The URL can be used to link to this page

Home My WebLink About222-015DATA SUBMITTAL COMPLIANCE REPORTAPI No.50-629-23639-61-00Well Name/No.NIKAITCHUQ SP03-NE2L2Completion Status1-OILCompletion Date5/4/2022Permit to Drill2220150OperatorEni US Operating Co. Inc.MD22084TVD4041Current Status1-OIL12/16/2022UICNoWell Log Information:DigitalMed/FrmtReceivedStart StopOH /CHCommentsLogMediaRunNoElectr DatasetNumberNameIntervalList of Logs Obtained:GR/RES/DEN/NEU/Caliper/CBL/mudlogsNoNoYesMud Log Samples Directional SurveyREQUIRED INFORMATION(from Master Well Data/Logs)DATA INFORMATIONLog/DataTypeLogScaleDF5/27/202212741 8899 Electronic Data Set, Filename: SP03-NE2_MFC_28MAR22_MainPass.las36669EDDigital DataDF5/27/202212727 12199 Electronic Data Set, Filename: SP03-NE2_MFC_28MAR22_RepeatPass.las36669EDDigital DataDF5/27/20221000 798 Electronic Data Set, Filename: SP03-NE2_RBT_28MAR22_FreePipe.las36669EDDigital DataDF5/27/202212741 8900 Electronic Data Set, Filename: SP03-NE2_RBT_28MAR22_MainPass.las36669EDDigital DataDF5/27/202212727 12199 Electronic Data Set, Filename: SP03-NE2_RBT_28MAR22_RepeatPass.las36669EDDigital DataDF5/27/202212532 22084 Electronic Data Set, Filename: SP03-NE2L2 Survey Data.las36669EDDigital DataDF5/27/202212560 22084 Electronic Data Set, Filename: SP03-NE2L2_Drilling_Mechanics_Depth_12560ft_22084ftMD.las36669EDDigital DataDF5/27/202244654 44664 Electronic Data Set, Filename: SP03-NE2L2_Drilling_Mechanics_Time_LWD001.las36669EDDigital DataDF5/27/202212560 22084 Electronic Data Set, Filename: SP03-NE2L2_Scope_Services_RM_12560ft_22084ftMD.las36669EDDigital DataDF5/27/202212805 22084 Electronic Data Set, Filename: SP03-NE2 L2 _Final.las36669EDDigital DataDF5/27/2022 Electronic File: Transmittal SP03-NE2 L2.xlsx36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2_MFC_28MAR22.pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2_RBT_28MAR22.pdf36669EDDigital DataFriday, December 16, 2022AOGCC Page 1 of 3Supplied byOpSP03-NE2 L2_Final.lasSP03-,NE2L2_Scope_Services_RM_12560ft_22084ftMD.las DATA SUBMITTAL COMPLIANCE REPORTAPI No.50-629-23639-61-00Well Name/No.NIKAITCHUQ SP03-NE2L2Completion Status1-OILCompletion Date5/4/2022Permit to Drill2220150OperatorEni US Operating Co. Inc.MD22084TVD4041Current Status1-OIL12/16/2022UICNoWell Cores/Samples Information:ReceivedStart Stop CommentsTotalBoxesSample SetNumberNameIntervalDF5/27/2022 Electronic File: SP03-NE2L2_Drilling_Mechanics_Depth_Log_12560ft_22084ft.PDF36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2L2_Drilling_Mechanics_Time_Log_LWD001.PDF36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2L2_Scope_Services_RM_2MD_12560ft_22084ft.Pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2L2_Scope_Services_RM_2TVD_12560ft_22084ft.Pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2L2_Scope_Services_RM_5MD_12560ft_22084ft.Pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2L2_Scope_Services_RM_5TVD_12560ft_22084ft.Pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2L2_Scope_Service_RM_DLIS.dlis36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2 L2_DEL_2MD_Final.pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2 L2_FEL_2MD_ Final.pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2 L2_GRL_2MD_Final.pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2 L2_DEL_5MD_Final.pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2 L2_FEL_5MD_Final.pdf36669EDDigital DataDF5/27/2022 Electronic File: SP03-NE2 L2_GRL_5MD_Final.pdf36669EDDigital DataFriday, December 16, 2022AOGCC Page 2 of 3 DATA SUBMITTAL COMPLIANCE REPORTAPI No.50-629-23639-61-00Well Name/No.NIKAITCHUQ SP03-NE2L2Completion Status1-OILCompletion Date5/4/2022Permit to Drill2220150OperatorEni US Operating Co. Inc.MD22084TVD4041Current Status1-OIL12/16/2022UICNoINFORMATION RECEIVEDCompletion ReportProduction Test InformationGeologic Markers/TopsY Y / NAYComments:Compliance Reviewed By:Date:Mud Logs, Image Files, Digital DataComposite Logs, Image, Data Files Cuttings SamplesY / NAYY / NADirectional / Inclination DataMechanical Integrity Test InformationDaily Operations SummaryYY / NAYCore ChipsCore PhotographsLaboratory AnalysesY / NAY / NAY / NACOMPLIANCE HISTORYDate CommentsDescriptionCompletion Date:5/4/2022Release Date: 2/14/2022Friday, December 16, 2022AOGCC Page 3 of 3M. Guhl12/16/2022 1a. Well Status:Oil SPLUG Other Abandoned Suspended 1b. Well Class: 20AAC 25.105 20AAC 25.110 Development Exploratory GINJ WINJ WDSPL No. of Completions: ___________________ Service Stratigraphic Test 2. Operator Name:6. Date Comp., Susp., or 14. Permit to Drill Number / Sundry: Aband.: 3. Address:7. Date Spudded: 15. API Number: 4a. Location of Well (Governmental Section):8. Date TD Reached: 16. Well Name and Number: Surface: Top of Productive Interval:9. Ref Elevations: KB: 17. Field / Pool(s): GL: 13.1 BF: Total Depth:10. Plug Back Depth MD/TVD: 18. Property Designation: 4b. Location of Well (State Base Plane Coordinates, NAD 27):11. Total Depth MD/TVD: 19. DNR Approval Number: Surface: x- y- Zone- 4 TPI:x- y- Zone- 4 12. SSSV Depth MD/TVD:20. Thickness of Permafrost MD/TVD: Total Depth:x- y- Zone- 4 5. Directional or Inclination Survey: Yes (attached) No 13. Water Depth, if Offshore: 21. Re-drill/Lateral Top Window MD/TVD: Submit electronic information per 20 AAC 25.050 N/A (ft MSL) 22. Logs Obtained: 23. BOTTOM 20"X-65 160 13.375 L-80 2,487 9.625 L-80 4,096 5.5 L-80 4041' 5.5 L-80 4004' 24. Open to production or injection? Yes No 25. 26. Was hydraulic fracturing used during completion? Yes No DEPTH INTERVAL (MD) AMOUNT AND KIND OF MATERIAL USED 27. Date First Production:Method of Operation (Flowing, gas lift, etc.): Hours Tested: Production for Gas-MCF: Test Period Casing Press: Calculated Gas-MCF: Oil Gravity - API (corr): Press. 24-Hour Rate 2,916 12.25 1636.8 11 ppg CRETE :505 bbls 12.5 ppg DeepCRETE: 74 bbls Oil-Bbl: Per 20 AAC 25.283 (i)(2) attach electronic information 22084'4073 Sr Res EngSr Pet GeoSr Pet Eng 41 19 353512,962 684 12.5 ppg DeepCrete Lead: 243 bbls 26691 ESP SP03- NE2 L2 :12,584'-22,084' MD/4,078'-4,041' TVD (slotted Liner in open hole) 4/23/2022 342 Gas-Oil Ratio: 276244216 6/1/2022 12 hrs Flow Tubing 138 182 Oil-Bbl:Water-Bbl: Water-Bbl: PRODUCTION TEST 5/6/2022 Date of Test:Choke Size: 12,518' 178.89 160 CASING WT. PER FT.GRADE 15.5 40 36.868 37.04 N/AN/A 508889.4 502386.86 TOP SETTING DEPTH MD 37.04 suspension, or abandonment, whichever occurs first. Types of logs to be listed include, but are not limited to: mud log, spontaneous potential, gamma ray, caliper, resistivity, porosity, magnetic resonance, dipmeter, formation tester, temperature, cement evaluation, casing collar locator, jewelry, and perforation record. Acronyms may be used. Attach a separate page if necessary N/A 511723.3 6053667.9 4386 FSL 3965 FEL S07 T14N R09E UM 4/9/2022 CEMENTING RECORD 6064121.81 1864'/1766' SETTING DEPTH TVD 6070680.9 ADL 41749322,084'/4041' N/A 54.1 HOLE SIZE AMOUNT PULLED 12,584'/4078 3700 Centerpoint Drive, Ste. 500, Anchorage, AK 99503 5/4/2022 222-015 4486.0 FSL 1186.3 FEL S19 T14N R09E UM 390 FSL 144 FEL S35 T15N R08E UM Nikaitchuq/Schrader Bluff ADL 0391283, 0388571 , 0388581, 0388583, 4/1/2022 50-629-23639-61-00 SP03-NE2 L2 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION WELL COMPLETION OR RECOMPLETION REPORT AND LOG ENI US Operating Co. Inc. WAG Gas Driven 15.5 N/A BOTTOM TOP N/A N/A N/A 12679'8-3/4"22099'4086 11,658'4.5" SIZEIf Yes, list each interval open (MD/TVD of Top and Bottom; Perforation Size and Number; Date Perfd): DEPTH SET (MD) N/A PACKER SET (MD/TVD) ACID, FRACTURE, CEMENT SQUEEZE, ETC. CASING, LINER AND CEMENTING RECORD List all logs run and, pursuant to AS 31.05.030 and 20 AAC 25.071, submit all electronic data within 90 days of completion, GR/RES/DEN/NEU/CALIPER/CBL /Mud Logswill be uploaded on the SFTP site Slotted Liner in Open Hole8-3/4" TUBING RECORD Slotted Liner in Open Hole G s d 1 0 p dB P L s (att Form 10-407 Revised 3/2020 Submit within 30 days of Completion, Suspension, or Abandonment By Meredith Guhl at 10:57 am, Jun 09, 2022 G Completed 5/4/2022 MDG RBDMS 6/9/2022 SFD 8/12/2022BJM 12/14/22 DSR-6/10/22 Conventional Core(s): Yes No Sidewall Cores: 30. MD TVD Surface Surface 1864 1766 UG-2 Coal Bed Marker 4215' 2836 Lower Ugnu 8,878 3583 Top Schrader Bluff 10,739 3873 Top N sand 11,260 3954 Top of Productive Interval 12805 4096 22084 4041 31. List of Attachments:Daily operations Reports/ Schematic/Directional Survey 32. I hereby certify that the foregoing is true and correct to the best of my knowledge. Stefano Pierfelici Contact Name: Amjad Chaudhry Well Ops Project Manager Contact Email:amjad.chaudhry@eni.com Authorized Contact Phone:907-865-3379 6/4/2022 General: Item 1a: Item 1b: Item 4b: Item 9: Item 15: Item 19: Item 20: Item 22: Item 23: Item 24: Item 27: Item 28: Item 30: Item 31: The API number reported to AOGCC must be 14 digits (ex: 50-029-20123-00-00). Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water Injection, Gas Injection, Shut-in, or Other (explain). Provide a listing of intervals tested and the corresponding formation, and a brief summary in this box. Submit detailed test and analytical laboratory information required by 20 AAC 25.071. Pursuant to 20 AAC 25.070, attach to this form: well schematic diagram, summary of daily well operations, directional or inclination survey, and other tests as required including, but not limited to: core analysis, paleontological report, production or well test results. Report measured depth and true vertical thickness of permafrost. Provide MD and TVD for the top and base of permafrost in Box 29. Attached supplemental records should show the details of any multiple stage cementing and the location of the cementing tool. If this well is completed for separate production from more than one interval (multiple completion), so state in item 1, and in item 23 show the producing intervals for only the interval reported in item 26. (Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval). Provide a listing of intervals cored and the corresponding formations, and a brief description in this box. Pursuant to 20 AAC 25.071, submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results, including, but not limited to: porosity, permeability, fluid saturation, fluid composition, fluid fluorescence, vitrinite reflectance, geochemical, or paleontology. Report the Division of Oil & Gas / Division of Mining Land and Water: Plan of Operations (LO/Region YY-123), Land Use Permit (LAS 12345), and/or Easement (ADL 123456) number. INSTRUCTIONS Authorized Name: Authorized Title: Signature w/Date: The Kelly Bushing, Ground Level, and Base Flange elevations in feet above Mean Sea Level. Use same as reference for depth measurements given in other spaces on this form and in any attachments. FORMATION TESTS Review the reporting requirements of 20 AAC 25.071 and, pursuant to AS 31.05.030, submit all electronic data within 90 days of completion, suspension, or abandonment, whichever occurs first. Well Class - Service wells: Gas Injection, Water Injection, Water-Alternating-Gas Injection, Salt Water Disposal, Water Supply for Injection, Observation, or Other. Formation at total depth: OA OA Sand This form and the required attachments provide a complete and concise record for each well drilled in Alaska. Submit a well schematic diagram with each 10-407 well completion report and 10-404 well sundry report when the downhole well design is changed. All laboratory analytical reports regarding samples or tests from a well must be submitted to the AOGCC, no matter when the analyses are conducted. Information to be attached includes, but is not limited to: summary of daily operations, wellbore schematic, directional or inclination survey, core analysis, paleontological report, production or well test results, per 20 AAC 25.070. Multiple completion is defined as a well producing from more than one pool with production from each pool completely segregated. Each segregated pool is a completion. TPI (Top of Producing Interval). If Yes, list formations and intervals cored (MD/TVD, From/To), and summarize lithology and presence of oil, gas or water (submit separate pages with this form, if needed). Submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results per 20 AAC 25.071. Yes No Well tested? Yes No 28. CORE DATA If yes, list intervals and formations tested, briefly summarizing test results. Attach separate pages to this form, if needed, and submit detailed test information, including reports, per 20 AAC 25.071. NAME Permafrost - Top Permafrost - Base 29. GEOLOGIC MARKERS (List all formations and markers encountered): N Form 10-407 Revised 3/2020 Submit within 30 days of Completion, Suspension, or Abandonment Digitally signed by: Stefano Pierfelici DN: CN = Stefano Pierfelici C = AD Date: 2022.06.09 10:55:24 -08'00' Stefano Pierfelic i Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/10/2022 Report #: 1 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 69.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast PJSM - Continue spotting the rock washer and final spot of mud pump #3. Making-up interconnect between modules and set suitcases to WIF. Prep pits for brine and mud plant to build brine. Archer to perform derrick inspection. 24h Summary Complete suitcases and equipment removal off ice pad around to west side of island. Lay herculite and mat boards for SP03-NE2. Spot and shim sub and pit modules. Skid rig floor into drilling position. Lay herculite and mat boards for rock washer, cutting tank and spot #3 mud pump into position. Set suitcases to mud plant from valve house, make-up interconnects under rig floor and sub/pit module, electrical and steam. Berm around rig. Spotted mud shack. Vault rep tested pack-off and seals on SP03-NE2 (all good). SIMOPS: Expro spotted and rig-up test equipment on west side. Operation at 07.00 Making up rig interconnects. Lithology Shows Mud Weight (lb/gal) Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 MOB A 2 P PJSM – Continue moving suitcase, tools and equipment around to west side. Inspect moving system and tires, lay down herculite for SP03-NE2 and start laying rig mat boards. 06:00 10:30 4.50 10.50 MOB A 2 P PJSM - Continue to lay mat boards and building mat bridge to SP03-NE2. 10:30 17:00 6.50 17.00 MOB A 2 P PJSM – Move sub module, spot and shim on SP03-NE2. Lower stumpers on back beam. Move pit module against sub module and shim in place. 17:00 18:00 1.00 18.00 MOB B 2 P PJSM - Perform check-list and skid rig floor into drilling position. 18:00 00:00 6.00 24.00 MOB A 2 P PJSM – Lay out herculite and rig mat boards for rock washer, cutting tank and #3 mud pump. Set suitcases to rig sub from valve house. Make-up interconnect under rig floor. Berm around rig modules. Steam to pit module. Spotted mud shack. Plug in top drive cables. Note: Vault rep tested pack-off to 2000 psi. and tubing hanger seals and neck void to 5000 psi for 10 mins. each (good test). Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Cliff Owens Doyon Drilling HSE cowens@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/11/2022 Report #: 2 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 77.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Rig-up Halliburton and Welltec and perform gauge run on SP03- NE2, and second run with a tubing hole punch. Continue making suitcase and lines to WIF. Continue building 9.1 ppg 3% KCL/Nacl brine treated with biocide, transfer to rig and kill well. 24h Summary Continue spotting the rock washer and final spot of mud pump #3. Making-up interconnect between modules and set suitcases to WIF. Power VFD and function test top drive. Run high line power and switch at 09:30 hrs. Transfer 350 bbls. of 9.1 ppg brine to rig pits. Load Halliburton wire line components in BOP cellar area, and spot whale at beaver slide. Note: Notified AOGCC on upcoming BOP test. Matt Herrera replied to keep updated Operation at 07.00 Rigging up Halliburton lubricator and installing suite cases. Lithology Shows Mud Weight (lb/gal) 9.11 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 MOB A 2 P PJSM – Spot mud pump #3, cuttings tank and rock washer to pit module. Continue berming around rig components. Power up VFD house and test all function of top drive. Remove chains securing top drive to rails. Get steam to rig floor. Make-up choke manifold lines on roof of pit module. Hook-up mud and electrical lines from #3 pump. Hook-up lines in wheel of sub module. 06:00 09:00 3.00 9.00 MOB A 2 P PJSM - Continue make-up of choke manifold lines on roof of pit module. Hook-up mud and electrical lines from #3 pump unit. Hook-up high line power cable to rig. 09:00 12:00 3.00 12.00 MOB A 1 P PJSM – Complete mud pump #3 lines. Install suitcases to WIF and clean out snow of same. Check and install steps and landing on all egress from rig. Continue make-up of fluid and electrical lines at interconnects of modules. Spot Halliburton mud logger unit. Note: Rig on high line power @ 09:30 hrs. Note: Notified AOGCC on upcoming BOP test @ 11:39 hrs. Matt Herrera replied to keep updated. 12:00 18:00 6.00 18.00 MOB A 2 P PJSM – Clean out WIF side suitcases, make-up cement slurry and Eddie pump lines. Run and make-up accumulator hoses from unit to rig. Clean out cuttings tank. Hook-up scissor lift controls to pipe shed / install hand rails. Connect electrical for mud pump VFD/rig alarms. Run power line to rig shop. Completed make-up of high mud lines under rig floor. 18:00 00:00 6.00 24.00 MOB A 1 P PJSM – Install mat and rig-up beaver slide. Continue making-up cement slurry and Eddie pump lines in WIF suitcases, and install covers. Transfer fittings/Gai-Tronics from well bay #3 to #1. Rig took on 350 bbls. of 9.1 ppg 3% KCL/Nacl brine treated with biocide from mud plant. Take on diesel. Halliburton obtained a permit from production, PJSM - load wireline valve / BOPE / Pump in sub / wire line swab valve into rig BOP deck level. Load 3 section of lubricator on rig floor and lubricator on skate. Spot Halliburton whale at beaver slide. