLWRUIRUVHHSDJHORVVHVUXQ/&0DVQHHGHG PRQLWRUVWDWLF7 'IRUFHVFHQWUDOL]HOLQHUDV QHHGHGWRSUHYHQWGLIIHUHQWLDOVWLFNLQJ )ORDWHG/LQHU5XQ +LJK (PSOR\&'DQG&'/HVVRQV/HDUQHG LPSOHPHQWIORWDWLRQVSHFLILFZHOOFRQWUROGULOOV XVH IORDWHGOLQHUGHFLVLRQWUHHIRULVVXHVHQFRXQWHUHG ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ +ROH&OHDQLQJ /RZ 0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO XVHEHVWKROHFOHDQLQJSUDFWLFHVDQGEDFNUHDPWR FOHDQKROHSULRUWROLQHUUXQ %+$)DLOXUH 0HGLXP3URDFWLYHO\SODQ%+$WULSWRDOORZIRUWRROZHDU HYDOXDWLRQDQGPRQLWRUVKRFNDQGYLEUDWLRQ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG &DVLQJ:HDU 0HGLXP0RGHOSUHYLRXVOLQHUFDVLQJZHDUKDYH15'33V DYDLODEOH XVH&3$,FDVLQJZHDUEHVWSUDFWLFHV 6WXFN3LSH 0HGLXP 8VHJRRGGULOOLQJSUDFWLFHVPRQLWRU7 'WUHQGV UXQ%+$GLVFRQQHFWVXELIQHFHVVDU\KDYHILVKLQJ NLWSUHLGHQWLILHG 'LIIHUHQWLDO6WLFNLQJ 0HGLXP 0RQLWRUIRUVHHSDJHORVVHVUXQ/&0DVQHHGHG PRQLWRUVWDWLF7 'IRUFHVFHQWUDOL]HOLQHUDV QHHGHGWRSUHYHQWGLIIHUHQWLDOVWLFNLQJ )ORDWHG/LQHU5XQ +LJK (PSOR\&'DQG&'/HVVRQV/HDUQHG LPSOHPHQWIORWDWLRQVSHFLILFZHOOFRQWUROGULOOV XVH IORDWHGOLQHUGHFLVLRQWUHHIRULVVXHVHQFRXQWHUHG $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 17 of 21 Printed: 29-Dec-21 ´[´+ROH´/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ :HOOERUH,QVWDELOLW\ +LJK ,VRODWHGLQVWDEOHVKDOHVZLWKGHGLFDWHGKROH VHFWLRQHPSOR\&'DQG&'LQVWDELOLW\ PLWLJDWLRQVXQGHUUHDPHUSURSHU(0:WRSUHYHQW VKHDUIDLOXUH03' LQKLELWHGIOXLGPRQLWRUUHDO WLPHGULOOLQJGDWD8VH&3$,/RZHU6KDOHLQVWDELOLW\ PLWLJDWLRQGULOOLQJEHVWSUDFWLFHV /RVW&LUFXODWLRQ +LJK 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG8VH03'WRUHGXFH(&'V $EQRUPDO5HVHUYRLU 3UHVVXUH+LJK :HOOFRQWUROGULOOVIORZFKHFNGXULQJFRQQHFWLRQV XVH03'WRILQJHUSULQWSURYLGHG\QDPLF RYHUEDODQFHLQFUHDVHPXGZHLJKWDVQHHGHGWR PDLQWDLQRYHUEDODQFHGXULQJWULSSLQJDFWLYLWLHV /DQGLQJLQ7KLQ.XSDUXN&+LJK 8VH&'DQG&'GDWDWRUHGXFHGHSWK XQFHUWDLQW\8VH8OWUD'HHS$]LPXWKDO5HVLVWLYLW\ WRLGHQWLI\.XSDUXN&DQGDVVLVWZLWKDGMXVWLQJ ODQGLQJ 6ZDEELQJRQ7ULSV 0HGLXP 5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ XVH03'LISRVVLEOH &HPHQWDURXQGOLQHU KDQJHUIURP¶79' UHJXDOWLRQ +LJK 'XHWRKLJKDQJOHDQGVKRUWRSHQKROHVHFWLRQWKH UHTXLUHG¶79'72&LVDERYHRXUOLQHUKDQJHU DQGLQWKHVKRHRIWKH´FDVLQJ7KLVLVDKLJK ULVNDVRXUOLQHUKDQJHULVVHWDJDLQVWWKHSOXJV,I WKHSOXJVGRQ¶WEXPSZHKDYHWRZDLWRQFHPHQW 5HGXFHFHPHQWFROXPQWR¶0'RURIWKH RSHQKROHYROXPH %DULWH6DJ +LJK 8VHXOWUDILQHEDULWHWRUHGXFHVDJULVN(PSOR\ EDULWHVDJPLWLJDWLRQEHVWSUDFWLFHV ´+ROH´3UH3HUIRUDWHG/LQHU,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVW&LUFXODWLRQ 0HGLXP 5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDODVQHHGHG8VH03'WRUHGXFH(&'V $EQRUPDO5HVHUYRLU 3UHVVXUH+LJK :HOOFRQWUROGULOOVIORZFKHFNGXULQJFRQQHFWLRQV XVH03'WRILQJHUSULQWSURYLGHG\QDPLF RYHUEDODQFHLQFUHDVHPXGZHLJKWDVQHHGHGWR PDLQWDLQRYHUEDODQFHGXULQJWULSSLQJDFWLYLWLHV 6WD\LQJLQ.XSDUXN&+LJK 8VHJHRVWHHULQJEHVWSUDFWLFHVIURPRIIVHW1DQXT .XSDUXN&XVH'HHS5HDGLQJ$]LPXWKDO 5HVLVWLYLW\WRROWRDVVLVWZLWKUHVHUYRLU LQWHUSUHWDWLRQDQGFUHDWHGHFLVLRQWUHHUHVSRQGLQJ WRIRUUHVHUYRLUH[FXUVLRQV :HOOERUH,QVWDELOLW\+LJK (PSOR\&'DQG&'LQVWDELOLW\ PLWLJDWLRQVXQGHUUHDPHUSURSHU(0:WRSUHYHQW VKHDUIDLOXUH03' LQKLELWHGIOXLGPRQLWRUUHDO WLPHGULOOLQJGDWD8VH&3$,/RZHU6KDOHLQVWDELOLW\ PLWLJDWLRQGULOOLQJEHVWSUDFWLFHV %DULWH6DJ+LJK8VHZHLJKWHGNLOOZHLJKWEULQHIRUWULSSLQJ RSHUDWLRQV $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 18 of 21 Printed: 29-Dec-21 6ZDEELQJRQ7ULSV 0HGLXP 5HGXFHWULSVSHHGVXVHZHLJKWHGNLOOZHLJKWEULQH WRUHGXFHVZDESUHVVXUHPRQLWRUWULSWDQNV XVH 03'LISRVVLEOH :HOO3UR[LPLW\5LVNV &'ZLOOEHWKHVHYHQW\VHYHQWKWKZHOOGULOOHGRQWKHSDG'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFH LQIRUPDWLRQDVUHTXLUHGE\$&&ELVSURYLGHGLQWKHIROORZLQJDWWDFKPHQWV 'ULOOLQJ$UHD5LVNV 4DQQLN .XSDUXN&5HVHUYRLU3UHVVXUH2IIVHWLQMHFWLRQKDVWKHSRWHQWLDOWRLQFUHDVHWKHUHVHUYRLU SUHVVXUH+HLJKWHQHGDZDUHQHVVDQGJRRGZHOOFRQWUROSUDFWLFHVZLOOEHXVHGWRSUHYHQWDZHOOFRQWURO VFHQDULR,IDZHOOFRQWUROVFHQDULRLVHQFRXQWHUHGZHOOFRQWUROGULOOVZLOOEHXVHGWRUHGXFHVKXWLQWLPHV DQGHQRXJKNLOOZHLJKWPDWHULDOZLOOEHRQORFDWLRQWRNLOOWKHZHOODVUHTXLUHG :HDN2YHUEXUGHQ6DQG6WULQJHUV±&OHDQVDQGVWULQJHUVIURPVORSHGHSRVLWVZHUHLQWHUPLWWHQWO\ GHSRVLWHGRQWKHVORSHVKHOYHVRIWKH7RURNDQG$OELDQ7KHVHFOHDQVDQGVKDYHUHGXFHGIUDFWXUH JUDGLHQWVUHODWLYHWRWKHVLOWVDQGFOD\VWKDWPDNHXSPRVWRIWKHRYHUEXUGHQ/&0PDWHULDOZLOOEH DYDLODEOHWRPLWLJDWHORVVHVLQWKHLQWHUPHGLDWHVHFWLRQV /RZHU6KDOH6WDELOLW\7KH+5=DQG.DOXELNLQWKH,QWHUPHGLDWHKROHVHFWLRQZLOOUHTXLUHKLJKHUPXG ZHLJKWVWKDQKLVWRULFDOO\XVHGWRHQKDQFHZHOOERUHVWDELOLW\0DQDJHG3UHVVXUH'ULOOLQJZLOOEHXVHGLQ FRQMXQFWLRQZLWKDVWULQJFDVLQJGHVLJQWRPLWLJDWH+5= .DOXELNVKDOHLQVWDELOLW\/&0PDWHULDODQG ZHOOERUHVWUHQJWKHQLQJSLOOVDUHH[SHFWHGWREHHIIHFWLYHLQGHDOLQJZLWKORVWFLUFXODWLRQDVUHTXLUHGWR PDLQWDLQVXIILFLHQWRYHUEDODQFHIRUZHOOERUHLQVWDELOLW\PLWLJDWLRQ )RUDOOVHFWLRQVJRRGWULSSLQJSUDFWLFHVZLOOEHVWUHVVHGWRPLQLPL]HWKHSRWHQWLDORIWDNLQJVZDEEHGNLFNV S JUDGLHQWVU SS \ FOHDQVDQGVKDYHUHGXFHGIUDFWXUH TJ 0DQDJHG3UHVVXUH'ULOOLQJZLOOEHXVHGLQJ\ \J FRQMXQFWLRQZLWKDVWULQJFDVLQJGHVLJQWRPLWLJDWH+5= .DOXELNVKDOHLQVWDELOLW\ $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&'6DYHG'HF CRU CD2-361 AOGCC APD Page 19 of 21 Printed: 29-Dec-21 $WWDFKPHQW±&RPSOHWLRQ6FKHPDWLF $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 20 of 21 Printed: 29-Dec-21 $WWDFKPHQW±3URSHUW\3ODW $2*&&$SSOLFDWLRQIRU3HUPLWWR'ULOO:HOO&58&' 6DYHG'HF CRU CD2-361 AOGCC APD Page 21 of 21 Printed: 29-Dec-21 $WWDFKPHQW±'LUHFWLRQDO3ODQ&' &'ZS 2EMHFWLYH3ODQQHGILQDOZHOOSDWKIRU)LRUG:HVW.XSDUXNSUHSURGXFHGLQMHFWRU&' &' ZS3ODQ6XPPDU\ 'RJOHJ6HYHULW\ 0HDVXUHG'HSWK [[ [ [ [ [ $]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@ &'3% &' &' &' &' &' &' &' &' &' &' ZS &' ZS 7UXH9HUWLFDO'HSWK 9HUWLFDO6HFWLRQDW [ [ [ [ [[ &HQWUHWR&HQWUH6HSDUDWLRQ 0HDVXUHG'HSWK (TXLYDOHQW0DJQHWLF'LVWDQFH '', 6859(< 352*5$0 'DWH79DOLGDWHG<HV9HUVLRQ 'HSWK)URP 'HSWK 7R 6XUYH\3ODQ 7RRO &'ZS&' *<'*&66 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*06 &$6,1* '(7$,/6 79' 0' 1DPH [ [ [ [ [ [ 0DJ0RGHO 'DWH %**0 $SU 0DJQHWLF1RUWKLV(DVWRI7UXH1RUWK0DJQHWLF'HFOLQDWLR 0DJ'LS )LHOG6WUHQJWK Q7 6(&7,21 '(7$,/6 6HF 0' ,QF $]L 79' 16 (: 'OHJ 7)DFH 96HFW 7DUJHW $QQRWDWLRQ 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUWKROGDW0' 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUWKROGDW0' 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW'/67)2 6WDUWKROGDW0' 6WDUW'/67)2 6WDUWKROGDW0' 6WDUWKROGDW0' 7'DW )250$7,21723'(7$,/6 79'3DWK )RUPDWLRQ %DVH)UR]HQ6DQG %DVH3HUP & & & & . 7RS4DQQLN. %DVH4DQQLN.%DVH 7RS.:HW6DQG %DVH.:HW6DQG $OE $OE $OE )6& +5= 8SSHU.DOXELN /RZHU.DOXELN. .XS& %\VLJQLQJWKLV,DFNQRZOHGJHWKDW,KDYHEHHQLQIRUPHGRIDOOULVNVFKHFNHGWKDWWKHGDWDLVFRUUHFWHQVXUHGLW VFRPSOHWHQHVVDQGDOOVXUURXQGLQJZHOOVDUHDVVLJQHGWRWKHSURSHUSRVLWLRQDQG,DSSURYHWKHVFDQDQGFROOLVLRQDYRLGDQFHSODQDVVHWRXWLQWKHDXGLWSDFN,DSSURYHLWDVWKHEDVLLV IRUWKHILQDOZHOOSODQDQGZHOOVLWHGUDZLQJV,DOVRDFNQRZOHGJHWKDWXQOHVVQRWLILHGRWKHUZLVHDOOWDUJHWVKDYHDIHHWODWHUDOWROHUDQFH 3UHSDUHGE\&KHFNHGE\$FFHSWHGE\$SSURYHGE\ 3ODQ#XVIW' 7UXH9HUWLFDO'HSWK 9HUWLFDO6HFWLRQDW[[[[[[&'ZS%DVH)UR]HQ6DQG%DVH3HUP&&&&.7RS4DQQLN.%DVH4DQQLN.%DVH7RS.:HW6DQG%DVH.:HW6DQG$OE$OE$OE)6&+5=8SSHU.DOXELN/RZHU.DOXELN..XS&&'ZS'HFHPEHU6HFWLRQ9LHZ 6RXWK1RUWK :HVW(DVW[[[[[[&'ZS&' ZS3ODQ9LHZWhile drilling production section, stay within 100 feet laterally of plan, unless notified otherwise.'HFHPEHU &'ZS6SLGHU3ORW'HFHPEHU7R1RUWKLQJXVIWLQ(DVWLQJXVIWLQ7HPSWDWLRQ7HPSWDWLRQ$&'&'3%&'3%&'&'3%&'&'/&'&'/&'&'&'3%&'3%&'&'&'/&'3%&'&'3%&'&'&'&'3%&'3%&'&'&'3%&'3%&'&'3%&'&'$&'&'3%&'&'&'&'3%&'&'&'3%&'&'3%&'&'&'3%&'3%&'&'&'3%&'&'&'&'3%&'&'ZSDSSURYHG&'3%&'3%&'&'3%&'&'$&'%&'&'3%&'&'$&'&'3%&'&'&'&'$&'$/&'3%&'&'3%&'&'&'&'3%&'&'3%&'&'&'&'&'/&'/&'/&'/&'&'&'&'&'3%&'&'&'/ZS&'/ZS&'&'$&'$/&'&'&'&'&'3%&'&'&'&'&'/&'&'&'/&'&'&'/&'&'3%&'&'$&'3%&'&'&'3%&'&'&'&'3%&'3%&'&'&'ZSQRUWK&'ZS&'ZS&'ZS&'ZS&'ZS &HQWUHWR&HQWUH6HSDUDWLRQ 3DUWLDO0HDVXUHG'HSWK &'3%&'&'$&'%&'&'3%&'&'/&'/&'/&'/&'&'ZS&'ZS(TXLYDOHQW0DJQHWLF'LVWDQFH &' ZS /DGGHU9LHZ &HQWUHWR&HQWUH6HSDUDWLRQ 0HDVXUHG'HSWK&'&'/&'&'3%&'&'3%&'&'&'&'3%&'&'3%&'&'$&'%&'&'&'3%&'&'3%&'&'3%&'&'&'/&'/&'/&'/&'&'&'&'&'3%&'&'&'/ZS&'/ZS&'&'$&'$/&'&'&'&'&'3%&'&'/&'&'&'/&'&'3%&'&'&'3%&'ZS&'ZS&'ZS&'ZS(TXLYDOHQW0DJQHWLF'LVWDQFH 6859(<352*5$0 'HSWK )URP 'HSWK 7R 6XUYH\3ODQ 7RRO &'ZS&' *<'*&66 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)5+'606 &'ZS&' 0:'2:6* &'ZS&' 0:',)56$*06 'HFHPEHU &$6,1*'(7$,/6 79' 0' 1DPH [ [ [ [ [ [ &' ZS 7&9LHZ $]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@ &' &'3% &' &' &'3% &' &'$ &'% &' &'3% &' &'3% &' &'3% &' &'/ &'/ &'/ &'/ &' &' &' &' &'3% &' &' &'/ ZS &'/ ZS &' &'$ &'$/ &' &' &'/ &' &'3% &' ZS &'ZS 6859(< 352*5$0 'DWH79DOLGDWHG<HV9HUVLRQ )URP 7R 7RRO *<'*&66 0:'2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:'2:6* 0:',)56$*06 &$6,1* '(7$,/6 79'0'1DPH [ [ [ [ [ [ 6(&7,21 '(7$,/6 6HF 0' ,QF $]L 79' 16 (: 'OHJ 7)DFH 96HFW 7DUJHW $QQRWDWLRQ 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUWKROGDW0' 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUWKROGDW0' 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW%XLOG 6WDUW'/67)2 6WDUWKROGDW0' 6WDUW'/67)2 6WDUWKROGDW0' 6WDUWKROGDW0' 7'DW ϮͲϯϲϭǁƉϭϯ͘ϭ&ůŝƉďŽŽŬ6859(<352*5$0'HSWK)URP 'HSWK 7R 7RRO *<'*&66 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)56$*06&$6,1* '(7$,/679'0'1DPH [ [ [ [ [ [$]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@&'3%&'&'/&'/&'/&'/&'&'&'&'&'3%&'&'&'/&' ZS&'ZS )URP&RORXU7R0'ϱϰ͘ϱϬdŽϭϬϬϬ͘ϬϬ0' $]L 7)DFH ϮͲϯϲϭǁƉϭϯ͘ϭ&ůŝƉďŽŽŬ6859(<352*5$0'HSWK)URP 'HSWK 7R 7RRO *<'*&66 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)56$*06&$6,1* '(7$,/679'0'1DPH [ [ [ [ [ [$]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@&'3%&'&'&'3%&'&'$&'%&'&'3%&'&'3%&'&'/&'/&'/&'/&'&'&'/&' ZS&' ZS )URP&RORXU7R0'ϭϬϬϬ͘ϬϬdŽϮϱϬϬ͘ϬϬ0' $]L 7)DFH ϮͲϯϲϭǁƉϭϯ͘ϭ&ůŝƉďŽŽŬ6859(<352*5$0'HSWK)URP 'HSWK 7R 7RRO *<'*&66 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)56$*06&$6,1* '(7$,/679'0'1DPH [ [ [ [ [ [$]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@&'&'3% )URP&RORXU7R0'ϮϰϬϬ͘ϬϬdŽϲϲϬϬ͘ϬϬ0' $]L 7)DFH ϮͲϯϲϭǁƉϭϯ͘ϭ&ůŝƉďŽŽŬ6859(<352*5$0'HSWK)URP 'HSWK 7R 7RRO *<'*&66 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)56$*06&$6,1* '(7$,/679'0'1DPH [ [ [ [ [ [$]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@&'3% )URP&RORXU7R0'ϲϱϬϬ͘ϬϬdŽϭϰϮϬϬ͘ϬϬ0' $]L 7)DFH ϮͲϯϲϭǁƉϭϯ͘ϭ&ůŝƉďŽŽŬ6859(<352*5$0'HSWK)URP 'HSWK 7R 7RRO *<'*&66 