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Cliff Owens Doyon Drilling HSE cowens@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/12/2022 Report #: 3 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 76.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Decision made to pull of hole and check tool string and lubricator grease head. Continue E-line operation with Halliburton and Welltec perform gauge run on SP03- NE2 to tag depth, and second run with a tubing hole punch (on site). Continue installing suitcase and hoses from rock washer to WIF. Work on MP2 of equipment. 24h Summary Rig-up Halliburton E-line components and Welltec tractor assembly, function tested with E-line. Assembly lubricator/BOP on tree to rig floor. Halliburton crew timed output, put to rest. Continue installing suitcase and hoses from rock washer to WIF. Continue building 9.1 ppg 3% KCL/NaCl brine treated with biocide, transfer to rig. Halliburton crew from OPP arrived, change out wire valve on tree. Halliburton crew pick-up WellTec tractor with 3.80” gauge ring and short sample catcher, install lubricator, test to 2000 psi. Run in hole free to 1,880’ start to tractor to 3,000’ with high amps 3.36 and high line pull. Completed building 9.1 ppg brine volume. Note: Updated Matt Herrera with AOGCC for BOPE test. Operation at 07.00 Running in hole with 3.75" gauge on eline. Lithology Shows Mud Weight (lb/gal) 9.11 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 PREP R 1 P PJSM - Spot Halliburton Combo at beaver slide, thread E-line through grease head and re-assemble section after testing. Re-head E-line. Welltec tested tractor on E-line (witness by ENI rep). Continue installing suitcase and hoses for cement slurry and cuttings tank line from rock washer to WIF. Work on MP2 of equipment. 06:00 10:00 4.00 10.00 PREP R 1 P PJSM – Mobilized wire equipment to rig floor, rig-up Halliburton lubricator on SP03-NE2 tree. Rig-up sheave and hanger lubricator from blocks Pick-up e-line and weight bars in lubricator. 10:00 17:30 7.50 17.50 PREP R 1 P PJSM - Halliburton crew timed out and retired to camp for rest period. Found wireline valve would not closed all the way, remove BOP and valve from tree. Continue working on suitcase hoses to WIF from rock washer. Prep and position equipment for well kill. Transfer 350 bbls. to rig from mud plant. 17:30 18:30 1.00 18.50 PREP R 1 P PJSM – Halliburton crew from OPP arrived. Install another wireline valve on tree and re-installed Halliburton BOP and manifold valve on pump in sub. 18:30 20:30 2.00 20.50 PREP R 15 P PJSM - Pick-up Welltec 2.5” tractor with (two) 3.0” stand-off and Halliburton 3.80” gauge ring with short sample catcher. Make-up lubricator to BOP and test to 2000 psi. f/5 mins. with LVT. Good test. 20:30 00:00 3.50 24.00 PREP R 15 P PJSM - Run in hole with from surface to 1,880’ WLM free. WellTec deployed tractor. Continue to 3,000’ WLM. Welltec tractor was pulling high 3.36 Amp should have been around 2.5 Amps. Halliburton would get pick-up weight 2600 lbs. should about ½ that amount. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Cliff Owens Doyon Drilling HSE cowens@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/13/2022 Report #: 4 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 81.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Kill well, bull head tubing volume and A annulus volume as pre-procedure. Monitor well for 1 hour. Install BPV and nipple down tree and nipple up BOPE. Test to AOGCC – PTD. 24h Summary Decision made to pull of hole from 2,998’ and check tool string and lubricator grease head. WellTec inspected tractor and found no issue. Halliburton inspected and disassembled surface lubricator components and no issues. Reassemble lubricator and changed to 3.76” gauge ring and run in hole 3,185’, would not go further, tractor stalled out. Pull out of the hole, pick-up Welltec tubing punch and run in hole to 3,185’. Position tool to punch bottom hole @ 3,150’ with 1” intervals up to 3,145’ top shot, pressure up tbg up to 300 psi. Shoot pressure drop to 96 psi. with A annulus pressure increase to 120 psi. Pull out hole lay down WellTec tool string and rig down Halliburton E-line. Rig-up to bull head and kill well with 9.1 ppg 3% KCL/NaCl treated with biocide as pre-procedure. Rig-up lines to bull head down tbg. and A annulus. Pressure test lines to 3500 psi. Note: Updated Matt Herrera with AOGCC for BOPE test. Operation at 07.00 After pumping kill weight fluid motoring well. Lithology Shows Mud Weight (lb/gal) 9.11 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:30 1.50 1.50 PREP R 15 P PJSM – Welltec tractor was pulling high 3.36 Amp @ 2,998’ should have been around 2.5 Amps. Halliburton would get pick-up weight 2600 lbs. should about ½ that amount. Decision made to pull out of hole to surface to diagnose problems with lubricator grease head or WellTec tractor. 01:30 05:00 3.50 5.00 PREP R 5 P PJSM – Close wire line valve, bleed off and drain lubricator separate lubricator at floor level, inspected gauge ring and sample catcher no sand or debris. WellTec inspected and found no issues with tractor. Inspected control line working properly. Disassembly Halliburton grease head inspected sealing /rubbers element all in proper working order. Re-assembly grease head and installed a methanol injection line to lubricator top. 05:00 06:30 1.50 6.50 PREP R 5 P PJSM – Halliburton changed out gauge ring from 3.80” to 3.76” on Welltec 2.5” tractor with (two) 3.0” stand-off. Make-up lubricator fluid pack and test to 2000 psi. f/5 mins. with LVT. 06:30 12:00 5.50 12.00 PREP R 15 U PJSM – Halliburton run in hole free fall with 3.76” gauge ring from surface to 2,000’. Engaged WellTec tractor and continue into hole to 3,182’. Several attempt to go further without success, WellTec tractor stalled out and high 4.5 amps. Pull out of hole form 3,182’. 12:00 13:00 1.00 13.00 PREP R 5 U PJSM – Shut-in master wire line valve, bleed off and drain lubricator and separate lubricator at floor level, remove 3.76” gauge ring. Pick-up Welltec tubing punch on tractor with (two) 3.6” stand-off, perform function test (good test). Make-up lubricator. 13:00 16:30 3.50 16.50 PREP R 15 U PJSM – Fluid pack and test lubricator to 2000 psi. f/5 mins. with LVT (good test). Run in hole with from surface to 2,000’ WLM free. WellTec deployed tractor from 2,000’ to 3,209’ WLM. 16:30 17:30 1.00 17.50 PREP R 15 U PJSM -Per tubing punch pressure Tbg= 117 psi. / A annulus =118 psi B annulus 200 psi. pressure up on 4-1/2” tubing to 300 psi. Welltec punched 6 holes on foot intervals @ 3,150’, 3,149’, 3,148’, 3,147’, 3,146’, 3,145’ WLM. Final pressure tbg.= 96 psi. / A annulus 120 psi. / B annulus 200 psi. 17:30 19:00 1.50 19.00 PREP R 15 U PJSM - Pull out hole with WellTec tractor and tbg punch from 3,150’ to surface. 19:00 22:30 3.50 22.50 PREP R 5 U PJSM – Shut in master swab valve. Bleed off pressure and drain lubricator. Break lubricator and lay down WellTec tool string (all punch shot). Rig down Halliburton e-line lubricator, BOPE and wire line valve from tree. 22:30 00:00 1.50 24.00 PREP M 1 U Rig-up high pressure lines to tree to bull head and kill well. Pressure test line to 3500 psi. (good test). Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Cliff Owens Doyon Drilling HSE cowens@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/14/2022 Report #: 5 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 80.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Kill well – bull head 500 bbls. down A annulus. Monitor well until died. Install BPV and nipple down tree and nipple up BOPE. Test to AOGCC – PTD 24h Summary Bull head 65 bbls. down tubing, switch valves bull head 925 bbls. down A annulus. Shut-in monitor pressure, bleed as needed recording volumes to pressure. Bull head tubing with 48 bbls. and A annulus with 179 bbls., of 9.2 ppg. Monitor pressure, bleed pressure on 10 min. intervals and shut-in on 20 intervals, monitor volumes bled and pressure drop. Prep and start bull head down A annulus with 500 bbls. of 9.2 ppg 3% KCL/NaCl treated with biocide. Note: Updated Matt Herrera with AOGCC for BOPE test. Operation at 07.00 Bleeding off well. Lithology Shows Mud Weight (lb/gal) 9.21 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 04:00 4.00 4.00 PREP M 9 U PJSM – Bull head 65 bbls. down tubing ICP @ 2 bpm = 653 psi; FCP @ 5 bpm = 489 psi. Switch to A annulus bull head 925 bbls. ICP @ 6 bpm = 580 psi; FCP @ 6 bpm = 693 psi. Fluid 9.1 ppg 3% KCL/NaCl brine treated with biocide. 04:00 05:00 1.00 5.00 PREP M 1 U PJSM – Monitor tubing and A annulus pressure. tbg. = 636 psi. and A annulus = 596 psi. / 40 min., drop tbg. = 405 psi. and A annulus = 385 psi. Open A annulus to bled tank 20 min. tbg.= 312 psi. and A annulus = 292 psi. / bled back 6.3 bbls. 05:00 07:30 2.50 7.50 PREP M 1 U PJSM – Shut-in monitor pressure. Hook-up hose from A annulus to tiger tank. tbg.= 151 psi. and A annulus = 137 psi. 07:30 09:30 2.00 9.50 PREP M 1 U PJSM – Initial tbg.= 151 psi. and A annulus = 137 psi. Bleed/shut-in on 10 min. intervals, A annulus pressure to tiger tank through 2” line. Final tbg.= 75 psi. and A annulus = 37 psi. Bled back volume 53 bbls. Total from A annulus recover of 59 bbls. 09:30 10:30 1.00 10.50 PREP M 1 U PJSM – Change bleed back intervals to 20 min. bleed of A annulus and 10 min. shut-in. Repeat with Final tbg.= 71 psi. and A annulus = 32 psi. Bled back volume 22 bbls. Total from A annulus recover of 81 bbls. 10:30 14:00 3.50 14.00 PREP M 1 U PJSM – Change bleed back intervals to 10 min. bleed and 20 min. shut-in Repeat with Final tbg.= 60 psi. and A annulus = 25 psi. Bled back volume 9 bbls. Total from A annulus recover of 90 bbls. 14:00 15:00 1.00 15.00 PREP M 5 U PJSM – Line-up to bull head down tbg and annulus – test lines to 3500 psi. (good test). 15:00 16:00 1.00 16.00 PREP M 1 U PJSM – Bull head 48 bbls. 9.2 ppg 3% KCl/NaCl brine treated with biocide down tbg ICP = 5 bpm @ 586 psi FCP = 5 bpm @ 693 psi. Switch to A annulus bull head 179 bbls. ICP@ 6 bpm = 740 psi. / FCP @ 6 bpm = 997 psi. 16:00 22:00 6.00 22.00 PREP M 1 U PJSM – Line-up to bleed A annulus to tiger and tbg to bleed tank on schedule intervals to 10 min. bleed and 20 min. shut-in. Initial tbg.= 108 psi. and A annulus = 128 psi. Final tbg.= 2 psi. and A annulus = 21 psi. Bled back volume 55 bbls. Total from A annulus recover of 145 bbls. 22:00 23:00 1.00 23.00 PREP M 1 U PJSM – Mud plant weighted up 350 bbls. to 9.2 ppg 3% KCl/NaCl brine treated with biocide and shipped to rig pit. 23:00 00:00 1.00 24.00 PREP M 9 U PJSM - Bull head 291 bbls. of 500 bbls. of 9.2 ppg 3% KCl/NaCl brine treated with biocide down A annulus ICP @ 6 bpm =657 psi. / monitor tbg. ICP= 542 psi. B annulus 220 psi. Note: 24 Hr mud loss to hole (bull head)= 1430 bbls. Total loses to the hole= 1430 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Cliff Owens Doyon Drilling HSE cowens@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/15/2022 Report #: 6 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 83.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Complete BOP test and pull BPV. Rig-up GBR tongs and Centrilift equipment and pull 4-1/2” tbg. and ESP assembly to 3,150’, bottom tubing perforation. 24h Summary Completed bull head of 500 bbls. of 9.2 ppg 3% KCl/NaCl brine treated with biocide down A annulus. Monitor and bleed well until died. Install BPV and nipple down tree and nipple up BOPE. Performed two test sequence on 2-7/8” tubular and 2-7/8’’ TIW/dart floor valves. Test to AOGCC – PTD. Note: Guy Cook with AOGCC waived witness of BOPE test. Operation at 07.00 Testing BOPs. Lithology Shows Mud Weight (lb/gal) 9.21 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:00 1.00 1.00 PREP M 9 U PJSM – Bull head remaining 209 bbls. of a total of 500 bbls. ICP @ 6 bpm= 657 psi. / FCP @ 6 bpm= 729 psi. monitor tbg. IP= 542 psi / FP= 716 psi. B annulus 220 psi. 01:00 03:30 2.50 3.50 PREP M 1 U PJSM – Initial tbg.= 424 psi. and A annulus = 424 psi. Bleed/shut-in on 5/20 min. intervals, A annulus pressure to tiger tank through 2” line. Bled tbg. to bleed tank. Final tbg.= 64 psi. and A annulus = 66 psi. Bled back volume 95 bbls. Total recovered 95 bbls. 03:30 09:00 5.50 9.00 PREP M 1 U PJSM – Bleed 10 min. / increased to 20 min/20 min. shut-in intervals, A annulus bled pressure to tiger tank. Bled tbg. to bleed tank. Final tbg.= -2 psi. and A annulus = 0.5 psi. Bled back volume 35 bbls. Total recovered 130 bbls. Monitor for 1 hour final tbg.= -3.5 psi. and A annulus = -5 psi. 09:00 09:30 0.50 9.50 PREP C 5 U PJSM – Vault rep installed BPV in hanger. 09:30 11:00 1.50 11.00 PREP C 5 U PJSM –Nipple down tree and Vault rep terminated control line and installed testing dart. Set high pressure riser and make-up gray lock clamp. Note: Guy Cook with AOGCC waived witness of BOPE test. 11:00 18:00 7.00 18.00 PREP C 5 U PJSM – Nipple up BOP stack, install primary and secondary choke/kill manual /HCR valves and hose. Hook- up accumulator lines to BOP stack and installed riser/flow line- secure and center stack. Tested LEL, H2S gas alarms and PVT/flow line sensor. Good tests. 18:00 19:00 1.00 19.00 PREP C 5 U PJSM – Installed clam shell containment under rig floor, mouse hole, perform function test BOPE, and installed drain hoses. 19:00 22:00 3.00 22.00 PREP C 5 U PJSM – Make-up 5” 525 floor valves for testing. Install test plug in top drive, make-up 2-7/8” floor valves on test joint, make-up retrieval tool to test joint and make-up to test dart as per Vault rep. Perform shell test, good test. 22:00 00:00 2.00 24.00 PREP C 12 U PJSM – Test BOPE with 2-7/8” tubular 250 psi. low / 3500 psi. high, Two test sequences #1= 2-7/8” TIW valve 2-7/8”x 5” variable ram and primary/ secondary manual kill valves. #2= 2-7/8” dart valve, annular and manual kill valves. Note: 24 Hour loses to hole 9.2 ppg KCL/NaCL brine with biocide = 210 bbls. Total loses to hole 9.1 ppg & 9.2 ppg KCL/NaCL brine with biocide = 1640 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Cliff Owens Doyon Drilling HSE cowens@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/16/2022 Report #: 7 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 85.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Pull out of the hole with 4-1/2” tbg. (12.6#, L-80, Hyd 563) and ESP assemble from 12,186' to 9,407’ to 3,150’, bottom tubing perforation. Make-up tbg hanger and re-land in well head. Prep and pick-up 2-7/8” HT- PAC pipe for clean out of 4-1/2’ tbg. 24h Summary Complete BOP test with 5” tubular and choke manifold sequence 3-11, perform 250 psi. Low / 3500 psi. High, perform accumulator draw-down test. Change out primary kill HCR valve (failed test) on Bop stack. Rig-up GBR tongs and Centrilift equipment. PJSM - Vault pull BPV and Pull hanger free @ 160K, pull to rotary table. Disconnect ESP cable and capillary line from tbg hanger and lay down. Pull out of hole from 12,563’ to 12,186’ of 4-1/2” tbg. / ESP cable and assembly. Note: Guy Cook with AOGCC waived witness of BOPE test. Operation at 07.00 Prepping to pick up 2 7/8" HT-Pac. Lithology Shows Mud Weight (lb/gal) 9.21 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:30 1.50 1.50 PREP C 5 U PJSM – Install 5” test joint and fluid pack choke manifold and lines conduct shell test. 01:30 05:30 4.00 5.50 PREP C 12 U PJSM – Test BOPE with 5” tubular to 250 psi low / 3500 psi High, Test sequences #3 = Annular, choke valves and primary / secondary manual kill valves, lower top drive IBOP. #4 = (2-7/8”X 5”) variable upper ram, Choke valves, primary / secondary HCR kill valves (primary kill leaked isolated retest). #5 = Choke manifold valves, primary / secondary manual Kill valves and 5” TT525 FOSV. #6 = primary / secondary HCR choke valves, 5” 525 dart valve. #7 = primary / secondary manual choke valves. 05:30 06:30 1.00 6.50 PREP C 12 U PJSM – Attempted to perform #8 test sequence O-ring on test dart failed, pull test joint and replaced, re-install test dart and joint. 06:30 08:30 2.00 8.50 PREP C 12 U PJSM – Tested to 250 psi Low / 3500 psi High. Test #8 sequence (3-1/2” X 6”) variable lower ram and choke valves #2/#5. #9= Pull 5“ test joint test Blind ram and #3/#4 choke valves. #10= Test hydraulic remote control and manual B chokes operated @ 2500 psi. observe pressure bleed on both. Perform accumulator test, start 3000 psi. draw-down to 2125 psi. Recovered 200 psi. in 10 second and full recovery 55 seconds. 10 Nitrogen bottles average 3500 psi. 08:30 11:00 2.50 11.00 PREP C 5 TR05 PJSM – Change out primary kill HCR valve on Bop stack. 11:00 13:00 2.00 13.00 PREP C 12 U PJSM - #11 sequence, test primary HCR kill valve. good test. 13:00 14:00 1.00 14.00 PREP C 5 U PJSM – Blow down and rig down test equipment, pull test dart as per Vault rep. 14:00 20:00 6.00 20.00 PREP L 5 U PJSM – Mobilized Centrilift ESP and capillary sheaves /rope/ elephant truck to rig floor. Attached elephant truck to sheave and hang in derrick at board level and run truck over wind walls to ground level. Thread rope through sheaves from rig floor to spooling unit. Mobilized Centrilift job box and rig-up GBR tongs, pick-up 4- 1/2” handling equipment. 20:00 21:00 1.00 21.00 PREP C 5 U PJSM – Pulling ESP assembly with all involved. Check for pressure on well (Zero), Vault pull BPV and made- up landing joint. Vault back out hanger lock down pins. 21:00 21:30 0.50 21.50 PREP L 5 U PJSM – Pull on hanger stage-up 100K, 120K, 140K, 160K came free Up wt.= 150K, hanger out of well head add 6 bbls., of 9.2 ppg 3% KCL/NaCl brine treated with biocide, observed fluid dropping. Pull tubing hanger to rig floor from 12,606’ to 12,563’. 21:30 22:30 1.00 22.50 PREP L 5 U PJSM - Disconnect ESP cable and capillary line from tbg hanger as per Centrilift and Vault rep. and lay down tubing hanger and landing joint. Centrilift crimped on ESP to swivel. 22:30 00:00 1.50 24.00 PREP L 4 P Pull out hole from 12,563’ to 12,186’ with 4-1/2” tbg. (12.6#, L-80, Hyd 563) and ESP cable to pull ESP cable and capillary lines to spooling unit and secure on reels. Note: 24 Hour mud loss to hole 9.2 ppg KCL/NaCL brine with biocide = 35 bbls. Total loses to the hole 9.2 ppg KCL/NaCL Brine with biocide= 1675 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/17/2022 Report #: 8 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 100.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Pick-up single 2-7/8” HTPAC pipe run in hole from 2,700’ to 9,355’ cleaning out of 4-1/2” tbg. Circulate bottom-up and pump 5 bbls. Sweep as hole condition dictate. 24h Summary Pull out of the hole with 4-1/2” tbg. (12.6#, L-80, Hyd 563) and ESP assemble from 12,186’ to 9,415’. Pick-up tbg hanger and secure ESP cable and land @ 9,488’. Wash 3 down joints of 2-7/8” HTPAC to 102’ circulate, pull out and lay down. Pull tbg hanger and lay down perforated joint to 9,407’ make-up tbg. hanger, secure ESP cable and land. Clear and clean rig floor. Pick-up single 2-7/8” HTPAC pipe with mule shoe clean out of 4-1/2” tbg from surface to 2,770’ as hole condition dictated circulate down and sweep as needed. Operation at 07.00 Singling in the hole with 2 7/8" HT-Pac at 4268' MD. Lithology Shows Mud Weight (lb/gal) 9.21 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 04:30 4.50 4.50 PREP L 4 U PJSM – Pull out hole from 12,186’ to 9,415’ with 4-1/2” tbg. (12.6#, L-80, Hyd 563) and ESP cable and capillary line. GBR tongs break connection and Centrilift removed collar clamps. 04:30 06:30 2.00 6.50 PREP C 5 U PJSM – Install tubing hanger and landing joint, secure ESP cable and capillary line with collar clamp, land in well head and screw-in lock down pins as per Vault rep. Up wt.=135K / Dn wt.= 85K. 06:30 11:00 4.50 11.00 PREP M 4 U PJSM – Pick-up single 2-7/8” HT PAC pipe with 8’ mule shoe, run in hole three joints 102’ to clean out sand in perforated joint, 126 gpm @ 110 psi. Pull out of hole lay down singles. 11:00 13:00 2.00 13.00 PREP C 5 U PJSM - Pick-up landing joint make-up to tubing hanger back-out lock down pins as per Vault, pull tubing hanger to rotary table and remove. Pull and lay down perforated joint of 4-1/2” tbg. (12.6#, L-80, Hyd 563) to 9,407’. Install tubing hanger and landing joint, secure ESP cable and capillary line with collar clamp, land hanger in well head and screw-in lock down pins per Vault. 13:00 14:00 1.00 14.00 PREP L 1 U PJSM – Clear and clean rig floor, from pulling 4-1/2” tubing and ESP cable components. 14:00 18:00 4.00 18.00 PREP M 4 U PJSM – Picking-up 2-7/8” HT PAC, change out handling equipment. Single in hole with mule shoe and 2-7/8” joints, GBR made-up connection and torque with power tongs, from surface to 850’ break circulation and wash down as needed when taking weight and hole condition dictated. 18:00 00:00 6.00 24.00 PREP L 4 U PJSM – Continue run in hole with elevators picking-up 2-7/8” HT PAC singles from 850’ to 2,100’ washing down every 10 joints or as hole condition dictated. Up wt.= 84K / Dn wt.= 78K. Tag with 4K @ 2,100’ wash down with 168 gpm @ 180 psi. 1-3K weight to 2,150’. Pump 5 bbls. Hi-vis sweep around to clear well bore and able to run into 2,770’ on elevators. Up wt.= 82K / Dn wt.= 78K. Pumped 5 bbls. sweeps @ 1,500’ and @ 2,200’. Note: 24 Hour mud loss to hole of 9.2 ppg 3% KCL/NaCL brine with biocide = 158 bbls. Total loses to the hole 9.2 ppg 3% KCL/NaCL brine with biocide = 1833 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/18/2022 Report #: 9 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 85.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Pick-up single 2-7/8” HT PAC pipe run in hole from 7,100’ to 9,335’ cleaning out of 4-1/2” tbg. Sweep hole with 5 bbls Hi-vis pill, every 5 joints pick-up. 24h Summary Pick-up single 2-7/8” HT PAC pipe run in hole from 2,770’ to 7,100’ cleaning out of 4-1/2” tbg. circulated as need. When condition allowed run 8-10 joints on elevators from 2,770’ to 3,880’. Circulate each joint down from 3,880’ to 7,100’ bbls. Pumping 5 bbls. Hi-vis sweep every 5 joints. Pumping 5 bbls./hr. into A annulus. Circulate clean brine back to the rig pits. Operation at 07.00 Singling in the hole with 2 7/8" HT-Pac at 8821' MD. Lithology Shows Mud Weight (lb/gal) 9.25 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 04:30 4.50 4.50 PREP L 4 U PJSM – Picking-up 2-7/8” HT PAC singles run in cleaning out 4-1/2” tubing from 2,770’ to 3,880’, when possible run on elevators and washing down every 8-10 joints or as hole conditions dictated and pump 5 bbls. sweep as needed. 84 gpm @ 330-410 psi. Up wt.= 90K / Dn wt.= 75K. GBR making-up connection and torque with power tongs. Pumping 5 bbls./hr. into A annulus. 04:30 11:00 6.50 11.00 PREP L 4 U PJSM – Continue picking-up 2-7/8” HT PAC singles in cleaning out 4-1/2” tubing from 3,880’ to 5,030’, pump pressure increasing and tag with 1-2K washing down each joint with 90 gpm @ 390 -450 psi. pump 5 bbls. sweep as needed. Brine cleaned-up and started to circulate system @ 0600 hrs. with clean 9.2 ppg 3% KCL/NaCl brine treated with biocide back to rig pits. Pumping 5 bbls./hr. into A annulus. 11:00 13:00 2.00 13.00 PREP L 9 U PJSM – After connection @ 5,030’ pump pressure increased from 400 to 600 psi at 90 gpm, and decrease in weight up wt.= 83K to 78K. Reciprocate string from 5,000’ to 5,030’ and circulated and sweep two bottoms-up. From 5,030' to 5,090' slight deceasing of pump pressure to 560 psi. and increased string weight Up wt.= 93K / Dn wt.= 78K. Stage pump rate up to 210 gpm @ 2320 psi. GBR making-up connection and torque with power tongs. Pumping 5 bbls./hr. into A annulus. 13:00 18:00 5.00 18.00 PREP L 4 U PJSM - Picking-up 2-7/8” HT PAC singles cleaning out 4-1/2” tubing from 5.090’ to 5,940’, with GBR made-up connection and torque with power tongs. Washing down every joint due to hole condition pumping 168 gpm @ 1930 psi. Up wt.= 90K / Dn wt.= 72K. Pump 5 bbls. hi- vis sweep every 5 joints. Pump pressure following K&M modeling. Pumping 5 bbls./hr. into A annulus. 18:00 00:00 6.00 24.00 PREP L 9 U PJSM - Picking-up 2-7/8” HT PAC singles cleaning out 4-1/2” tubing from 5,940’ to 7,100’, with GBR made-up connection and torque with power tongs. Washing down every joint due to hole condition pumping 168 gpm @ 2350 psi. taking 1-3K down weight to wash joints. Up wt.= 95K / Dn wt.= 77K. Attempted to slack off without circulating with no success. Pump 5 bbls. hi- vis sweep every 5 joints. Pump pressure following K&M modeling. Added 1% lube to rig pits. Pumping 5 bbls./hr. into A annulus. Note: 24 Hour mud loss to hole 9.2 ppg KCL/NaCL brine with biocide = 128 bbls. Total loses to the hole 9.2 ppg KCL/NaCL brine with biocide = 1961 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/19/2022 Report #: 10 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 85.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue pull of hole lay down 2-7/8” HT PAC pipe from 4,800’ to surface. Clean out BOP stack. Bull head 712 bbls. of 9.3 ppg 3% KCL/NaCl brine treated with biocide and soap. Pick-up landing joint, make-up to tubing hanger, pull to rig floor, lay down same. Continue pulling and lay down 4-1/2” (12.6#, L-80, Hyd 563) tubing and ESP assembly from 9,407’ to surface. 24h Summary Pick-up single 2-7/8” HT PAC pipe run in hole from 7,100’ to 9,381’ cleaning out of 4-1/2” tbg. Circulated down each joint down from 7,100’ to tag at 9,381’. Pumping 5 bbls. Hi-vis sweep every 5 joints. Circulate 4X bottom-up at 5 BPM and reciprocate from 9,381’ to 9,360’. Mix and pump 9.3 ppg 100 bbls. sweep with a of rate 5.5 bpm @ 4430 psi. and observed loses to formation of 120 BPH. Shut down monitor well, pump 10 bbls. dry job. Pull out of hole lay down 2-7/8” singles from 9,375’ to 4,800’, monitor pipe displacement. Operation at 07.00 Prepping to clean stack. Lithology Shows Mud Weight (lb/gal) 9.26 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 PREP L 4 U PJSM - Picking-up 2-7/8” HT PAC singles cleaning out 4-1/2” tubing from 7,100’ to 8,500’, with GBR made-up connection and torque with power tongs. Washing down every joint due to hole condition pumping 168 gpm @ 2700 psi. taking 1-2K down weight to wash down joints. Up wt.= 92K / Dn wt.= 72K. Pump 5 bbls. Hi- vis sweep every 5 joints. Pumping 5 bbls./hr. into A annulus. 06:00 09:00 3.00 9.00 PREP L 4 U PJSM – Continue picking-up 2-7/8” HT PAC singles cleaning out 4-1/2” tubing from 8,500’ to 9.381’ tag, with GBR made-up connection and torque with power tongs. Washing down every joint due to hole condition pumping 168 gpm @ 2700 psi. taking 1-2K down weight to wash down joints. Up wt.= 92K / Dn wt.= 72K. Pump 5 bbls. Hi-vis sweep every 5 joints. Pumping 5 bbls./hr. into A annulus. 09:00 15:00 6.00 15.00 PREP L 9 U PJSM – Circulate 4X bottom-up at 5 BPM and reciprocate from 9,381 to 9,360’. Mix and pump 9.3 ppg 100 bbls. sweep rate 5.5 bpm @ 4430 psi. and observed loses to formation of 120 BPH. Shut down monitor well, breathing back and slow down and stop, pump 10 bbls. dry job. 15:00 18:00 3.00 18.00 PREP L 4 U PJSM – Pull out of hole lay down 2-7/8” HT PAC singles from 9,375’ to 8,335’, with GBR breaking-out connection with power tongs. Adjust pulling speed for swabbing. Up wt.= 105K / Dn wt.= 73K. Monitor pipe displacement. 18:00 00:00 6.00 24.00 PREP L 4 U PJSM – Pull out of hole lay down 2-7/8” HT PAC singles from 8,335’ to 4,800’, with GBR breaking out connection with power tongs. Up wt.= 90K / Dn wt.= 80K. Monitor pipe displacement. Note: 24 Hour mud loss to hole 9.2 ppg KCL/NaCL Brine with biocide = 266 bbls. Note: Total loses to the hole 9.2 ppg KCL/NaCL brine with biocide= 2227 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/20/2022 Report #: 11 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 85.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue monitor and bleeding pressure on A annulus and tubing to zero. Monitor for 1 hour. Pick-up landing joint, make-up to tubing hanger, pull to rig floor, lay down same. Continue pulling and lay down 4- 1/2” (12.6#, L-80, Hyd 563) tubing and ESP assembly from 9,407’ to surface. Install wear bushing per Vault. Prep to run scraper with full drift mill. 24h Summary Pull out of hole lay down 2-7/8” singles from 4,800’ to surface. Clear floor of 2-7/8” handling equipment and mobilized and pick-up stack jetting tool on drill pipe and 2” vac hose from Kusko. Flush stack @ 12.5 bpm from tbg hanger to annular and remove residual sand from top of hanger with Kusko. Slip and cut drilling line. Bull head 783 bbls. of 9.3 ppg 3% KCL/NaCl brine inhibited with biocide and soap. Monitor tubing and A annulus pressure bleed as required to static. Operation at 07.00 Pulling out of hole with 4 1/2" ESP completion string at 8,353' MD. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 07:30 7.50 7.50 PREP L 4 U PJSM - Pull out of hole lay down 2-7/8” singles from 4,800’ to surface with GBR breaking out connection with power tongs. Monitor pipe displacement. 07:30 08:30 1.00 8.50 PREP L 1 U PJSM - Clear floor of 2-7/8” handling equipment and mobilized and pick-up stack jetting tool on 5” drill pipe and 2” vac hose from Kusko super sucker to rig floor. 08:30 10:00 1.50 10.00 PREP L 1 U PJSM – Position jetting tool 1’ above tubing hanger and flush @ 12.5 BPM to annular 4 times and Kusko removed fluid and residual sand from top of tubing hanger. Function BOP equipment. 10:00 13:30 3.50 13.50 PREP L 25 U PJSM –Slip and cut (140’) drilling line. Service top drive and blocks. Inspect and adjust draw-works brakes. Rig-up secondary kill to bull head. 13:30 16:30 3.00 16.50 PREP L 9 U PJSM – Pressure test lines to 3500 psi. good test. Bull head 783 bbls. of 9.3 ppg 3% KCL/NaCl brine inhibited with biocide and soap down annulus stage rate-up ICP 5 bpm @ 330 psi. FCP 8 BPM 1170 psi. Monitor B annulus = 290 psi. 16:30 18:00 1.50 18.00 PREP L 1 U PJSM – Shut in well monitor pressure initial pressure 560 psi. /15 mins. @ 466 psi. / 30 min. @ 400 psi. Line- up bleed off tubing and A annulus to 126 psi, with 40 bbls. 18:00 00:00 6.00 24.00 PREP L 1 U PJSM – Bleed 10 min. / increased to 20 min/20 min. shut-in intervals, A annulus bled pressure, switch to 2” line to bleed tank. Bled tbg. to rig through choke. Final tbg.= -0 psi. and A annulus = 15 psi. Bled back volume 27 bbls. Total recovered 107 bbls. Note: 24 Hour mud loss to hole 9.3 ppg KCL/Nacl Brine with biocide = 736 bbls. Note: Total loses to the hole (9.1 ppg & 9.2 ppg & 9.3 ppg) KCL/Nacl brine with biocide = 2963 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/21/2022 Report #: 12 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 86.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue rig down of Baker Centrilift and GBR equipment from rig floor, sheaves from derrick and spooling unit. Install wear bushing per Vault rep. Pick-up to run scraper with full drift mill as per program and Baker rep. Run in hole picking-up singles of 5” TT525 drill pipe to +/- 12,679’. Perform pumping and rotation as per program of liner top. Pull out of the hole standing back drill pipe in derrick. 24h Summary Continue monitor and bleeding pressure on A annulus and tubing, to zero. Monitor for 1 hour. Pick-up landing joint, make-up to tubing hanger, pull to rig floor, lay down same. Continue pulling and lay down 4- 1/2” (12.6#, L-80, Hyd 563) tubing and ESP assembly from 9,407’ to 78’ and lay down pump and motor shroud assembly per Centrilift rep. Rig down Centrilift ESP equipment and prep ESP cable sheaves from derrick. Operation at 07.00 Picking up cleanout BHA #1. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:30 3.50 3.50 PREP L 1 U PJSM – Continue monitor/bleed 20 min/20 min. shut-in intervals, tubing and A annulus until died. Monitor for 1 hour with A annulus -3.2 psi and tubing 0 psi. Blow down and rig down lines. Prep to pull 4-1/2” tubing and ESP assembly, pick-up landing joint. 03:30 04:30 1.00 4.50 PREP L 5 P PJSM – Vault made-up to tubing hanger and back out lock down pins pull hanger to rig floor. Up wt.= 125K. and lay down hanger and landing joint. Prep and crimp ESP cable together. 04:30 09:30 5.00 9.50 PREP L 4 P PJSM – Pull out of hole with 4-1/2” tubing and ESP assembly form 9,407’ to 6,400’. Up wt.= 115K / Dn wt.= 105K. Add 5 bbls/hour to well bore and pipe displacement. 09:30 11:30 2.00 11.50 PREP L 5 P PJSM – Change out full ESP cable spools in unit. Add 5 bbls/hour to well bore. 11:30 20:30 9.00 20.50 PREP L 4 P PJSM – Pull out of hole with 4-1/2” tubing and ESP assembly form 6,400’ to ESP motor/ pump @ 78’. Add 5 bbls/hour to well bore and pipe displacement. 20:30 23:00 2.50 23.00 PREP L 5 P PJSM – Lay down pump and motor shroud assembly per Centrilift rep. Pumps no rotation, oil good in upper and lower tandem seals motor tested good and free rotation. Add 5 bbls/hour to well bore. 23:00 00:00 1.00 24.00 PREP L 5 P PJSM – Rig down Baker Centrilift and GBR equipment from Lay down completion. Install crimp on ESP cable and prep capillary line to remove from derrick sheaves to spool unit. Add 5 bbls per hour to well bore. Note: 24 Hour mud loss to hole 9.3 ppg 3% KCL/NaCL Brine with biocide = 108 bbls. Note: Total loses to the hole (9.1 ppg & 9.2 ppg 9.3 ppg) of 3% KCL/NaCL brine with biocide = 3071 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/22/2022 Report #: 13 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 77.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Finish performing pumping and rotation as per program of liner top. Pull out of the hole stands. Prepare and test BOPE. 24h Summary Rig down Centrilift ESP equipment and prep ESP cable sheaves from derrick. Install wear ring. Pick-up to run scraper with full drift mill as per program and Baker rep. Make up BHA run in hole picking-up singles of 5” TT525 drill pipe to 12,679’. Start performing pumping and stroking above liner top. Operation at 07.00 Pulling out of hole with polish mill / scraper BHA at 2,748' MD Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 04:00 4.00 4.00 PREP L 20 P Run ESP cable and Cap line over sheaves in derrick and back to spooling unit. Remove elephant trunk from sheave and place in storage box. Remove sheaves from derrick. Clean and clear floor. 04:00 06:30 2.50 6.50 PREP M 5 P Mobilize wear ring and running tool to rig floor. Install wear ring. Mobilize BHA to rig floor and pipe shed. 06:30 08:30 2.00 8.50 PREP M 5 P Make up Clean out BHA, polish mill and scraper. 08:30 23:30 15.00 23.50 PREP M 4 P Run in hole with cleanout BHA picking up TT525 drill pipe from pipe shed from 144’ to ’12611’. SO174 k, SO=110 k. Pull out of hole and rack back 1 stand. Pick up joint # 403 and 404. Make up top drive to stand from derrick 23:30 00:00 0.50 24.00 PREP M 4 P Run in hole from 12611’ to 12679’ and observe polish mill enter liner top, no-go land out and with 10 k at 12688’. Mark pipe at 1’ up from land out and stroke from 1’ to 50’ up above liner top with 3 BPM at 250 psi. Note: 24 Hour mud loss to hole (9.3 ppg) = 183 bbls. Max gas= 0 units Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/23/2022 Report #: 14 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 76.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Troubleshoot and repair Annular. Finish testing BOPE. Rig up Halliburton combo unit. Make up logging BHA. Perform Wireline run with CCL/GR, Tractor, CBL, multi finger imaging tool and GyroData MicroDLS. Rig up to run 2 7/8” clean out run. 24h Summary Finish performing pumping and rotation as per program of liner top. Pull out of the hole with TT525 drill pipe stands and stand back in derrick from 12,688’to 144’. Lay down polish mill and scraper BHA from 144’ to surface. Pull wear ring and install test plug. Prepare and testing BOPE 250/3500 psi, Test witness waived by AOGCC rep Guy Cook. Trouble shooting Annular on BOP stack. Operation at 07.00 Phase III Conditions, all life critical operations are suspended. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:00 1.00 1.00 PREP M 4 P Pump at 3 BPM at 250 psi while stroking pipe from 1’ to 50’ above liner top with no-go, 12688’ to 12627’ work 4 more times for a total of 5 times at 30 ft/min. At 5’ above liner top with no-go increase pump rate to 5 BPM at 650 psi with 20 rpm at 11k TQ. While rotating slack off and lower into liner top to 10 k weight on liner top with no-go for 1 minute at 12,688’. Pull out of liner top to 12 675’and stop rotation and turn off pump. Monitor well. Returns while pumping. 