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)56$*06&$6,1* '(7$,/679'0'1DPH [ [ [ [ [ [$]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@ )URP&RORXU7R0'ϭϰϭϬϬ͘ϬϬdŽϮϱϬϬϬ͘ϬϬ0' $]L 7)DFH ϮͲϯϲϭǁƉϭϯ͘ϭ&ůŝƉďŽŽŬ6859(<352*5$0'HSWK)URP 'HSWK 7R 7RRO *<'*&66 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:'2:6* 0:',)5+'606 0:' 2:6* 0:',)5+'606 0:' 2:6* 0:',)56$*06&$6,1* '(7$,/679'0'1DPH [ [ [ [ [ [$]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@ )URP&RORXU7R0'ϮϰϬϬϬ͘ϬϬdŽϯϯϰϬϬ͘ϬϬ0' $]L 7)DFH &'ZS6SLGHU3ORW'HFHPEHU7R1RUWKLQJXVIWLQ(DVWLQJXVIWLQ7HPSWDWLRQ7HPSWDWLRQ$&'&'3%&'3%&'&'3%&'&'/&'&'/&'&'&'3%&'3%&'&'&'/&'3%&'&'3%&'&'&'&'3%&'3%&'&'&'3%&'3%&'&'3%&'&'$&'&'3%&'&'&'&'3%&'&'&'3%&'&'3%&'&'&'3%&'3%&'&'&'3%&'&'&'&'3%&'&'ZS&'3%&'3%&'&'3% &'&'$&'%&'&'3%&'&'$&'&'3%&'&'&'&'$&'$/&'3%&'&'3%&'&'&' &'3%&'&'3%&'&'&'&'&'/&'/&'/&'/&'&'&'&'&'3%&'&'&'/ZS&'/ZS&'&'$&'$/&'&'&'&'&'3%&'&'&'&'&'/&'&'&'/&'&'&'/&'&'3%&'&'$&'3%&'&'&'3%&'&'&'&'3%&'3%&' &'&'ZSQRUWK&'ZS&'ZS&'ZS&'ZS&'ZS &'ZS6SLGHU3ORW'HFHPEHU7R1RUWKLQJXVIWLQ(DVWLQJXVIWLQ&'&'3%&'3%&'&'3%&'&'/&'&'/&'&'&'3%&'3%&'&'&'/&'3%&'&'3%&'&'&'&'3%&'3%&'&'&'3%&'3%&'&'3%&'&'$&'&'3%&'&'&'&'3%&'&'&'3%&'&'3%&'&'&'3%&'3%&'&'&'3%&'&'&'&'3%&'&'ZS&'3%&'3%&' &'3%&'&'$&'%&'&'3%&'&'$&'&'3%&'&'&'&'$&'$/&'3%&'&'3%&'&'&'&'3%&'&'3%&'&'&'&'&'/&'/&'/&'/&'&'&'&'&'3%&'&'&'/ZS&'/ZS&'&'$&'$/&'&'&'&'&'3%&'&'&'&'&'/&'&'&'/&'&'&'/&'&'3%&'&'$&'3%&'&'&'3%&'&'&'&'3%&'3%&'&'&'ZSQRUWK&'ZS&'ZS&'ZS&'ZS&'ZS &'ZS6SLGHU3ORW'HFHPEHU7R1RUWKLQJXVIWLQ(DVWLQJXVIWLQ&'&'3%&'3%&'&'3%&'&'/&'&'/&'&'&'3%&'3%&'&'&'/&'3%&'&'3%&'&'&'&'3%&'3%&'&'&'3%&'3% &'&'3% &' &'$&'&'3% &'&'&'&'3% &'&'&'3%&'&'3% &' &'&'3%&'3%&' &' &'3% &'&'&'&'3%&'&'ZS&'3%&'3% &' &'3%&'&'$&'%&'&'3%&'&'$&'&'3%&'&'&'&'$&'$/&'3%&'&'3%&'&'&'&'3%&'&'3%&'&'&'&'&'/&'/&'/&'/&'&'&'&'&'3%&'&'&'/ZS&'/ZS&'&'$&'$/&'&' &'&'&'3%&'&'&'&'&'/&'&'&'/&'&'&'/&'&'3%&'&'$&'3%&'&'&'3%&'&'&'&'3%&'3%&'&'&'ZSQRUWK&'ZS&'ZS&'ZS&'ZS&'ZS &'ZS6SLGHU3ORW'HFHPEHU7R1RUWKLQJXVIWLQ(DVWLQJXVIWLQ&'&'/&'3% &' &'&' &'&'&'3%&'&'ZS&'3%&'3% &' &'3% &' &'$ &'%&'&'3%&'&'$&'&'3% &'&'&'&'$&'$/&'3% &' &'3%&' &' &'3% &' &'3%&'&' &' &' &'/ &'/ &'/ &'/&'&'&'&'&'3%&' &' &'/ZS &'/ZS &' &'$ &'$/ &'&' &'&'&'3%&'&'&' &' &'/&'&'&'/&'&'&'/ &' &'3%&'&'$&'3%&'&'&'3%&'&'&'&'3%&'3%&' &'&'ZSQRUWK&'ZS&'ZS&'ZS&'ZS &'ZS7HPSWDWLRQ 7HPSWDWLRQ$&'&'3%&'3%&'&'3%&'&'/&'&'/&'&'&'3%&'3%&'&'&'/&'3%&'&'3%&'&'&'&'3%&'3%&'&'&'3%&'3%&'&'3%&'&'$&'&'3%&'&'&'3%&'&'&'3%&'&'3%&'&'3%&'3%&'&'3%&'&'&'3%&'&'3%&'3%&'&'3%&'%&'&'&'3%&'&'3%&'3%&'&'/&'/&'/&'&'&'&'&'/ ZS&'/ ZS&'3%&'&'/&'&'3%&'&'&'3%&'&'&'&'3%&'3%&'&'ZS&' ZS&' ZS'9LHZ&'ZS'HFHPEHU &'ZS7HPSWDWLRQ 