01:00 08:30 7.50 8.50 PREP M 4 P Pull out of hole racking back TT525 stands in derrick from 12,675’ to 144’ at 60-90 ft/min. 08:30 11:30 3.00 11.50 PREP M 5 P Lay down BHA. Empty Vacs tool and clean magnets. Recover .5 BBL of sandy crude mix from Vacs tool. Recovered 49.5 pounds of metal fines from the magnet. Clean and clear floor. 11:30 12:00 0.50 12.00 PREP C 5 P Pull wear ring. Install test plug. 12:00 14:30 2.50 14.50 PREP C 12 P PJSM, rig up for testing BOPE. Make up floor valve and dart valve and make up to stump. Fluid pack stack, choke manifold, choke and kill lines. Perform shell test, good. 14:30 22:00 7.50 22.00 PREP C 12 P Test BOPE 250/3500 psi with 2 7/8” and 5” test joints. Test PVT and flow alarms. Test gas alarms. Testing 75% completed. Fail/Pass on secondary kill HCR. Test witness waived by AOGCC rep Guy Cook. 22:00 00:00 2.00 24.00 PREP C 12 TR05 Diagnose Annular. Note: 24 Hour mud loss to hole (9.3 ppg) = 63 bbls. Max gas= 59 units Back ground gas = 2 units 24 HRS metal Recovery= 49.5 lbs. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/24/2022 Report #: 15 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 82.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Pick up and run in hole with 2 7/8” with vacs tool clean out assembly BHA on TT525 drill pipe. Sting into top of liner to clean out lower lateral. 24h Summary Trouble shooting Annular on BOP stack, Thaw annular hydraulic lines and clear. Remove flow line and riser. Remove top of annular preventer. Phase 3 conditions, suspend all life critical work. Phase weather cleared Resume work on annular preventer, remove element and change out piston O-ring seals and install piston. Install new element and Install cap. Nipple up flow line, riser and reconnect hoses. Function test annular. Rig up and finish testing BOPE 250/3500 psi with 2 7/8” and 5” test joints, witness waived by AOGCC rep Guy Cook. Pull test plug and install wear ring. Operation at 07.00 Run in hole with Baker Vacs tool at 1,695' MD Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:30 3.50 3.50 PREP M 4 TR05 Trouble shoot Annular, not release test joint. Thaw hydraulic lines and drain and bleed pressure and open annular preventer, remove flow line and riser. 03:30 05:30 2.00 5.50 PREP C 25 TR05 Pull test joint and close blind rams. Install annular removal plate and pup joint. Remove cap from annular and prepare to remove element. 05:30 10:00 4.50 10.00 PREP M 22 TW01 Phase 3 weather conditions, suspend all life critical work. Continue to thaw annular hoses. 10:00 18:30 8.50 18.50 PREP C 25 TR05 Phase 2 weather conditions, may return to life critical work. Continue to thaw annular hoses. Remove annular element, no damage. Change out annular piston O-ring seals and install piston. Install new annular element. Pick up and change out annular cap seals and install cap. Disconnect annular plate removal tool and pup joint. Finish clearing annular hydraulic hoses. Reconnect hoses, nipple up riser and flow line 18:30 19:30 1.00 19.50 PREP C 25 TR05 Install 5” test joint, function test annular. Stage up pressure after several functions up to 1200 psi, good. Fluid pack stack, choke and kill manifold. Rig up and perform shell test. 19:30 23:30 4.00 23.50 PREP C 12 P Finish performing BOPE testing at 250/3500 psi. Waived witness by AOGCC rep Guy Cook. Finish testing with 2 7/8” and 5” test joint. Perform accumulator draw down test. Test gas alarms. 23:30 00:00 0.50 24.00 PREP C 5 P Pull test plug and install wear ring. Note: Max gas= 0 units Back ground gas = 0 units 24 Hour mud loss to hole 120 bbls. Total losses to the hole= 3146 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/25/2022 Report #: 16 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 82.0 MD @ Report Time (f… TVD @ Report Time (f… Daily Summary Operations 24h Forecast Continue to pull out of hole and empty vacs tool and clean magnets. Make up new BHA with bent joint and vacs tool with 4 joints of 2 7/8” PH6 pipe to ensure we can enter upper lateral to clean out. Pull out of hole and prep for next step. 24h Summary Blow down surface equipment and rig down BOP test equipment. Pick up and run in hole with 2 7/8” with vacs tool clean out assembly BHA on TT525 drill pipe to 12,569 MD. Break circulation at 5 BPM. Wash down to 12789’ set down 7k several times. Pull out of hole racking back TT525 drill pipe into derrick from 12,789’ to 1839’. Laying down BHA from 1839’ to 1789’. Clean magnet and recover 20 LBS of metal fines. Clean boot baskets and only slight amount of sludge in boot baskets. Operation at 07.00 Picking up BHA #3 VACS clean out assembly. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time Plan Oper. Descr. End Depth (ftKB) 00:00 01:00 1.00 1.00 PREP C 5 P Blow down kill and choke lines. Rig down BOPE test equipment. 01:00 03:00 2.00 3.00 PREP M 5 P PJSM, mobilize Vacs run BHA to rig floor. 03:00 08:30 5.50 8.50 PREP M 4 P Make up vacs run BHA as per Baker hand. GBR to make up BHA and PH6 pipe from surface to 1839’. 08:30 09:30 1.00 9.50 PREP M 5 P Prepare rig floor and change out handling equipment from 2 7/8” to 5”. 09:30 16:00 6.50 16.00 PREP M 4 P Run in hole with 5” TT525 drill pipe from 1839’ to 12,659’. PU=170 k, SO=105 k. 16:00 17:30 1.50 17.50 PREP M 4 P Break circulation at 5 BPM, 830 psi. Slow pump rate to 3 BPM, 380 psi. Wash down to 12789’ and set 5-7 k down. Work string with 10 k torque, with string moving. RTW=130 k. set down several times at 12,769’. Increased flow to 5 BPM, 890 psi 17:30 23:00 5.50 23.00 PREP M 1 P PJSM, pull out of hole racking back TT525 drill pipe to derrick from12,769’ MD to 1839’ MD. 23:00 00:00 1.00 24.00 PREP M 4 P Lay down BHA from 1839’ to 1789’. Clean magnet and recover 20 LBS of metal fines. Clean boot baskets and only slight amount of sludge in boot baskets. Note: 24 Hour mud loss to hole (9.3 ppg) = 170 bbls. Max gas= 491 units 24 HRS metal Recovery= 20 lbs. 24 Hour mud loss to hole 170 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/26/2022 Report #: 17 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 82.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Clean lower magnet and vacs tool. Run vacs tool back in hole picking up 54 joints of 2 7/8” PH6 and run in upper lateral on TT525 drill pipe, clean out upper lateral with vacs tool. Pull out of hole standing back 5” TT525 drill pipe in derrick. Clean off magnets and clean out Vacs tool. 24h Summary Laying down BHA from 1789’. Clean magnet and recover 20 LBS more of metal fines, only brine in vacs tool, 3 gallons of sand in stinger pipe. Make up bent joint mule shoe and run in hole with vacs tool clean out assembly to 297’ MD. Run in hole with clean out run BHA on 5” TT525 drill pipe from 297’ to 12682’ MD. Wash down from 12682’ to 12787’. Pick up to 12764’ and put 1 right hand turn in string and wash down to 12839’ into upper lateral. Pull out of hole from 12,839’ to 247’. Operation at 07.00 Pick up BHA # 4 Vacs clean out assembly. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 PREP M 5 P Continue to lay down BHA from 1789’ to surface. Clean upper magnet and recover 20 LBS more of metal fines. Clean Vacs tool and only fluid, no sands or sludge. 3 gallons of sand from pipe above flapper recovered. 06:00 07:00 1.00 7.00 PREP M 25 P Clean and clear floor. Service blocks and top drive. 07:00 09:30 2.50 9.50 PREP M 5 P Mobilize Bent joint mule shoe(3.936° bend) assembly to rig floor. Make up and run in hole with BHA #3 vacs tool cleanout run from surface to 297’ MD. PU=64 k, SO=84 k. 09:30 12:00 2.50 12.00 PREP M 4 P Run in hole with clean out run BHA on 5” TT525 drill pipe from 297’ to 4818’ MD. PU=123 k, SO=112 k. 12:00 12:30 0.50 12.50 PREP M 25 P Service draw works, Iron Roughneck and handling equipment. 12:30 16:00 3.50 16.00 PREP M 4 P Continue to run in hole with vacs tool BHA on TT525 drill pipe from 4818’ to 12682’ MD. 16:00 17:00 1.00 17.00 PREP M 9 P Wash down from 12682’ to 12787’ pumping at 3 BPM, 310 psi, set down 4K. Pick up to 12764’ and put 1 right hand turn in string and wash down to 12839’ without rotation to no-go X-O sub, setting down 3-5K. Wash for 5 minutes at 3 BPM, 300 psi, pull out of hole from 12839’ to 12605’ MD. 17:00 23:30 6.50 23.50 PREP M 4 P Blow down top drive and pull out of hole on elevators from 12605’ to 297’, racking TT525 drill pipe in derrick. 23:30 00:00 0.50 24.00 PREP M 4 P Pull out of hole with BHA from 297’ to 247’ MD. Clean upper magnet and recover 20 pounds of metal fines. Check boot baskets, empty. Lay down bumper sub and jars. Note: Max gas= 12 units Back ground gas = 0 units 24 HRS metal Recovery= 20 lbs. Total metal recovered= 89.5 lbs. 24 Hour mud loss to hole 179 bbls. Total losses to the hole= 3451 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/27/2022 Report #: 18 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 82.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Pull out of hole standing back 5” TT525 drill pipe in derrick. Clean off magnets and clean out Vacs tool, lay down BHA #4. Rig up and run wire line on tractor with CCL/GR, CBL, Multi finger imaging tool, and GyroData MicroDLS. Pull out of hole and rig down wire line. 24h Summary Pull out of hole with BHA #3 from 247’ MD. Clean lower magnet and vacs tool, recover 20 pounds of metal fines on lower magnet, no sand in vacs tool, and recover 5 gallons of sandy crude from tail pipe. Run vacs tool BHA #4 in hole picking up 54 joints of 2 7/8” PH6 on TT525 drill pipe. Run in hole Vacs tool BHA on TT525 drill pipe into upper lateral and wash to 14,390’ at 6-8 BPM. Pull out of hole from 14,390’ to 10,055’ MD. Operation at 07.00 Laying down BHA # 4 Vacs tool assembly. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:00 3.00 3.00 PREP M 5 P Pull out of hole and lay down BHA #3 from 247’ MD. Clean lower magnet and recover 20 pounds of metal fines. Recover 5 gallons of thick sandy crude from tail pipe. Clean and clear floor. 03:00 07:30 4.50 7.50 PREP M 5 P PJSM, make up Vacs tool and picking up 2 7/8” PH-6 pipe, BHA #4 in hole to 1848’ MD. GBR torque 2 7/8” PH-6 connections. PU=84 k, SO=76 K. 07:30 13:00 5.50 13.00 PREP M 4 P PJSM, Run in hole with BHA #4 on TT525 drill pipe from 1848’ to 12,576’ MD 13:00 15:30 2.50 15.50 PREP M 25 P PJSM, Slip and cut 119’ of drilling line. Service top drive, blocks, and draw works. 15:30 21:00 5.50 21.00 PREP M 9 P Continue to run in hole with Vacs tool clean out assembly from 12,576’ to 12,680’ MD. Wash down from 12,680’ to 12,789’ MD and tag bridge plug in mother bore. Stroke up and put 1 right hand turn into string. Stroke down and entered upper lateral on second attempt. Increase pump flow rate to 8 BPM, 1920 psi, while washing down from 12830’ to 12917’ decreased flow to 6 BPM due to over boarding returns to rock washer. Wash down from 12,917’ to 14,156’ MD, Increase flow to 8 BPM after brine cleaned up and taking returns to pits. Continue to wash down from 14,156’ to 14,390’ MD, set down 6K. 21:00 00:00 3.00 24.00 PREP M 4 P Pull out of hole from 14,390’ to 12,665’ MD at 60 ft/min. Pull out hole from 12,665’ to10,055 at 120 ft/min after 2 7/8” is out of liner top. PU=150 K, SO=120 k. Note: Max gas= 12 units Back ground gas = 0 units 24 HRS metal Recovery= 20 lbs. Total metal recovered= 109.5 lbs. 24 Hour mud loss to hole 208 bbls. Total losses to the hole= 3994 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/28/2022 Report #: 19 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 82.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Stand by for Gyro timer power up tool. Log up at 40-60 ft/min stopping for 1 minute every 20 minutes to collect data With CCL/GR to top of cement, CBL, Multi finger imaging tool, and GyroData MicroDLS with 1.5 hours of Gyro memory continual mode. Stop for 3 minutes to change to Gyro mode and pull out of hole at 120’ per minute and rig down wire line. Prepare to pick up and run in hole and set MLZXP. 24h Summary Pull out of hole standing back 5” TT525 drill pipe in derrick from 10,055’ to 1,848’ MD. PJSM, lay down Vacs tool BHA #4. Recover .5 bbls of heavy crude from Vacs tool. Recover 10 bbls of thick crude with some sand from tail pipe. Recover 30 pounds of metal fines from magnets. Clean tools and pipe for transport. Clean and clear rig floor. Rig up and run wire line on tractor with CCL/GR, CBL, Multi finger imaging tool, and GyroData MicroDLS. Tag Top of liner and make 500’ of correlation log. Tractor back in hole and stand by for Gyro timer to power up tool. Operation at 07.00 Rigging down Halliburton Slickline. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 04:00 4.00 4.00 PREP M 4 P Pull out hole with TT525 drill pipe from 10,055 to1,848’ at 120 ft/min PU=150 K, SO=120 k. 04:00 11:30 7.50 11.50 PREP M 5 P PJSM, lay down Vacs tool BHA. Lay down the 54 joints of 2 7/8” tail pipe. Recover .5 bbls of heavy crude from Vacs tool. Recover 10 bbls of thick crude with some sand from tail pipe. Recover 30 pounds of metal fines from magnets. 11:30 16:00 4.50 16.00 PREP M 5 P Rig down GBR power tongs. Clean and prepare tools, X-O’s and 2 7/8” drill pipe for sending off floor and transport. Clean oil, sludge and sand from duck pond, rig floor and mats. 16:00 18:00 2.00 18.00 PREP R 5 P PJSM, Rig up Halliburton wire line, Well Tec and Gyro data. Pick up and Rig up wire line on tractor with CCL/GR, CBL, Multi finger imaging tool, and GyroData MicroDLS. Test tools at surface. 18:00 00:00 6.00 24.00 PREP R 15 P Run in hole with wire line from surface to 3972’. Tractor down at 50 ft/min from 3972’ to 12741’. Take survey every 500’ to 3000’. Perform correlation log, log up 500’, tractor back in to 12741’. Wait on Gyro tool timer to power up toll. Continue to clean throughout rig and work on Archer drops audit list. Note: Max gas= 12 units Back ground gas = 0 units 24 HRS metal Recovery= 20 lbs. Total metal recovered= 129.5 lbs. 24 Hour mud loss to hole 200 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/29/2022 Report #: 20 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 81.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue to run in hole and set MLZXP and sting into SLZXP and position at desired depth and orientation 30-40° R. Drop ball and Pressure up set packer. Test packer and annulus to 1500 psi for 15 minutes charted. Bleed pressure and pull out of hole with running tool. Lay down running tool. Prepare and test BOPE 24h Summary Stand by for Gyro timer to power up tool. Log at 40-60 ft/min stopping for 1 minute every 20 minutes to collect data With CCL/GR to CBL, Multi finger imaging tool, and GyroData MicroDLS with 1.5 hours of Gyro memory continues mode to 9177’. Pull out of hole. Data recovered and verified from Gyro tool was good. Rig down Well Tec tractor and E-line. Demobilize units from east side of rig. PJSM, make up MLZXP assembly. Pick up Schlumberger slim pulse MWD and install. Scribe MWD with packer. Run in hole from surface to 4836’ Operation at 07.00 Run in hole with MLZXP at 12,388' MD Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:30 1.50 1.50 PREP R 15 P On bottom and tag liner top with tractor and Gyro tool inside liner, wait for Gyro tool timer to power up tool. Continue to clean throughout rig and work on Archer drops audit list. 01:30 03:00 1.50 3.00 PREP R 15 P Log with CCL/GR , CBL, Multi finger imaging tool, and GyroData MicroDLS at 40-50 ft/min from 12641’ to 9177 MD’, stopping every 20 minutes for 1 minute. Final stop for 5 minutes at 9177’. 03:00 06:30 3.50 6.50 PREP R 15 P Unable to continue pulling, wire miss wraps on drum. Tractor back in hole and fix spooler wraps. Pull out of hole. Continue housekeeping on rig and preventive maintenance. 06:30 09:30 3.00 9.50 PREP R 5 P Rig down Gyro and data recovery. Continue to lay down Halliburton tools. 09:30 10:30 1.00 10.50 PREP R 5 P Data recovered and verified from Gyro tool was good. Continue to rig down Well Tec tractor and E-line. Demobilize units from east side of rig. 10:30 14:00 3.50 14.00 PREP M 5 P Load MLZXP and spacer joint of 5.5” HYD 521 into pipe shed. Mobilize GBR power tongs and 5.5” handling equipment to rig floor. 14:00 17:00 3.00 17.00 PREP M 5 P PJSM, make up MLZXP assembly. Pick up seals and make up to pup joint. Pick up Schlumberger slim pulse MWD and install. Scribe MWD with packer. Run in hole to 170’. 17:00 17:30 0.50 17.50 PREP M 5 P Remove GBR equipment from rig floor. 17:30 23:00 5.50 23.00 PREP M 4 P Continue to run in hole from 170’ to 1000’ with TT525 drill pipe stands from derrick drifting each stand. Perform shallow hole test on tools at 1000’. Continue in hole from 1000’ to 4836’. 23:00 00:00 1.00 24.00 PREP M 9 P Fill pipe and break circulation. Note: Max gas= 62 units Back ground gas = 0 units 24 HRS metal Recovery= 0 lbs. Total metal recovered= 129.5 lbs. 24 Hour mud loss to hole 191 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/30/2022 Report #: 21 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 79.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Prepare and test BOPE. Rig down test equipment. Pick up whip stock BHA and run in hole. Set whip stock and shear off. Pull out of hole. 24h Summary Continue to run in hole with MLZXP and sting into SLZXP, position at desired depth and orientation 30-40° R. Drop ball and Pressure up set packer. Test packer and annulus to 1500 psi for 15 minutes charted, good test. Bleed pressure and pull out of hole with running tool. Inspect and lay down running tool. Flush stack and prepare to change out top pipe rams Operation at 07.00 Testing BOPs. Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:30 6.50 6.50 PREP M 4 P Continue to run in hole from 4836’ to 12,683’ with TT525 drill pipe stands from derrick drifting each stand. Pick up to 12,680’, PU=165 k, SO=114 k. 06:30 07:30 1.00 7.50 PREP M 9 P Circulate at 3.7 BPM at 700 psi. Work string multiple times to obtain tool face at 32° Right. 07:30 08:00 0.50 8.00 PREP M 4 P Position MLZXP at 12,680’, TOL at 12626’, ML collet at 12,638 MD. 08:00 10:00 2.00 10.00 PREP M 19 P Drop 1.5” ball and circulate at 3 BPM at 550 psi. Decrease to 2 BPM at 250 psi, ball on seat at 1769 strokes. Pressure up to 1800 psi to set hanger, slack off to verify set. Increase pressure and observe pusher tool activate at 2450 psi. Set packer at 3200 psi. Attempt to shear ball 2 times with pressures at 5200 psi with no success. 10:00 11:00 1.00 11.00 PREP M 12 P Blow down top drive. Rig up to test packer. Test packer and 9 5/8” casing to 1500 psi for 15 minutes, charted, good test. 11:00 11:30 0.50 11.50 PREP M 19 P Attempt multiple times to verify top of liner with running tool dog subs with no success. Pick up and observed pack off unsting from liner. Circulate AT 4 bpm, 150 PSI, verify released. 11:30 12:30 1.00 12.50 PREP M 4 P Rack back 1 stand to 12 599’ MD. Blow down top drive and primary kill. Blow down choke manifold. 12:30 17:30 5.00 17.50 PREP M 4 P PJSM, pull out of hole from 12,599’ to 3338’ MD, PU=110 k. 17:30 18:00 0.50 18.00 PREP M 20 P ENI personnel walk through all areas of the rig. 18:00 20:30 2.50 20.50 PREP M 4 P Continue to pull out of hole from 3338’ to 170’ MD. 20:30 22:00 1.50 22.00 PREP M 5 P PJSM, lay down Packer running tool and slim pulse MWD BHA from 170' to surface. Tools look good. 22:00 00:00 2.00 24.00 PREP M 20 P Mobilize stack washer crossover and joint. Make up and flush stack from wear ring to flow line at 10 BPM. Blow down top drive and break down tool and lay down. Inspect top drive rail braces for possible adjustment. Prep for changing out rams. Note: Max gas= 88 units Back ground gas = 0 units 24 HRS metal Recovery= 0 lbs. Total metal recovered= 129.5 lbs. 24 Hour mud loss to hole 176 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 3/31/2022 Report #: 22 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 79.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Orient and set whipstock. Displace well to 9.4 PPG oil base mud. Drill window and 20 feet of new formation. Perform FIT test and pull out of hole. 24h Summary PJSM, change out upper pipe rams from 2 7/8” X 5” to 4 ½” X 7”. Rig up annulus A fill up line to fill 9 5/8” casing while testing. PJSM, rig up BOPE testing equipment. Test BOP equipment, on 4.5” and 5” pipe to 250 PSI low and 3500 PSI. Good Test. Rig down BOPE testing equipment, remove test plug, and install 9” ID wear bushing. PJSM, adjust torque tube alignment to ensure top drive is centered over rotary. Perform weekly derrick inspection. Make up Anchor/Whipstock and mill assembly and Run in hole with DP put of the derrick. Operation at 07.00 RIH with Whipstock assembly at 6,726' MD Lithology Shows Mud Weight (lb/gal) 9.33 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:30 2.50 2.50 PREP C 5 P PJSM, change out upper pipe rams from 2 7/8” X 5” to 4 ½” X 7”. Rig up A annulus fill up line to fill 9 5/8” casing while testing. 02:30 04:00 1.50 4.00 PREP C 5 P PJSM, rig up BOPE testing equipment. Make up FOSV, IBOP for 425 and 525 and install test sub on top drive. Pull wear bushing and install test plug. 04:00 05:30 1.50 5.50 PREP C 12 P Flood all BOPE equipment with water and bleed air, perform shell test to 3500 psi, good test. 05:30 11:00 5.50 11.00 PREP C 12 P Test BOP equipment per Permit to Drill, on 4.5” and 5” pipe to 250 PSI low and 3500 PSI for 5 minutes each test. Perform accumulator draw down test, starting pressure 3000 PSI, after function 2150 PSI, 200 PSI recovery 10 seconds, full recovery 56 seconds, 10 N2 bottle average pressure 3600 PSI. Test PVT and gas alarms. Good Tests. Note test witness waived by AOGCC Inspector Austin McCoud 11:00 12:00 1.00 12.00 PREP C 5 P Rig down BOPE testing equipment, remove test plug, and install 9” ID wear bushing, blow down primary and secondary kill lines, upper and lower choke lines and choke manifold. 12:00 14:30 2.50 14.50 PREP M 25 U PJSM, adjust torque tube alignment to ensure top drive is centered over rotary. Perform weekly derrick inspection. 14:30 21:30 7.00 21.50 PREP E 5 P Bring anchor, whipstock and mill assembly to rig floor. Make up Anchor/Whipstock and mill assembly as per Baker and Schlumberger reps. Orient MWD and Scribe slide. 21:30 00:00 2.50 24.00 PREP E 12 P Run in hole with 5" DP out of the derrick from 284" MD to 1,500' and test MWD with 400 GPM @ 440 PSI. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/1/2022 Report #: 23 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 80.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue milling window plus 20’ new formation. Work through window several times. CBU and perform FIT test. Pull out of hole for drilling assembly. 24h Summary Continue to trip in the hole with whip-stock and window milling assembly from 1966- to 12,626' at 40 FPM per Baker tool hand, filling every 20 stands. Circulate at 350 GPM obtain survey of 26R. Obtain up and down weights of 115K DW, 165K UW, slack off and set whip-stock in collet seen bobble with 3K DW, set a total of 10K DW, with a survey of 29R, picked up to 10K over UW to verify set. Three attempts to shear off- no go. Slack off to down weight engage rotary 40 RPM, weight increased to 124K, slack off to 100K, 24K to shear. Drop dart and pump down to Swivel Master sub at 206 GPM. Dart on seat and pressure up to 3.200 psi and hold for 1 minute, Pressure up to 3,600 PSI and shear out dart. Displace well with 9.4 Faze-Pro. Obtain SPRs. Start milling window from 12,567' to 12,575'. Operation at 07.00 Preparing equipment for formation integrity test. Lithology Schrader Bluff - Interlayer Shale Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:00 2.00 2.00 PREP E 4 P Continue to trip in the hole with whip-stock and window milling assembly from 1966- to 3012 at 40 FPM per Baker tool hand, DW 106K. Encountered drag setting down 10K, picked up to 2987’, 106K UW. Trip in hole to 3077’ seen 7K drag at 3012’, DW 4106K 02:00 06:00 4.00 6.00 PREP F 4 P Continue to trip in hole with whip-stock and window milling assembly from 3077’ to 5978’, at 40 FPM, DW 109K, filling pipe every 20 stands. Encountered intermittent drag from 3077’-4330’, while tripping in hole. 06:00 12:00 6.00 12.00 PREP F 4 P Continue to trip in hole with whip-stock and window milling assembly from 5978’ to 11674’, at 40 FPM, DW 113K, filling pipe every 20 stands. 12:00 13:30 1.50 13.50 PREP F 4 P Continue to trip in hole with whip-stock and window milling assembly from 11674’ to TOL 12626,’ at 40 FPM, DW 113K, filling pipe every 20 stands. 13:30 15:30 2.00 15.50 PREP F 19 P Kelly up and circulate at 350 GPM obtain survey of 26R. Obtain up and down weights of 115K DW, 165K UW, slack off and set whip-stock in collet seen bobble with 3K DW, set a total of 10K DW, with a survey of 29R, picked up to 10K over UW to verify set. Slacked off to top drive weight in an attempt to shear bolt then picking up to 15K over up weight repeat process 3 times with no luck. Slack off to down weight engage rotary 40 RPM, weight increased to 124K, slack off to 100K, 24K to shear. Drop dart and pump down to Swivel Master sub at 206 GPM. Dart on seat and pressure up to 3.200 psi and hold for 1 minute, Pressure up to 3,600 PSI and shear out dart. 15:30 19:30 4.00 19.50 PREP M 7 P Hold PJSM and displace well with 20 BBLS LVT and 40 BBLS HI-VIS sweep followed by 871 BBLS of 9.4 PPG Faze-Pro mud 19:30 20:30 1.00 20.50 PREP M 1 P Clean out under shakers, down mud trough to Pit 5 and suction pit. Obtain SPRs @ 12,558’ MD with TVD of 4,077’. MW wt = 9.4 PPG MP #1 @ 3 BPM=100 PSI; 4 BPM=200 PSI MP #2 @ 3 BPM=110 PSI 4 BPM= 210 PSI 20:30 00:00 3.50 24.00 DRILL E 14 P Begin milling window at 12,567’ to 12,575’. Rotary 100 RPM with 15- 25K torque. 451 GPM with 1,500 – 1,900,PSI. WOB = 2/4 K. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/2/2022 Report #: 24 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 78.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue laying down whip stock BHA and make up drilling BHA # 7. Trip in hole and drill ahead as per directional program. 24h Summary Continue milling window from 12,576’ to 12,609’ MD. Pumped 20 BBL super sweep @ 12,580’. Ream window 3 times F/ 12,609’ to 12,560’, with 450 GPM w/ 1790 PSI ; 100 RPM w/16-21 K torque. Wash through window with 100 GPM no rotation. No issues. Pump 50 BBL super sweep while on bottom @ 500 GPM with 2,045 PSI. Back ream to 12,560’. Stop rotation and continue pumping 2 full bottoms up. Flush BOPE 3 times with 500 GPM @ 150 PSI. Rig down Circ. sub. Perform FIT test with 9.4 PPG Faze-pro mud. Tested to equivalent mud weight of 12.6 PPG. 2 BBLS pumped with 2 ¼ BBLS returned. Pull out of hole from 12,523’ to 213’. Operation at 07.00 Change out saver sub and prepare to pick up BHA # 7 Drilling assembly. Lithology Schrader Bluff - Interlayer Shale Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:30 3.50 3.50 DRILL E 14 P Continue milling window from 12,576’ to 12,609’ MD. Pumped 20 BBL super sweep @ 12,580’. 450 GPM w/ 1790 PSI ; 100 RPM w/16-21 K torque ; 3-21 K WOB. P/U = 175 K ; S/O = 104 K , RWT = 125 K 12,609.0 03:30 04:30 1.00 4.50 DRILL E 14 P Ream window 3 times F/ 12,609’ to 12,560’, with 450 GPM, 1790 PSI 100 RPM, 16-21 K torque. Wash through window with 100 GPM no rotation. No issues. Note: Top of window at 12,567' MD Bottom of window at 12,584' MD 12,609.0 04:30 06:30 2.00 6.50 DRILL E 7 P Pump 50 BBL super sweep while on bottom @ 500 GPM, 2,045 PSI. Back ream to 12,560’. Stop rotation and continue pumping 2 full bottoms up. 12,609.0 06:30 08:00 1.50 8.00 DRILL E 9 P Rack back 1 stand DP and make up circ sub. Flush BOPE 3 times with 500 GPM @ 150 PSI. Rig down Circ sub. 12,609.0 08:00 10:30 2.50 10.50 DRILL E 12 P Blow down top drive and rig up for FIT testing. Fluid pack lines and pressure test to 1,500 PSI 12,609.0 10:30 11:00 0.50 11.00 DRILL E 11 P Perform FIT test with 9.4 PPG Faze-pro mud. equivalent mud weight is 12.6 PPG. 2 BBLS pumped with 2 ¼ BBLS returned 12,609.0 11:00 12:00 1.00 12.00 DRILL E 5 P Rig down test equipment and blow down lines. Pump 25 BBL 10.9 PPG dry job. Blow down top drive. Recovered 12 LBS of metal last 12 hours. 12,609.0 12:00 21:00 9.00 21.00 DRILL E 4 P Pull out of hole from 12,523’ to 4,590’ as per K&M tripping schedule. 12,609.0 21:00 00:00 3.00 24.00 DRILL E 4 P Pump dry job and continue POOH from 4,590' to 213' as per K&M tripping schedule. Note: Max gas= 00 units Back ground gas = 0 units 24 HRS metal Recovery= 0 lbs. Total metal recovered= 129.5 lbs. 24 Hour mud loss to hole 0 bbls. 12,609.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/3/2022 Report #: 25 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 0.0 End Depth (TVD) (ftKB) Depth Progress (ft) Drilling Hours (hr) Avg ROP (ft/hr) POB 78.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Drill 8 ¾” L2 hole section. 24h Summary Lay down widow milling assembly. Recovered 294 lbs of metal with upper mill in gauge. Change saver sub, and make up drilling assembly BHA # 7. Trip in hole with BHA # 7 to 1500’ and shallow test MWD, Continue to trip in hole to 8,374’ MD. Operation at 07.00 Slip and cut drilling line. Lithology Schrader Bluff - Interlayer Shale Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:00 3.00 3.00 DRILL E 5 P PJSM, Lay down widow milling assembly, metal recovered from string magnets 295 lbs. Upper watermelon mill is in gauge. Note: TOW 12567’, BOW 12584’ 12,609.0 03:00 05:00 2.00 5.00 DRILL E 5 P PJSM, clean and clear widow milling BHA components from rig floor. 12,609.0 05:00 07:00 2.00 7.00 DRILL E 25 P Change out saver sub due to wear.12,609.0 07:00 08:30 1.50 8.50 DRILL E 5 P Mobilize BHA #7 components to rig floor.12,609.0 08:30 12:00 3.50 12.00 DRILL E 5 P PJSM, make up BHA # 7 as per Schlumberger DD. 12,609.0 12:00 14:00 2.00 14.00 DRILL E 4 P Trip in hole with 8 3/4” directional BHA to 1207’ and shallow test MWD 12,609.0 14:00 00:00 10.00 24.00 DRILL E 4 P Continue to trip in hole with 8 ¾” directional BHA from 1,207' - 8,374’ MD. PU-130K; SO-90K. Recovered 2 lbs metal for 12 hour period. Note: Max gas= 00 units Back ground gas = 0 units 24 HRS metal Recovery= 294 lbs. Total metal recovered= 423.50 lbs. 24 Hour mud loss to hole 0 bbls. 12,609.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/4/2022 Report #: 26 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 13,347.0 End Depth (TVD) (ftKB) 4,102.4 Depth Progress (ft) 738.00 Drilling Hours (hr) 10.81 Avg ROP (ft/hr) 68.3 POB 77.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Drill ahead 8 ¾” L2 hole section. 24h Summary Single in hole with BHA #7 to 10083', change elevators and run in hole on stands to 12508’. Cut and slip drilling line, and perform rig service. Attempt to slack off through window, set down at 12585’ picked up washed through window. Drill from 12591 to 12615’, appeared to be tracking casing. Control drill at 30 FPH and steered downward to effect departure from original well bore, at 12675’ we had dropped 2.3° from original well bore inclination. Continue to drill 8.75” hole section to plan. From 12675’ to 13,347'. Operation at 07.00 Drilling ahead 8 ¾” L2 hole section at 13,952' MD. Lithology Schrader Bluff - OA-3 Sand Shows Gas at 13,060' 241 units Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:00 3.00 3.00 DRILL E 4 P Single in hole with BHA #7 on 4.5” drill pipe from 8374’ to 10083’, filling pipe every 20 stands, UW 141K, DW 96K, 12,609.0 03:00 05:00 2.00 5.00 DRILL E 4 P Change elevators to 5” DP and run in hole with BHA #7 on stands, from 10083’ to 12508’, filling pipe every 20 stands, UW 150K, DW 96K 12,609.0 05:00 07:30 2.50 7.50 DRILL E 25 P PJSM, cut and slip 120’ of drilling line, service blocks, top drive, and calibrate block height. 12,609.0 07:30 10:00 2.50 10.00 DRILL E 19 P Obtain parameters, slack off from 12508’ to 12584’, set down 10K at 12584’ (bottom of window). Picked up to 12555’, engage pump, GPM 200, SPP 500 PSI, and wash down from 12555’ to 12591’, UW 165K. DW 105K. Drilled from 12591’ to 12615’. It appears we tracked casing based on Xceed tool inclinations observed when reaming down in rathole. Expected inclination at 12,584 ft = 88.98° (calculated based on expected whipstock specifications). Xceed inclinations observed on rig floor display: 12,583 = 87.43°, 12,586 = 87.5°, 12,590 = 87.43°, 12,600 = 87.08°. The original hole was 87.18° at top of window and 87.16° at 12,600'. 12,615.0 10:00 11:00 1.00 11.00 DRILL E 4 P Pump out of hole from 12615’to 12550’, GPM 200, SPP 500 PSI, Discuss options with town, decision made to attempt to drill ahead dropping inclination to effect departure from original well bore. Wash down to 12615’ with same parameters. 12,615.0 11:00 12:30 1.50 12.50 DRILL E 3 P Control drill ahead at 30 FPH, from 12615’ to 12675’ in 10’ intervals taking surveys with each survey trending a downward drop in inclination, indicating departure from original well bore. At 12675’ inclination 84.8°, giving us a 2.3° drop in inclination 12,675.0 12:30 13:30 1.00 13.50 DRILL E 3 P Stage ROP up to 90 FPM and begin to steer back to plan. Drill from 12,675’ to 12,718’ 12,718.0 13:30 18:00 4.50 18.00 DRILL E 3 P Continue to directional drill 8.75” hole section from 12,718’ to 12,975’’ per plan. P/U = 165K ; S/O =100K ; ROT =130K. WOB= 4K ; 522 GPM @ 3,145 PSI ; ECD = 10.57 60 RPM @ 12-13K TQ. 12,975.0 18:00 00:00 6.00 24.00 DRILL E 3 P Continue drill ahead from 12,975’ – 13,347’. 60 RPM @ 12-13K TRQ. P/U = 165K ; S/O =105K ; ROT =125K. WOB= 12K ; 500 GPM @ 3,260 PSI ; ECD = 10.31 Note: Max gas= 241 units Back ground gas = 33 units 24 Hour mud loss to hole 0 bbls. 13,347.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/5/2022 Report #: 27 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 15,495.0 End Depth (TVD) (ftKB) 4,075.4 Depth Progress (ft) 2,148.00 Drilling Hours (hr) 15.87 Avg ROP (ft/hr) 135.3 POB 78.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Drill ahead 8 3/4" L2 hole section 24h Summary Drill 8.75” hole section from 13,347’ to 15,495’’as per plan. Operation at 07.00 Drilling ahead 8 3/4" L2 hole section at 16,184' MD. Lithology Schrader Bluff OA-2 Sand Shows Max gas: 246 units @ 13,510' MD Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 DRILL E 3 P Continue to directional drill 8.75” hole section from 13,347’ to 13,866’’ per plan. P/U = 175K ; S/O =89K ; ROT =129K. WOB= 4K ; 522 GPM @ 3,264 PSI ; ECD = 10.72 120 RPM @ 12-13K TQ. LVT @ 4 BPH. 13,866.0 06:00 12:00 6.00 12.00 DRILL E 3 P Continue to directional drill 8.75” hole section from 13,866’ to 14,305’’ per plan. P/U = 169K ; S/O =92K ; ROT =125K. WOB= 4K ; 517 GPM @ 3,250 PSI ; ECD = 10.68 175 RPM @ 12-13K TQ. LVT @ 3-4 BPH. 14,305.0 12:00 18:00 6.00 18.00 DRILL E 3 P Continue to directional drill 8.75” hole section from 14,305’ to 14,904’’ per plan. P/U = 191K ; S/O =75K ; ROT =136K. WOB= 8K ; 517 GPM @ 3,200 PSI ; ECD = 11.05 160 RPM @ 18 K TQ. LVT @ 3-4 BPH. 14,904.0 18:00 00:00 6.00 24.00 DRILL E 19 P Continue to directional drill 8.75” hole section from 14,904’ to 15,495’ per plan. P/U = 200K ; S/O =N/A ; ROT =132K. WOB= 8K ; 517 GPM @ 3,200 PSI ; ECD = 11.02 160 RPM @ 18.5 K TQ. LVT @ 3-4 BPH. Note: Max gas= 246 units Back ground gas = 77 units 24 Hour mud loss to hole 0 bbls. 15,495.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/6/2022 Report #: 28 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 17,865.0 End Depth (TVD) (ftKB) 4,059.7 Depth Progress (ft) 2,370.00 Drilling Hours (hr) 14.65 Avg ROP (ft/hr) 161.8 POB 76.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Drill ahead 8 3/4" L2 hole section. 24h Summary Directional drill 8.75” hole section from 15,495’ to 17,865'’, maintaining directional plan Note crossed Fault C at 15653’, with a 15’ throw;. crossed unplanned fault at 17013’, and was back in OA sand at 17117’. Fault appeared to have a 3’ throw. Operation at 07.00 Drilling ahead 8 3/4" L2 hole section at 18,658' MD. Lithology Schrader Bluff OA-3 Sand Shows Max gas: 402 units @ 16,242' MD Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 DRILL E 3 P Directional drill 8.75” hole section from 15,495’ to 16160’, maintaining directional plan. UW 194K, DW N/A, ROT 130K, GPM 522, SPP 3560 PSI, WOB 4-6K, RPM 160, TQ 18K, and ECD 11.16 Note crossed Fault C at 15653’, with a 15’ throw. 