7HPSWDWLRQ$&'&'3%&'3%&'&'3%&'&'/&'/&'&'&'3%&'3%&'&'&'/&'3%&'&'3%&'&'&'&'3%&'3%&'&'&'3%&'3%&'&'3%&'&'$&'&'3%&'&'&'3%&'&'&'3%&'&'3%&'&'3%&'3%&'&'3%&'&'&'3%&'&'ZSDSSURYHG&'3%&'3%&'&'3%&'%&'3%&'&'&'/&'/&'/&'/&'&'&'&'&'/ ZS&'/ ZS&'3%&'&'/&'&'3%&'&'&'3%&'&'&'&'3%&'3%&'&'ZSQRUWK&'ZS'9LHZ&'ZS'HFHPEHU &'ZS7HPSWDWLRQ 7HPSWDWLRQ $&'&'&'/&'&'/&'&'3%&'&'3%&'&'3%&'3%&'&'3%&'3%&'ZS&'&' ZS'9LHZ&'ZS'HFHPEHU &'ZS7HPSWDWLRQ 7HPSWDWLRQ $&'&'3%&'&'/&'&'&'/&'3%&'&'&'&'3%&'3%&'&'&'3%&'&'&'3%&'3%&'&'&'&'&'&'3%&'3%&' ZS'9LHZ&'ZS'HFHPEHU 6RXWK1RUWKXVIWLQ :HVW(DVWXVIWLQ 7H P S W D W L R Q 7HPSWDWLRQ$&'3%&'&'ZSDSSURYHG&'&'ZSQRUWK&'ZS&'ZS[[[&'ZS&'ZS4XDUWHU0LOH9LHZ'HFHPEHU:(//%25(7$5*(7'(7$,/60$3&225',1$7(61DPH 79' 6KDSH&'7+ &LUFOH5DGLXV&'77 &LUFOH5DGLXV $/3,1( )$&,/,7<352-(&7'5,// 6,7(&' &' W,KE͗ϵϬϳͲϲϳϬͲϰϳϯϵ W,KE͗ϵϬϳͲϲϳϬͲϰϳϯϵ NAD 83 NAD 83 1 Guhl, Meredith D (OGC) From:Wiens, Matt R <Matt.R.Wiens@conocophillips.com> Sent:Thursday, January 20, 2022 11:46 AM To:Loepp, Victoria T (OGC); Rixse, Melvin G (OGC) Cc:Hobbs, Greg S Subject:CD2-361 Updated kick tolerance All, Thanksforthemeetingtoday.Belowisthekicktolerancewiththemudweight=totheporepressuretosimulateaswab kick.PleasenoteproductionPPwillbehigherthanmudweightduetofracgradientlimitation. Thanks, Matt Wiens DrillingEngineerͲERD ConocoPhillipsAlaskaATOͲ1788 O:+1Ͳ907Ͳ265Ͳ1101 C:+1Ͳ281Ͳ620Ͳ1222 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. See next page for full table Revised 2/2015 TRANSMITTAL LETTER CHECKLIST WELL NAME: ______________________________________ PTD: _____________________________________________ ___ Development ___ Service ___ Exploratory ___ Stratigraphic Test ___ Non-Conventional FIELD: ____________________________ POOL: ______________________________________ Check Box for Appropriate Letter / Paragraphs to be Included in Transmittal Letter CHECK OPTIONS TEXT FOR APPROVAL LETTER MULTI LATERAL (If last two digits in API number are between 60-69) The permit is for a new wellbore segment of existing well Permit No. _____________, API No. 50-_______________________. Production should continue to be reported as a function of the original API number stated above. Pilot Hole In accordance with 20 AAC 25.005(f), all records, data and logs acquired for the pilot hole must be clearly differentiated in both well name (_______________________PH) and API number (50-_____________________) from records, data and logs acquired for well (name on permit). Spacing Exception The permit is approved subject to full compliance with 20 AAC 25.055. Approval to produce/inject is contingent upon