16,160.0 06:00 12:00 6.00 12.00 DRILL E 3 P Directional drill 8.75” hole section from 16160’ to 16796’, maintaining directional plan. UW 200K, DW N/A, ROT 132K, GPM 522, SPP 3590 PSI, WOB 2-4K, RPM 160, TQ 17K, and ECD 11.25. 16,796.0 12:00 18:00 6.00 18.00 DRILL E 3 P Directional drill 8.75” hole section from 16796’ to 17386’, maintaining directional plan. UW 205 K, DW N/A, ROT 134K, GPM 522, SPP 3620 PSI, WOB 5K, RPM 160, TQ 17K, and ECD 11.16. Note: crossed unplanned fault at 17013’, and was back in OA sand at 17117’. Fault appeared to have a 3’ throw. 17,386.0 18:00 21:00 3.00 21.00 DRILL E 3 P Directional drill 8.75” hole section from 17,386’ to 17,637’, maintaining directional plan. UW 200 K, DW N/A, ROT 134K, GPM 522, SPP 3810 PSI, WOB 5K, RPM 160, TQ 18K, and ECD 11.16. 17,637.0 21:00 22:00 1.00 22.00 DRILL E 20 TR02 Crew responded to a fluid release inside pump #3 complex. Notifications given and spill clean up initiated. 17,637.0 22:00 00:00 2.00 24.00 DRILL E 19 P Directional drill 8.75” hole section from 17,637’ to 17,865’, maintaining directional plan. UW 217 K, DW N/A, ROT 134K, GPM 522, SPP 3310 PSI, WOB 7K, RPM 160, TQ 18K, and ECD 11.29. Note: Max gas= 402 units Back ground gas = 98 units 24 Hour mud loss to hole 0 bbls. 17,865.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/7/2022 Report #: 29 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 19,920.0 End Depth (TVD) (ftKB) 4,039.3 Depth Progress (ft) 2,055.00 Drilling Hours (hr) 14.57 Avg ROP (ft/hr) 141.0 POB 71.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Drill ahead 8 3/4" L2 hole section. 24h Summary Directional drill 8.75” hole section from 17,864’ to 19,920’ as per Directional plan. Safety Stand Down with all rig crew members plus all service hands. Operation at 07.00 Drilling ahead 8 3/4" L2 hole section at 20,525' MD. Lithology Schrader Bluff OA-1 Sand Shows Max gas: 113 units @ 18,481' MD Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 07:30 7.50 7.50 DRILL E 3 P Directional drill 8.75” hole section from 17,865’ to 18,665’, maintaining directional plan. UW 202K, DW N/A, ROT 132K, GPM 522, SPP 3590 PSI, WOB 2-4K, RPM 160, TQ 17K, and ECD 11.25. 18,665.0 07:30 08:00 0.50 8.00 DRILL E 1 P Safety Stand Down to discuss spill prevention. Circulate and rotate drill string. 18,665.0 08:00 13:30 5.50 13.50 DRILL E 3 P Directional drill 8.75” hole section from 18,665’ to 19,013’, maintaining directional plan. UW 202 K, DW N/A, ROT 137K, GPM 522, SPP 3820 PSI, WOB 5K, RPM 160, TQ 17K, and ECD 11.48. 19,013.0 13:30 14:00 0.50 14.00 DRILL E 1 P Safety Stand Down to discuss spill prevention. Circulate and rotate drill string. 19,013.0 14:00 20:30 6.50 20.50 DRILL E 3 P Directional drill 8.75” hole section from 19,013’ to 19,647’, maintaining directional plan. UW 205 K, DW N/A, ROT 134K, GPM 522, SPP 3,780 PSI, WOB 5K, RPM 160, TQ 17K, and ECD 11.48 19,647.0 20:30 21:00 0.50 21.00 DRILL E 1 P Safety Stand Down to discuss spill prevention. Circulate and rotate drill string. 19,647.0 21:00 00:00 3.00 24.00 DRILL E 3 P Directional drill 8.75” hole section from 19,647’ to 19,920’, maintaining directional plan. UW 200 K, DW N/A, ROT 133K, GPM 522, SPP 3,840 PSI, WOB 5K, RPM 160, TQ 18/19K, and ECD 11.55 Note: Max gas= 113 units Back ground gas = 49 units 24 Hour mud loss to hole 0 bbls. 19,920.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/8/2022 Report #: 30 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 21,680.0 End Depth (TVD) (ftKB) 4,042.6 Depth Progress (ft) 1,760.00 Drilling Hours (hr) 14.19 Avg ROP (ft/hr) 124.0 POB 72.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Drill 8.75” hole section to TD. Circulate and back ream out of hole. 24h Summary Directional drill 8.75” hole section from 19,920’ to 21,680’ as per Directional plan. Operation at 07.00 Perform circulation cleaning cycle as per procedure. Lithology Schrader Bluff OA-3 Sand Shows Max gas: 168 units @ 21,494' MD' Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 12:00 12.00 12.00 DRILL E 3 P Directional drill 8.75” hole section from 19,920’ to 20,902’, maintaining directional plan. UW 230K, DW N/A, ROT 135K, GPM 522, SPP 4,120 PSI, WOB 5-7K, RPM 160, TQ 17-19K, and ECD 11.61. A 4' concretion at 20,462' - 20,466' MD and 30' at 20,472' - 20,502' MD. 20,902.0 12:00 00:00 12.00 24.00 DRILL E 3 P Directional drill 8.75” hole section from 20,902’ to 21,680’, maintaining directional plan. UW 200K, DW N/A, ROT 135K, GPM 522, SPP 4,230 PSI, WOB 5-7K, RPM 160, TQ 17-19K, and ECD 11.77. A 66' concretion at 20,971' - 21,037' MD and 2' at 21,079' - 21,081' MD. 21,680.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/9/2022 Report #: 31 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 404.00 Drilling Hours (hr) 1.93 Avg ROP (ft/hr) 209.3 POB 72.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue back ream out of hole as per program. 24h Summary Directional drill 8.75” hole section from 21,680’ to 22,084’ maintaining directional plan, TD at 22,084' MD. Begin hole clean up cycle of 3 bottoms up by racking back1 stand for each bottoms up. Back ream from 22,084' to 19,580' , reaming speed 1-20’ per minute as hole conditions allow following back ream schedule. Operation at 07.00 BROOH at 19,131' MD Lithology Schrader Bluff OA-3 Sand Shows Max gas: 253 units @ 22,026' MD' Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:30 3.50 3.50 DRILL E 3 P Directional drill 8.75” hole section from 21,680’ to 22,084’, maintaining directional plan. TD at 22,084' MD UW 210K, DW N/A, ROT 133K, GPM 519, SPP 4,041 PSI, WOB 2-6K, RPM 160, TQ 19-21K, and ECD 11.83 22,084.0 03:30 12:00 8.50 12.00 DRILL E 6 P Begin hole clean up cycle of 3 bottoms up by racking back 1 stand for each bottoms up. Circulate with 517 GPM @ 4,120 PSI. Rotary at 160 RPM W/17-18K TQ. Back reaming @ 1.1-5’ per minute from 22.084’ - 21,836’. Gradually increase to 20” per minute. 22,084.0 12:00 00:00 12.00 24.00 DRILL E 6 P Continue Back reaming from 21,836’ to 19,508’ . Back reaming speed 1-20’ per minute as hole conditions allow. UW 208K, DW N/A, ROT 131K, GPM 517, SPP 3,870 PSI, RPM 160, TQ 17-19K, and ECD 11.8 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/10/2022 Report #: 32 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 75.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue to pump out of the hole with reduced pump rate at 100 GPM and no rotation. 24h Summary Back reaming from 19,508’ to 16,276’ . Back reaming speed 1-20 FPM as hole conditions allow following program schedule. Observed sudden loss of 1,000 psi pump pressure at 16,302'. Stop reaming and verify surface equipment. All OK. Suspect well commander wash out. Discuss options with town and minimums on circulation rates. Continue to pull of the hole from 16,276' - 16,119' with 100 GPM @ 105 PSI. No rotation. Loose connections found on 1st and 2nd stand pulled. Checking each connection. Operation at 07.00 BROOH at 15,588' MD Lithology Schrader Bluff OA-3 Sand Shows Max gas: 20 units @ 19,200' MD' Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 DRILL E 4 P Continue Back reaming from 19,508’ to 18,800’ . Back reaming speed as hole conditions allow. GPM 522, SPP 3,700 PSI, RPM 160, TQ 16K, and ECD 11.2 – 12.16. Slight packing off as BHA transitions through OA3 – OA2. 22,084.0 06:00 18:00 12.00 18.00 DRILL E 6 P Continue Back reaming from 18,800’ to 16,706’ . Back reaming speed as hole conditions allow. GPM 522, SPP 3,700 PSI, RPM 160, TQ 16K, and ECD 11.3. Slight packing off as BHA transitions through OA3 – OA2 22,084.0 18:00 21:30 3.50 21.50 DRILL E 6 P Continue Back reaming from 16,706’ to 16,276'’ . Back reaming speed 1 -20 FPM as hole conditions allow following program schedule. GPM 522, SPP 3,580 PSI, RPM 160, TQ 16K, and ECD 11.30. Observed a sudden loss of 1,000 psi pump pressure. 22,084.0 21:30 23:00 1.50 23.00 DRILL E 6 P Stop reaming and verify surface equipment. All OK. MWD turbine dropped from 4K rpm to 2,800 rpms indicating issue is up drill string. Suspect well commander wash out. Discuss options with town and program minimums on circulation rates. 22,084.0 23:00 00:00 1.00 24.00 DRILL E 6 P Continue to pull of the hole from 16,276' - 16,151' with 100 GPM @ 105 PSI. No rotation. Loose connections found on 1st and 2nd stand pulled. Checking each connection. 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/11/2022 Report #: 33 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 75.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue to pump out of the hole at 103 GPM and over pull limit of 20K. Down rotation only to work through problem areas at 20 RPM. 24h Summary Pump out of the hole from 16,151' – 14,333’ with 100 GPM at 105 PSI. PUW=190K. ROT=130K. Top joint of stand # 147 ( Bit depth=14,339’) was backed out ¾ of the way. Lay down stand #147 . Notified office, continue POOH pumping 100 GPM and working pipe through trouble spots. Verify torque of each connection. Operation at 07.00 Continue to pump out of the hole at 12,972' MD Lithology Schrader Bluff OA-3 Sand Shows Max Background gas: 7 units Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 21:30 21.50 21.50 DRILL E 4 P Continue to pump out of the hole from 16,151' – 14,339’ with 103 GPM at 105 PSI. PUW=190K. ROT=130K. Over pull limit is 20K. Down rotation only to work through problem areas. 20 RPM-10K TQ 22,084.0 21:30 23:00 1.50 23.00 DRILL E 4 P Top joint of stand # 147 ( Bit depth=14,339’) out of the hole was backed out ¾ of the way. Lay down stand #147 . Notified office, will continue POOH pumping 100 GPM and working pipe through trouble spots. 22,084.0 23:00 00:00 1.00 24.00 DRILL E 4 P Continue to pump out of the hole from 14,339' – 14,333’ with 103 GPM at 105 PSI. PUW=190K. ROT=130K. Over pull limit is 20K. Down rotation only to work through problem areas. 20 RPM-10K TQ 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/12/2022 Report #: 34 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 74.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Test BOPE. Make up clean out BHA and trip in the hole. 24h Summary Continue to pump out of the hole from 14,189' – 12,416’ with 50 GPM @ 90 PSI. PUW=170K. ROT=130K. Over Pull limit is 20K. Down rotation only to work through problem areas. 20 RPM-10K TQ. Verify make up TQ for every DP connection. POOH on elevators as per K&M schedule from 12,416’ to 2,017’. Operation at 07.00 Clean and clear rig floor. Prep for BOP test. Lithology Schrader Bluff OA-3 Sand Shows Max Background gas: 7 units Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 DRILL E 4 P Continue to pump out of the hole from 14,189' – 13,040’ with 50 GPM @ 90 PSI. PUW=170K. ROT=130K. Over Pull limit is 20K. Down rotation only to work through problem areas. 20 RPM-10K TQ. Verify make up TQ for every DP connection 22,084.0 06:00 09:00 3.00 9.00 DRILL E 4 P Continue to pump out of the hole from 13,040' – 12,416’ with 50 GPM @ 90 PSI. PUW=170K. ROT=135K. Over pull limit is 20K. Down rotation only to work through problem areas. 20 RPM-10K TQ. Verify make up TQ for every DP connection 22,084.0 09:00 12:00 3.00 12.00 DRILL E 4 P Blow down TD & POOH on elevators as per K&M schedule from 12,416’ to 10,837’. PUW – 160K. Verify make up TQ for every DP connection 22,084.0 12:00 18:00 6.00 18.00 DRILL E 4 P POOH on elevators as per K&M schedule from 10,837’ to 6,900’. PUW – 130K. Verify make up TQ for every DP connection 22,084.0 18:00 00:00 6.00 24.00 DRILL E 4 P POOH on elevators as per K&M schedule from 6,900’ to 2,017’. PUW – 100K. Verify make up TQ for every DP connection. 24 Hour losses: 32 bbls Total losses to the hole: 5121 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/13/2022 Report #: 35 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 72.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Make up clean out BHA and trip in the hole. 24h Summary Continue to POOH from 2,017’ to BHA. Lay down BHA and clear/clean rig floor. Rig up and test BOPE; Blind/shear ram leaking. Change out sealing elements, Re-test OK. Test Witnessed by AOGCC Brian Bixby. Operation at 07.00 Trip in the hole with clean out BHA at 2556' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:00 2.00 2.00 DRILL E 4 P Continue to POOH from 2,017’ to BHA verifying correct make up torque for each drill pipe connection 22,084.0 02:00 07:00 5.00 7.00 DRILL E 4 P Lay down BHA and clear/clean rig floor 22,084.0 07:00 09:30 2.50 9.50 DRILL C 20 P Make up stack washer and flush stack and Blow down Pull wear bushing and install test plug with test joint. Rig up test valves, hoses etc 22,084.0 09:30 15:00 5.50 15.00 DRILL C 20 P Test BOPE with 4 ½” test joints as per AOGCC requirements, 250 psi low/3,500 psi high, AOGCC representative Brian Bixby witness the BOPE test. good tests. 22,084.0 15:00 16:00 1.00 16.00 DRILL E 20 TR05 Not getting good test on blind/shear ram. Suspect test plug o-ring. Pull test joint and replace o-ring. Blind/Shear ram still not testing. Ram seals leaking. 22,084.0 16:00 19:00 3.00 19.00 DRILL E 20 P Continue testing with 5 ½” test joint, 250/3,500 psi, perform acumulator draw down test, good tests.22,084.0 19:00 22:00 3.00 22.00 DRILL E 20 TR05 Leave test joint and test plug in position with FOSV installed in top with bottoms rams tested and closed making a tested second barrier. Monitor well on trip tank via tubing spool keeping the well full of mud. Suck out stack and open blind ram doors. Remove blind rams and change out sealing elements. Reinstall rams and button up doors. 22,084.0 22:00 00:00 2.00 24.00 DRILL E 20 P Pull test joint and re-test blind/shear rams. Re-test OK. 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/14/2022 Report #: 36 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 76.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue trip into hole to 22,084' and back ream out of hole as per program. 24h Summary Remove test plug and install 9” wear bushing. Drain and blow down choke manifold and all test lines, Make up clean out BHA and trip into the hole to 12,472. Cut/slip drilling line. Change out saver sub and calibrate blocks. Cont trip f/12,475' to 16,113'. Note: Crew pre-tour and pre-job safety meetings discussed driving safety awareness. Operation at 07.00 Back reaming out of hole at 21980' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:00 2.00 2.00 DRILL C 20 P Remove test plug and install 9” wear bushing. Drain and blow down choke manifold and all test lines.22,084.0 02:00 04:30 2.50 4.50 DRILL E 5 P Mobilize clean out BHA #8 to rig floor and make up as per Directional Driller. 22,084.0 04:30 12:00 7.50 12.00 DRILL E 4 P Trip into hole from derrick from 374’ to 9,571’ filling pipe every 20 stands. PUW -131K; SOW – 90K 22,084.0 12:00 15:30 3.50 15.50 DRILL E 4 P Continue tripping into the hole from 9,571’ to 12,475’ filling pipe every 20 stands. PUW -157K SOW – 98K 22,084.0 15:30 17:30 2.00 17.50 DRILL E 25 P Cut and slip drilling line while monitoring well on trip tank. 22,084.0 17:30 20:00 2.50 20.00 DRILL E 20 P Change out saver sub, service top drive and recalibrate blocks while monitoring well on trip tank. 22,084.0 20:00 00:00 4.00 24.00 DRILL E 4 P Continue tripping into the hole from 12,475’ to 16,113’; filling pipe every 20 stands. SOW – 98K 24 hour losses 0 bbls Total losses to well 5121 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/15/2022 Report #: 37 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 81.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue back ream from 16,396’ with 500 – 600 GPM @ 3,175 -4,100 PSI, to window. 24h Summary Continue to run in the hole from 16,113’ to 21,992’ ; wash down to 22,084’ with 187 GPM. Stage up pumps to 500/600 GPM @ 3,500/4,100 PSI, 160 RPM and 17-18K TQ and back ream from 22,084’ to 16,396’. NOTE: Pre-job safety meetings watch video on driving safety. Operation at 07.00 Back reaming out of hole at 15,469' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 06:00 6.00 6.00 DRILL E 4 P Continue to run in the hole from 16,113’ to 21’992’; filling pipe every 20 stands. SOW-80K. 22,084.0 06:00 07:00 1.00 7.00 DRILL E 4 P Make up top drive and wash down from 21,992’ to 22,084’ with 187 GPM @340 PSI. Stage up pumps to 400 GPM @ 2540 PSI 22,084.0 07:00 12:00 5.00 12.00 DRILL E 4 P Back ream out of hole 10 - 20’ FPM from 22,084’ – 20,410’ with 500 GPM @ 3,500 PSI; 160 RPM @ 17/18K TQ. RWT-123K 22,084.0 12:00 18:00 6.00 18.00 DRILL E 4 P Continue back ream from 20,410’ – 18,418' with 500 - GPM @ 3,500 - 4,100 PSI; 160 RPM @ 17/18K TQ. RWT-123K 22,084.0 18:00 00:00 6.00 24.00 DRILL E 4 P Continue back ream from 18,418’ – 16,396’’ with 500 – 600 GPM @ 3,175 - 4,100 PSI; 160 RPM @ 15K TQ. RWT-123K. 24 hour losses 77 bbls Total losses to well 5198 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mark Ashley ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/16/2022 Report #: 38 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 80.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Pull BHA up into 9-5/8 shoe Circ 2x bottoms up, pump dry job, POOH on elevators, Break out Lay down BHA, Make up whipstock retrieval BHA #9. 24h Summary Trouble shoot top drive, change out shot pin assembly, problem resolved, back ream out of the hole from 16396 to 15469 md, Trouble shoot top drive again, Grabber not functioning, change out check valves, grabber operational. Continue back reaming out of the hole from 15469' to12634' MD. Operation at 07.00 Pulling out of hole on Elevators at 9959' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:30 3.50 3.50 DRILL E 25 TR04 PJSM, Troubleshoot top drive, make up FOSV, head pin, Halliburton valve and high pressure hose to drill pipe, monitor well on trip tank keeping hole full of mud, change out shot pin assembly, problem resolved. 22,084.0 03:30 06:30 3.00 6.50 DRILL E 6 P Continued back reaming out of the hole f/ 16396 to15569 md @ 10-20 fpm, 600 gpm,3,950 psi.160 rpm, 14-15 TQ, Rot Wt 125k 22,084.0 06:30 09:30 3.00 9.50 DRILL E 25 TR04 PJSM, Troubleshoot top drive, Grabber not Functioning, change out check valves on Grabber system, grabber operational. Top drive made up to drill pipe during valve changes, monitor well on trip tank keeping hole full of mud. 22,084.0 09:30 12:00 2.50 12.00 DRILL E 6 P Continued back reaming out of the hole, f/ 15469 to 14828 @ 10-20 fpm,600 gpm 3825 psi 60-160 rpm, tq 13- 14 k, rot Wt 125k 22,084.0 12:00 18:00 6.00 18.00 DRILL E 6 P Continued back reaming f/14828' to13501' MD @ 2-20 fpm, 600 gpm, 3400 psi, rpm 60-160, tq 13k Rt wt- 123k 22,084.0 18:00 21:30 3.50 21.50 DRILL E 6 P Back ream f/ 13501 to 12714 md, 2-20 fpm, 600 gpm, 3400 psi, rpm 60-160, Tq 10k, rot wt 12k, Attempted to pack off multiple times due to shale build up. 22,084.0 21:30 00:00 2.50 24.00 DRILL E 6 P Continued Back ream f/ 12714 to 12634 md, @ 1-2 fpm, gpm 600-650, psi 3400- 3880, rpm 120, Tq 11k, Rt wt 123k, Attempt to pack off. 24 hour losses 55 bbls Total losses to well 5253 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Anton Gress ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/17/2022 Report #: 39 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 81.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue tripping in the hole with whipstock retrieval BHA #9 to 40 ft above top of whip stock record p/u-s/o Break circ wash over whip stock turn pumps off Latch onto whip stock Pull free Trip out of the hole with whipstock and anchor. 24h Summary Cont Trip out of hole from 12644' MD to BHA Break & lay down BHA #8. Clear and Clean Rig Floor, repair top drive. Pick and make up BHA #9 whipstock Retrieval, Trip in the hole to 1,405' MD. Operation at 07.00 Running in hole with BHA #9 at 10909' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:00 1.00 1.00 DRILL E 4 P Continue back reaming out of hole F/12644’ to 12609’ MD, 611 GPM, 120 RPM, Trq 10-11K, turn off rotary reduce flow rate F/ 12609’ to 12555’ MD, 125 GPM, 225 PSI and pull through shoe with 5-7K drag PUW 175K. 22,084.0 01:00 03:30 2.50 3.50 DRILL E 7 P Perform clean up cycle, 653 GPM, 3770 PSI, 160 RPM, 8-14K Trq, F/ 12555’ to 12285’ MD Circulate 3 bottoms up and rack back a stand after each bottoms up. 22,084.0 03:30 05:00 1.50 5.00 DRILL E 4 P Perform 30 min. flow check, pull out of hole F/12285’ to 11825’ MD PUW 175K, monitor for swabbing. Pu mp 20 bbls dry job, blow down top drive. 22,084.0 05:00 13:30 8.50 13.50 DRILL E 4 P Pull out of hole on elevators from 11825’ to 368’ MD PUW 98K. 22,084.0 13:30 17:30 4.00 17.50 DRILL E 5 P Change out elevator to 5”. Lay down BHA #8, remove BHA from rig floor. 22,084.0 17:30 19:30 2.00 19.50 DRILL E 25 TR04 Repair shot pin assembly on top drive, change out hydraulic filter. 22,084.0 19:30 23:00 3.50 23.00 DRILL E 5 P PJSM, MOB whipstock retrieval BHA # 9 to rig floor and make up as per Baker & SLB reps. 22,084.0 23:00 00:00 1.00 24.00 DRILL E 4 P Run in hole with BHA #9 F/ 171’ to 1405’ MD. PUW 78K, SO 83K. 24 hour losses 23 bbls Total losses to hole 5276 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Anton Gress ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/18/2022 Report #: 40 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 83.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue to pull out of hole with whipstock retrieval BHA #9 from 1474' MD to surface, (no whipstock on retrieval tool) MOB new whipstock retrieval tool, make up BHA and fish for whipstock, pull out of hole lay down whipstock, make up and run SBD. 24h Summary Trip in hole with whip stock retrieving tool from 1405" to 12509", obtain perameters and orientated hook, was able to engage whip stock slide at 12564", opened unloader and snapped out of anchor, pull out hole with whip stock fron 12582' to 12390", seen 40--50k over pull in addition to swabbing. Rigged up and pumped out of the hole from 12390' to 11648, Continued trip out of the hole from 11648" to 1474' MD. Operation at 07.00 Preparing whipstock retrieval BHA #10. Lithology Schrader Bluff Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 01:00 1.00 1.00 DRILL E 4 P Trip in hole with whipstock pulling tool from 1405’-1509’ perform shallow hole MWD test at GPM 350, SPP 570 PSI. All good. 22,084.0 01:00 08:00 7.00 8.00 DRILL E 4 P Continue to trip in hole with whipstock pulling tool from 1509’-12509’ filling pipe every 20 stands. UW 170K, DW 100K. 22,084.0 08:00 13:00 5.00 13.00 DRILL E 4 P Obtain perimeters, GPM 353 -SPP 1220 PSI, GPM 450 - SPP 1750 PSI, GPM 517 – SPP 2400 PSI, UW 170K, DW 100K. Wash down with hook orientated 180° out to wash whipstock face and retrieval slot, observed slight packoff, continues to work pipe, washed across whipstock face multiple times. Pulled above whipstock orientated 30R and set set down and pulled up in an attempt to engage hook into whipstock ramp with no luck, made multiple attempt while adjusting tool face. Was finally able to engage whipstock, set down seen 20K WOB at 12564’, picked up and pulled over 20K. Continue to pick up to 230K 55K over and seen unloader shear, monitor well for losses for 10 minutes, and continue to pull to 60K over and release anchor. 22,084.0 13:00 14:00 1.00 14.00 DRILL E 4 P Blow down top drive, and primary kill line. Prep rig floor to pull out of hole with whipstock on elevators, while monitoring for flow. 22,084.0 14:00 14:30 0.50 14.50 DRILL E 4 P Pull out of hole with whipstock from 12582’ to 12390’, observed 40-50K overpull breaking back to normal up weight, resulting in swabbing. 22,084.0 14:30 16:00 1.50 16.00 DRILL E 4 P PJSM, rig up and pump out of hole from 12390’ to 11648’ at GPM 108 - SPP 160 PSI 22,084.0 16:00 23:30 7.50 23.50 DRILL E 4 P Continued trip out of the hole on elevators from 11648 to 9232' MD, Pump 21 bbl. dry job of 11.2 PPG. continue to pull out of hole to 1474' MD. PU=86k 30-70FPM. 22,084.0 23:30 00:00 0.50 24.00 DRILL E 4 P Changed out die blocks on ST-100 for 4.5 DP. Change out elevators from 5" to 4.5". 24 hour losses 23 bbls Total losses to hole 5314 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Ted Kruger Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/19/2022 Report #: 41 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 83.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue to fish whipstock, pull out of hole with whipstock lay down BHA, make up and run in hole with SBD assembly. 24h Summary Pull out of the hole with whip stock retrieval hook BHA #9 F/ 1474' MD to surface, did not recover whip stock. Clean string magnets and recovered 10# metal, cut and slip 84ft drilling line. Made up new whip stock retrieval BHA #10 with new hook and trip in the hole to 12,581' MD. Wash whipstock face multiple times, attempt to latch onto whipstock with no success. Operation at 07.00 Pulling out of hole with BHA #10 @ 11,095' MD Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:30 2.50 2.50 DRILL E 4 P Continue to pull out of hole with whipstock retrieval hook assembly from 1474’ to 171’. 22,084.0 02:30 06:30 4.00 6.50 DRILL E 4 P PJSM, lay down whipstock retrieval BHA, clean magnets recovered 10# metal continue, to lay down BHA, Note did not recover whipstock. 22,084.0 06:30 08:30 2.00 8.50 DRILL E 5 P Clean and clear rig floor, and remove whipstock hook from rig floor. Organize tools and prep for next BHA. 22,084.0 08:30 10:30 2.00 10.50 DRILL E 25 P PJSM, Slip and cut 85’ of drilling line 22,084.0 10:30 11:00 0.50 11.00 DRILL E 5 P PJSM, Mobilize new whipstock retrieval hook to rig floor, and make up new BHA #10 Whipstock retrieval assembly. 22,084.0 11:00 12:00 1.00 12.00 DRILL E 4 P Trip in hole with Whipstock retrieving BHA from 171’ to 1571’ and perform shallow MWD test, at GPM 353, SPP 400 PSI. Good test. 22,084.0 12:00 20:30 8.50 20.50 DRILL E 4 P Continue to trip in hole with whipstock retrieval BHA from 1571’ to 12581’, filling pipe every 20 stands. 22,084.0 20:30 00:00 3.50 24.00 DRILL E 19 P Obtain parameters. GPM 350 -SPP 1210 PSI, GPM 450 - SPP 1750 PSI, GPM 517 – SPP 2400 PSI, UW 170K, DW 100K. Wash down with hook orientated 120°/180° out to wash whipstock face and retrieval slot several times, observed slight bobble on weight indicator many times continues to work pipe, washed across whipstock face multiple times. Pulled above whipstock orientated tool face 30R /35R and set down and pulled up in an attempt to engage hook into whipstock ramp with no luck, made multiple attempt while adjusting tool face. 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/20/2022 Report #: 42 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 77.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Make up seal bore diverter assembly. Trip in the hole to 12567' MD. 24h Summary Engage whipstock, pull out of hole from 12567’ to 12440’, swabbing. Pumped out of hole from 12440’-11945’ MD. Pull out of hole on elevators with whipstock from 11945’ to 245’ Laid down fishing BHA assembly. Clear & clean rig floor. Prep for Seal bore diverter assembly run. Operation at 07.00 Running in the hole with seal bore diverter assembly at 5757' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 03:00 3.00 3.00 DRILL E 19 P Continue to work string attempting to pull whipstock free from 12567, set 40K down picked up to 50K over up weight, allow jars to bleed off, pick up to 90K over, and had weight drop had free movement, however we did not see a drop in fluid level. Slack off and set 40K down seen bobble indicating latch, picked up 20K above up weight had weight fall off. Could not confirm whipstock engagement, repeated process several time with the final time setting down 40K and picking up 105K over string weight and had upward traveling weight 8K over original up weight. 22,084.0 03:00 05:30 2.50 5.50 DRILL E 4 P PJSM, monitor well, fluid level static. Pull out of hole from 12567’-12440’, had 10-15K drag and swabbing. Pump out of hole from 12440’ to 11945’ at GPM 118, SPP 180 PSI, UW 172K. 22,084.0 05:30 07:30 2.00 7.50 DRILL E 4 P Pull out of hole on elevators with whipstock retrieval BHA and whipstock assembly, from 11945’ to 10920’, UW 170K, following trip schedule. 22,084.0 07:30 12:00 4.50 12.00 DRILL E 4 P Pump 15 BBL 11.2 PPG dry job, and continue to pump out of hole with whipstock retrieving BHA and whipstock assembly, from 10920’ to 5805’ UW 140K following trip schedule 22,084.0 12:00 14:30 2.50 14.50 DRILL E 4 P Continue to pump out of hole with whipstock retrieving BHA and whipstock assembly, from 5805’ to 1447’ UW 92K following trip schedule 22,084.0 14:30 15:30 1.00 15.50 DRILL E 5 P Change die blocks on ST-100 For 4.5” drill pipe. Pulled stripping rubbers, changed elevators to 4.5". 22,084.0 15:30 19:00 3.50 19.00 DRILL E 4 P PJSM, Laid down hook assembly and whip stock as per Baker Fishing Rep. Upper 4 Magnets Recovered metal= 50#, lower magnets recovered metal= 20#. 22,084.0 19:00 22:00 3.00 22.00 DRILL E 4 P PJSM, Demob whip stock / hook and fishing BHA from rig floor. Clear & clean rig floor. 22,084.0 22:00 00:00 2.00 24.00 DRILL E 4 P PJSM, MOB & rig up GBR power tongs & equipment, begin making up seal bore diverter assembly as per Baker Rep. 24 hour metal recovery 70 lbs. 24 hour losses 0 bbls Total losses to hole 5314 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Steve Lawrence ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/21/2022 Report #: 43 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 83.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Run in the hole with 5.5" production liner. 24h Summary Continued making up seal bore diverter assembly, Trip in the hole set top of the diverter @ 12,560 md Trip out of the hole, break and laid down BHA assembly. Clear & clean rig floor, rig up GBR tools & equipment. Prep to run 5.5" production liner. Operation at 07.00 Running in the Hole with 5.5" liner at 1400' MD. Lithology Schrader Bluff OA-3 Sand Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:30 2.50 2.50 DRILL E 4 P PJSM, Continued making up seal bore diverter assembly. Shallow test MWD @ 94’, good. Confirm tool will unlatch and latch up @ 320 Gpm Psi=450 received MWD signal with 500 GPM @ 1050 PSI. 22,084.0 02:30 12:00 9.50 12.00 DRILL E 4 P Continued trip in the hole from/171‘ to 12485’. filling drill pipe every 20 stands max running speed 90 FPM PU=168K SO=102 22,084.0 12:00 13:30 1.50 13.50 DRILL E 19 P Circulate and wash down from 12485’ to 12579’ @ 324 GPM with 1190 Psi orient @ 53 degrees right, Continued to wash down tag liner top @ 12626’ roll off and continued washing down, set down on and attempt to latch multiple times with 30k down, latch on depth @ 12657’ @ 52 Degrees right rolled over @ 35 degrees right. Verify latch X2 with 30k & 40k over pull, set down 20k released with 512 gpm @ 2550 Psi, Picked up and free with 167k string weight. 22,084.0 13:30 14:00 0.50 14.00 DRILL E 4 P Trip out of the hole from 12571’ to 12488’ at 10 fpm as per K&M trip schedule with a PU=173K. 22,084.0 14:00 15:30 1.50 15.50 DRILL E 7 P Circulate bottoms up with 512 Gpm @ 2550 Psi F/O=8%. Pump dry job 22 bbls, of 11.1 ppg, Drop 2.8 drift down drill pipe, Blow down top drive. 22,084.0 15:30 00:00 8.50 24.00 DRILL E 4 P Continued trip out of the hole on elevators, from 12488’-1612' MD. 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/22/2022 Report #: 44 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 77.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Run in hole with production liner on 5” drill pipe from 11,336’ to 12,490’. Change out saver sub to delta 425. Run in hole with 4 1/2" Delta 425 drill pipe. Land out hanger as per Baker hand with 40 K down. Drop ball and confirm release. Pick up above hanger and pressure up to blow out ball seat and clean SBD. Pull out of hole laying down 425 drill pipe, standing back 5 “ drill pipe and lay down running tool. 24h Summary Continue to trip out of hole from 1,612’ and lay down running tool BHA. Clean and clear floor. Rig up to run 5” production liner. Run 5.5" production liner from surface to 9,450’ MD. Make up liner hanger run in hole to 9500’ MD. Change out handling equipment to 5”. Run production liner in hole on 5” drill pipe from 9500’ to 11.366’ MD. Operation at 07.00 Running in hole with 5 1/2" liner at 14547' MD. Lithology Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 02:30 2.50 2.50 DRILL K 4 P Continued tripping out of the hole on elevators from 1612' MD to surface, laying down SBD running tool. Drift recovered from last stand of drill pipe. Clear floor of BHA. Clean floor. 22,084.0 02:30 04:30 2.00 4.50 DRILL K 1 P Mobilize GBR, Liner running equipment and pup joints to rig floor. Rig up to run 5.5” liner, 15.5#, L-80, HYD 521 liner. 22,084.0 04:30 12:00 7.50 12.00 DRILL K 4 P Run 5.5” liner, 15.5#, L-80, HYD 521 liner from surface to 3,497’ MD. Torque turn each connection with GBR, using dog collar and stabbing guide. PU=95 K, SO=95 k. Superior thread rep here to witness and inspect connections. 22,084.0 12:00 20:00 8.00 20.00 DRILL K 4 P Run 5.5” liner, 15.5#, L-80, HYD 521 liner from surface from 3,497’ to 9,450’ MD. Torque turn each connection with GBR, using dog collar and stabbing guide. PU=130 K, SO=90 k. Superior thread rep here to witness and inspect connections. 22,084.0 20:00 21:00 1.00 21.00 DRILL K 5 P Change out elevators to 5”. Demob thread protectors and mobilize Baker equipment to rig floor. 22,084.0 21:00 22:30 1.50 22.50 DRILL K 4 P PJSM, make up Ram liner hanger to 5.5” production liner as per Baker hand, run in hole from 9450’ to 9500’ MD. 22,084.0 22:30 23:00 0.50 23.00 DRILL K 5 P Remove Cross over from 4..5” drill pipe stand. Remove cross over from FOSV. Change die blocks on ST-100 for 5” drill pipe. 22,084.0 23:00 00:00 1.00 24.00 DRILL K 4 P PJSM, run in hole with 5” drill pipe from 9500’ to 11,366’ MD. 24 hour losses 0 bbls Total losses to hole 5314 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date CASING 9 5/8 8.84 L-80 0.0 12,962.0 4,096.6 9/12/2019 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: DRILLING WCEI: LEVEL 3 Daily Report Date: 4/23/2022 Report #: 45 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information End Depth (ftKB) 22,084.0 End Depth (TVD) (ftKB) 4,039.2 Depth Progress (ft) 0.00 Drilling Hours (hr) Avg ROP (ft/hr) POB 75.0 MD @ Report Time (ft… TVD @ Report Time (ft… Daily Summary Operations 24h Forecast Continue to pull out of hole laying down 425 drill pipe, standing back 5“ drill pipe and lay down running tool. Make up and run in hole with LEM and SLZXP. Work down and latch LEM into RAM hanger collet, confirm latch. Set SLZXP, test annulus to 1500 psi for 30 minutes, charted. Pull up and displace OBM with 9.4 PPG brine. 24h Summary Run production liner in hole on 5” drill pipe from 11,366’ MD to 12,490’. Change out saver sub to delta 425. Run in hole with 425 drill pipe from 12,490’ to 18,840’ MD. Rotate In hole from 18,840’ to 22,052’ and observe and verify latch. Drop ball and pump ball down pressure up and bleed to 0 psi and confirm release. Pick up and shear ball seat. Pick up 75’ and run in hole and tag with 5k to verify main bore entry. Top of Hanger at 12,555.25’. pull out of hole laying down 4 ½” drill pipe to pipe shed from 12573’ to 10,863’. Note: This will be last drilling report, move to completion. Operation at 07.00 Pulling out of hole with liner running tool laying down 4 1/2" Delta 425 drill pipe at 3767' MD. Lithology Shows Mud Weight (lb/gal) 9.40 Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. End Depth (ftKB) 00:00 00:30 0.50 0.50 DRILL K 9 P Break circulation at 5 BPM at 440 psi.22,084.0 00:30 01:30 1.00 1.50 DRILL K 4 P PJSM, run 5 1/2" liner in hole with 5” drill pipe from 11,366’ to 12490’ MD, SO= 90 k. 22,084.0 01:30 04:00 2.50 4.00 DRILL K 1 P Change saver sub on top drive from TT525 to Delta 425. Change to drive jaws. 22,084.0 04:00 13:00 9.00 13.00 DRILL K 4 P Make up first stand of 4.5” drill pipe and obtain parameters. PU=161 k, SO=106 k, RW=132 k. Continue to running 5 1/2" liner in hole with 4.5” drill pipe from 12,490’ to 18,840’ MD, drifting non-drifted drill pipe out of derrick from 13,728 with 2.4” drift. Break circulation every 20 stands, SO=68 k. 22,084.0 13:00 20:00 7.00 20.00 DRILL K 4 P Rotate in hole from 18,840’ to 22,052’, observe latch in, 30 RPM, TQ=15 k, RW=128 k. Set down 3 times with 40 K. Over pull 20 k, 30 k, 40 k and confirmed latch. 