issuance of a conservation order approving a spacing exception. (_____________________________) as Operator assumes the liability of any protest to the spacing exception that may occur. Dry Ditch Sample All dry ditch sample sets submitted to the AOGCC must be in no greater than 30' sample intervals from below the permafrost or from where samples are first caught and 10' sample intervals through target zones. Non- Conventional Well Please note the following special condition of this permit: Production or production testing of coal bed methane is not allowed for well ( ) until after ( ) has designed and implemented a water well testing program to provide baseline data on water quality and quantity. (________________________) must contact the AOGCC to obtain advance approval of such water well testing program. Well Logging Requirements Regulation 20 AAC 25.071(a) authorizes the AOGCC to specify types of well logs to be run. In addition to the well logging program proposed by (_______________________________) in the attached application, the following well logs are also required for this well: Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071, composite curves for well logs run must be submitted to the AOGCC within 90 days after completion, suspension or abandonment of this well. Alpine OilColville River CRU CD2-361 221-116 WELL PERMIT CHECKLISTCompanyConocoPhillips Alaska, Inc.Well Name:COLVILLE RIV UNIT CD2-361Initial Class/TypeDEV / PENDGeoArea890Unit50360On/Off ShoreOnProgramDEVField & PoolWell bore segAnnular DisposalPTD#:2211160COLVILLE RIVER, ALPINE OIL - 120100NA1 Permit fee attachedYes Surface location lies in ADL 380075; wellbore passes thru ADL 0025530, ADL0387212, and ADL0387211;2 Lease number appropriateYes top of the productive interval lies in ADL 0388906; productive portion of well passes thru AA 0084140,3 Unique well name and numberYes ADL0388904, and ADL0380093; and the bottom-hole location lies in ADL0390344.4 Well located in a defined poolYes COLVILLE RIVER, ALPINE OIL - 120100, governed by CO 443D.5 Well located proper distance from drilling unit boundaryYes CO No. 443D has no interwell spacing restrictions. Wellbore will be more than 500'6 Well located proper distance from other wellsYes from an external property line where ownership or landownership changes.7 Sufficient acreage available in drilling unitYes As planned, well will conform to spacing requirements.8 If deviated, is wellbore plat includedYes9 Operator only affected partyYes10 Operator has appropriate bond in forceYes11 Permit can be issued without conservation orderYes12 Permit can be issued without administrative approvalYes13 Can permit be approved before 15-day waitNA14 Well located within area and strata authorized by Injection Order # (put IO# in comments) (For sNA15 All wells within 1/4 mile area of review identified (For service well only)NA16 Pre-produced injector: duration of pre-production less than 3 months (For service well only)NA17 Nonconven. gas conforms to AS31.05.030(j.1.A),(j.2.A-D)Yes 80" conductor provided18 Conductor string providedYes 2316' MD19 Surface casing protects all known USDWsYes 155% excess20 CMT vol adequate to circulate on conductor & surf csgNo21 CMT vol adequate to tie-in long string to surf csgNo uncemented production liner22 CMT will cover all known productive horizonsYes23 Casing designs adequate for C, T, B & permafrostYes Rig has steel tanks24 Adequate tankage or reserve pitNA25 If a re-drill, has a 10-403 for abandonment been approvedYes26 Adequate wellbore separation proposedYes diverter line variance requested and approved27 If diverter required, does it meet regulationsYes Max reservoir pressure 4305 psig(11.5 ppg EMW); will drill w/ 9.5-12.2 ppg EMW; MPD used28 Drilling fluid program schematic & equip list adequateYes29 BOPEs, do they meet regulationYes MPSP is 3579 psig; will test BOPs to 4000 psig30 BOPE press rating appropriate; test to (put psig in comments)Yes31 Choke manifold complies w/API RP-53 (May 84)Yes32 Work will occur without operation shutdownNo H2S measures rqd33 Is presence of H2S gas probableNA34 Mechanical condition of wells within AOR verified (For service well only)Yes H2S not encountered in offset wells. However, rig will be equipped with operational sensors/alarms.35 Permit can be issued w/o hydrogen sulfide measuresYes Maximum expected reservoir pressure is about 11.5 ppg EMW; will be drilled with 9.5 to 12.2 ppg36 Data presented on potential overpressure zonesNA mud using Managed Pressure Drilling technique to maintain borehole stability in shale sections37 Seismic analysis of shallow gas zonesNA and manage reservoir pressure. Some potential to encounter lost circulation. Adequate mud and38 Seabed condition survey (if off-shore)NA LCM supplies will be available on site. Drilling hazards and mitigation discussed on p. 15-18.39 Contact name/phone for weekly progress reports [exploratory only]ApprSFDDate12/29/2021ApprVTLDate1/20/2022ApprSFDDate12/29/2021AdministrationEngineeringGeologyGeologic Commissioner:Date:Engineering Commissioner:DatePublic CommissionerDate-03JLC 1/20/2022