22,084.0 20:00 22:00 2.00 22.00 DRILL K 19 P Drop 1” setting ball, circulate down at 6 BPM at 1300 psi, slowing to 2 BPM at 260 psi. Ball on seat at 1686 stokes, pressure up to 3100 psi and hold for 5 minutes. Bleed pressure off and verify release at 157K up weight. Pick up and shear ball seat at 4000 psi. Pick up 75’ and run in hole and tag with 5k to verify main bore entry. Top of Hanger at 12,555.25’. 22,084.0 22:00 00:00 2.00 24.00 DRILL K 4 P PJSM, pull out of hole laying down 4 ½” drill pipe to pipe shed from 12573’ to 10,863’. Rig up super sucker and vacuum wiper dart through drill pipe to clean. 24 Hour mud loss to hole 0 bbls Total losses to hole 5314 bbls 22,084.0 Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Craig Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/24/2022 Report #: 1 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Clear WC -7° Temperature (°F) 12.2 Wind NE @ 16 MPH Days LTI (days) 46.00 Days RI (days) 46.00 POB 75.0 Daily Summary Operations 24h Forecast Continue to run in hole with 5” drill pipe from 8860’ to 12,555’. Work down and latch LEM into RAM hanger collet, confirm latch. Set SLZXP, test annulus to 1500 psi for 30 minutes, chart. Pull up and displace OBM with 9.4 PPG brine. Pull out of hole laying down 5” drill pipe. 24h Summary Pull out of hole laying down 4 ½” drill pipe to pipe shed from 10,863’ to 3100’. Pull out of hole with 5” drill pipe from 3100’ to surface, laying down running tool. Make up LEM, SLZXP and UBHO sub, run in hole on 5” drill pipe to 8860’. Operation at 07.00 Displacing well with 9.4 ppg KCL/NaCl brine with biocide. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 07:30 7.50 7.50 COMP E 4 P Continue to pull out of hole laying down 4 ½” drill pipe to pipe shed from 10,863’ to 3100’. Rig up super sucker and vacuum wiper dart through drill pipe to clean. 07:30 10:00 2.50 10.00 COMP E 4 P Change Elevators to 5” drill pipe. Drop 2.87” drift down string. Change dies on iron rough neck for 5” drill pipe. Pull out of hole with 5” drill pipe from 3100’ to surface. 10:00 13:00 3.00 13.00 COMP E 5 P Lay down liner running tool assembly, use GBR to brake one connection. Clean and clear floor of equipment. 13:00 15:30 2.50 15.50 COMP K 20 P PJSM, Change out die blocks on top drive grabber to 5” drill pipe. Change out Delta 425 saver sub to TT525. Change out bell guide for 5” drill pipe. 15:30 17:00 1.50 17.00 DRILL K 4 P PJSM, make up LEM, SLZXP and UBHO sub. Run in hole to 96’. 17:00 00:00 7.00 24.00 DRILL K 4 P Run in hole with SLZXP and LEM assembly on 5” drill pipe from 96’ to 8860’, at 60 ft/min, drifting 5” drill pipe out of derrick with 2.4” drift. PU=145 K, SO=110 K. 24 Hour mud loss to hole (9.4 ppg) 0 bbls. Total mud loss to hole 5314 bbls Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/25/2022 Report #: 2 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Scattered Clouds WC -10° Temperature (°F) 6.3 Wind N @ 13 MPH Days LTI (days) 47.00 Days RI (days) 47.00 POB 78.0 Daily Summary Operations 24h Forecast Continue to pull out of hole laying down 5” drill pipe to pipe shed from 6805’ to surface and lay down running tool. Rig up and test BOPE with 4 ½” pipe, witness waived by AOGCC rep Austin McCloud. Rig up for Completion. 24h Summary Run in hole with LEM, SLZXP and UBHO sub, on 5” drill pipe from 8860’ to 12,555’ MD. Work down and latch LEM into RAM hanger collet, confirm latch. Set SLZXP, top at 12,518.35’ MD. Test annulus to 1500 psi for 30 minutes, good test. Displace OBM with 9.4 PPG brine. Pull out of hole laying down 5” drill pipe from 12,409’ to 6805’ MD. Operation at 07.00 Laying down LEM / SLZXP running tool BHA. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 04:30 4.50 4.50 DRILL K 4 P Run in hole with SLZXP and LEM assembly on 5” drill pipe from 8860’ to 12,502’, at 60 ft/min, drifting 5” drill pipe out of derrick with 2.4” drift. PU=170 K, SO=112 K. 04:30 05:00 0.50 5.00 DRILL K 19 P PU=170 k, SO=112 k. Slack off from 12,502’ to 12,582’ MD, tag up with LEM. Slack off 30 k to engage LEM, pick up to 170 K, LEM did not latch. Set back down 40 k to engage LEM. Pick back up to 10 k over up weight and verify latch. Pick up 20 k over and back down and a third pull up with 30 k overpull and reconfirm LEM had latched. Come back down to down weight at 112 k. 05:00 06:00 1.00 6.00 DRILL K 9 P Drop 1” ball and pump at 6 BPM at 1030 psi. Slowing pumps down to 2.9 BPM at 390 psi at 1700 stokes. Ball on seat at 1940 strokes. Bring up pressure to 3000 psi and hold. Pressure up to 4000 psi and hold, set down 40 k. Packer set and Pusher tool neutralized. Bleed off pressure. Pull up to down weight of 112 k and pull up 1’, to ensure packer is released from running tool. Top of packer at 12,518.35’. 06:00 07:00 1.00 7.00 DRILL K 12 P Rig up and test packer and casing to 1500 psi for 30 minutes, good test. Bleed off pressure, open rams. Staging pressure up to 5400 psi on drill pipe to blow ball seat. Pull out of hole from 12,518’ to 12,409’ MD and rack back stand. 07:00 08:00 1.00 8.00 DRILL K 8 P Blow down choke and kill lines. Prepare for displacement. 08:00 11:00 3.00 11.00 DRILL K 9 P Displace 9.4 ppg OBM with 9.4 ppg brine. Pump 35 bbls of LVT through all 3 pumps followed by 40 bbl hi-vis sweep at 4 bpm at 360 psi. Continue to displace well to 9.4 ppg brine ICP 7.1 BPM at 760 psi, FCP 5 bpm at 300 psi. 11:00 16:00 5.00 16.00 DRILL K 20 P PJSM, clean off drillers side steam table, wash OBM from rig floor. Clean out under rotary table. 16:00 19:00 3.00 19.00 DRILL K 25 P PJSM, slip and cut 127' of drilling line. Continue cleaning OBM from pits. Service top drive, blocks and calibrate blocks and hook load. Inspect brakes. 19:00 00:00 5.00 24.00 DRILL K 4 P PJSM, pull out of hole laying down 5”drill pipe to pipe shed from 12,409’ to 8805’, PU=154 k 24 Hour mud loss to hole 0 bbls. Total mud losses to hole 5314 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Viktor Torres Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Tyler Gochenauer Doyon Drilling HSE tgochenauer@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/26/2022 Report #: 3 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC -8° Temperature (°F) 9.5 Wind NE @ 16 MPH Days LTI (days) 48.00 Days RI (days) 48.00 POB 87.0 Daily Summary Operations 24h Forecast Run ESP cable over sheaves in derrick. Spot Halliburton slick line unit. Pull up out of hole from 86’ and make up ESP cable and cap tube and test. Run in hole with tubing to 209’. Rig up wire line and install slick line retrievable motor and seal assemblies. Continue to run in hole with completion from 209’, testing ESP cable every 1000’. 24h Summary Pull out of hole laying down 5” drill pipe from to 6805’ to surface and lay down running tool. Rig up and test BOPE with 4 ½” pipe, witness waived by AOGCC rep Austin McCloud. Rig up for Completion. Run in hole with AccessESP permanent completion assemblies to 86’ for through tubing completion. NOTE: Safety Awareness Meeting, Line of Fire. Operation at 07.00 Running ESP cable over sheave in derrick. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 08:00 8.00 8.00 DRILL K 4 P PJSM, pull out of hole laying down 5” TT525 drill pipe to pipe shed from 6805’ to surface. Lay down running tool. Lay down BHA and clear floor. 08:00 08:30 0.50 8.50 DRILL K 20 P Line of fire safety awareness meeting with Milan video conference. 08:30 09:00 0.50 9.00 DRILL K 1 P Flush stack with washing sub. 09:00 09:30 0.50 9.50 DRILL C 5 P Pull wear ring and install test plug. 09:30 15:30 6.00 15.50 DRILL C 12 P Rig up to test BOPE. Perform shell test, good. Test BOPE 250/3500 psi with 4 ½” test joint. Test PVT system and alarms. Perform accumulator draw down test. Test all H2S and gas alarms, all test good. Witness waived by AOGCC rep Austin McLeod. 15:30 16:30 1.00 16.50 DRILL K 20 P Pull test plug. Rig down test equipment. Blow down surface equipment. 16:30 19:00 2.50 19.00 DRILL K 1 P PJSM, mobilize completion equipment to rig floor. 19:00 20:30 1.50 20.50 DRILL K 5 P PJSM, hang ESP and capillary sheaves from derrick board. 20:30 22:00 1.50 22.00 DRILL K 5 P Rig up GBR power tongs for torque turn. Spot and position spooling unit and connect power from rig. Make up X-O’s to safety valves. Load spools in spooler. 22:00 00:00 2.00 24.00 DRILL K 5 P PJSM, Adjust tec line spooler on rig floor. Make up 1, 2, and # 3 AccessESP permanent assemblies and run in hole to 86’. Pull cap tube over sheave. 24 Hour mud loss to hole 0 bbls. Total losses to the hole 5314 bbls. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/27/2022 Report #: 4 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC -13° Temperature (°F) 5.4 Wind NE @ 16 MPH Days LTI (days) 49.00 Days RI (days) 49.00 POB 84.0 Daily Summary Operations 24h Forecast Finish servicing seal assemblies. Set motor and seal assemblies with slick line. Make up intake-gas separator and lower pump and middle pump, run in hole with Retrievable run #2 and set. Make up upper pump assembly set with slick line. Make up tubing packoff assembly, set and pressure test. Make up tubing stop installation and set, Rig down slick line. Continue to run completion, drifting every connection. 24h Summary Run ESP cable over sheaves and pull sheave into derrick. Spot Halliburton slick line unit. Pull up out of hole from 86’ and make up ESP cable and cap tube and test, good test. Conduct Safety stand down with all parties involved with ESP cable run. Run in hole with tubing to 204’. Set through tubing motor assembly into tubing. Make up dual seal assemblies and service. Operation at 07.00 Working on ESP motor assembly. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 06:00 6.00 6.00 DRILL K 5 P Attempt to run ESP cable over sheave in derrick and back down to rig floor without success. Take sheave down out of derrick to in front of spooling unit. Install ESP cable with connector through sheave and pull sheave with ESP cable back into derrick and rehang. 06:00 09:00 3.00 9.00 DRILL K 12 P Conduct capillary tube pressure test to 1000 psi for 10 minutes. Good test. Pressure up to 2000 psi for 10 minutes, good. Pressure up to 3950 psi and check valve open for pass through pressure. Pump through for 5 minute. Pressure stabilized at 2250 psi after stopping pump. Simops: hook up ESP cable to ACP unibody. 09:00 10:00 1.00 10.00 DRILL K 12 P Test ESP cable connection with dielectric fluid to 1000 psi for 1 minute, bleed off pressure and wait 30 minutes to let connection re-seat internally. 10:00 10:30 0.50 10.50 DRILL K 20 P Conduct Safety stand down with all parties involved with ESP cable run. Discuss possible electric feedback from ESP pump and how to mitigate the potential hazards. Including Well control methods. 10:30 12:00 1.50 12.00 DRILL K 4 P Make up motor pump assembly tubing and run in hole from 86’ to 117’ MD. 12:00 15:00 3.00 15.00 DRILL K 20 P Add weight bar on drift cable, unsuccessful. Cut flutes on drift and add weight bars to allow drift to drop through connections after connections are torqued. 15:00 20:30 5.50 20.50 DRILL K 4 P Make up joint #2 and discharge gauge mandrel run in hole from 117’ to 176’. Install C-6 gauge and attach tec line. Rig up tec line and sheave. Test and run in hole with panel tester. Bad reading, trouble shoot and found tester bad. Install joint #3 and run in hole from 176’ to 204’. 20:30 22:00 1.50 22.00 DRILL K 5 P PJSM, Rig up Halliburton wireline. 22:00 00:00 2.00 24.00 DRILL K 5 P Set through tubing motor assembly into tubing, check rotation. Pick up lower tandem seal assembly and change out O-rings. Bolt on top of motor assembly and service as per Baker Centrilift. 24 Hour mud loss to hole 10 bbls Total losses to hole 5324 bbls Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Drilling Engineer Alex Vaughan ASRC Energy Services Drilling Engineer Alex.Vaughan@external.eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/28/2022 Report #: 5 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC -17° Temperature (°F) 5.0 Wind NE @ 23 MPH Days LTI (days) 50.00 Days RI (days) 50.00 POB 88.0 Daily Summary Operations 24h Forecast Set motor and seal assemblies with slick line, Make up intake-gas separator and lower pump and middle pump, run in hole with Retrievable run #2 and set. Make up upper pump assembly set with slick line. Make up tubing packoff assembly, set and pressure test. Make up tubing stop installation run in and set. Rig down slickline. Continue to run 4 ½” tubing with ESP completion drifting every connection. 24h Summary Finish servicing seal assemblies. Run in tubing in attempt to set motor assembly in permanent assembly tag 12’ high at 197’. Pull out of tubing. Inspect motor assembly. Run in tubing with motor assembly to 197’. Pull up to 500 LBS over pull, tool did not move. Shear off motor assembly and pull out of tubing with slick line. Install 1.75” oil jars on slick line, run in tubing and latch on and pull free with oil jars. Inspect and service motor assembly, run in hole with motor assembly to 197’, tag 12’ high, over pull. Attempt to pull motor assembly free, wire parted. Free motor assembly. Pull out of tubing with motor assembly. Operation at 07.00 Installing RCA assembly #2. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 01:00 1.00 1.00 DRILL K 15 P Run in hole with motor assemble on sick line, tag 12’ high at 197’. Pull out of hole with wire line to 32’ exposing seals and examine motor assembly. Found no evidence of tight hole or signs of sticking when inspecting. 01:00 04:00 3.00 4.00 DRILL K 15 P Run in hole with motor assembly on wire line to 197’. Tool hung up in permanent completion with bottom at 197’. Pull up to 500 LBS over pull, tool did not move. Stroking spanks with upstroke by hand in attempt to free tool, no success. Shear off GS and pull out of hole leaving motor assembly in hole. Install 1.75” oil jars on slick line. Run in hole and latch on to motor assembly. 8 strokes of oil jars and motor assembly came free. 04:00 07:00 3.00 7.00 DRILL K 15 P Pull out of hole. Unbolt seal assembly and lay down. Pull motor out of tubing. Setting mechanism had deployed and electrical plug board had activated spring release. 07:00 07:30 0.50 7.50 DRILL K 15 P Run in hole with 3.75” drift on slick line to 207’ wire line depth. Pull out of hole. 07:30 10:00 2.50 10.00 DRILL K 15 P Lower motor into tubing. Install seal assembly on top of motor. Service dual seal assembly. 10:00 10:30 0.50 10.50 DRILL K 15 P Run in hole with motor assembly to 197’, tag 12’ high. Attempt to pull, pull 500 lbs over pull. Attempt to free tool with spanks, no success. Shear off GS connector and pull out of hole leaving motor assembly. 10:30 12:00 1.50 12.00 DRILL K 15 U Install 1.75” oil jars on slick line. Run in hole and latch back up on motor assembly. Attempt to pull motor assembly free, wire parted. 12:00 14:30 2.50 14.50 DRILL K 15 U Make up rope socket on slick line wire, make up rope socket to connect slick line together. Raise top drive to 90’, leaving slack in slick line. Take slack out of slick line with unit. Prepare to shear GS, GS already sheared. Pull out of hole with GS and oil jar assembly. 14:30 21:30 7.00 21.50 DRILL K 15 U String off slick line and make cut. Make up slick line tool string with weight bars accelerator and oil jars with GS. Run in tubing with slick line and latch on to motor assembly. Stroking oil jars, shearing off GS an leave motor assembly in tubing every 45 minute to pull out of hole and cut 40-80’ of slick line wire. Motor assembly came free after 6th trip jarring. Pull out of hole with motor assembly. 21:30 22:00 0.50 22.00 DRILL K 15 U Pull out of tubing with motor assembly. 22:00 22:30 0.50 22.50 DRILL K 15 P Redress slick line tools and run in tubing with 3.8” gauge ring to 179’ to seal bore of 3.78” ID, wire line depth. 22:30 00:00 1.50 24.00 DRILL K 15 P Redress motor, inspect motor for signs of wedging in hole. Run 3.805” gauge ring down motor and seal assembly. Observe slight scratches down motor and washer between motor and lower seal slightly dented. 24 Hour mud loss to hole 60 bbls Total losses to hole 5384 bbls Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Drilling Engineer Alex Vaughan ASRC Energy Services Drilling Engineer Alex.Vaughan@external.eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/29/2022 Report #: 6 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC -4° Temperature (°F) 10.4 Wind NE @ 12 MPH Days LTI (days) 51.00 Days RI (days) 51.00 POB 87.0 Daily Summary Operations 24h Forecast Finish troubleshooting electrical reading inconsistent. Continue to run 4 ½” tubing completion from 1971’, drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. 24h Summary Inspect retrievable completion assembly, Replace motor and seal assembly connection bolts, washers and dress off protruding welds on Motor. Run retrievable assemblies in tubing. Pressure test pack off, good. Install tubing stop. Rig down slick line unit. Run in hole with 4 ½” 12.6 #, L-80, HYD 563 retrievable ESP completion from 209’ to 1971’. Troubleshoot Elec readings inconsistent, Phase to phase. Making electrical checks every 1000’, continue to monitor cap tube pressure. Operation at 07.00 At 3107' MD. electrical readings to ESP motor not with in parameters, MOB Halliburton slickline to rig. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 03:00 3.00 3.00 DRILL K 15 P Run 3.805” OD gauge ring over dual seal assembly and across bolted section to motor. OD gauge would not pass, catching on 2 washers. Replace bolts and washers. Re-run 3.805” OD gauge over seals and motor, good. Dress off 2 perimeter welds with file on motor. Re-measure all OD’s with calipers assure all were within tolerances of permanent completion assembly. 03:00 06:00 3.00 6.00 DRILL K 15 P Rig up and latch slick line GS onto Motor assembly. Test slick line load cell, purge line and retest good. Run in hole with motor assembly to 209’ and tag no-go to deploy plug alignment arm. DW=850 lbs, UW= 1175 LBS. Pick up to align plug board, continue pick up and observe second over pull, good. Slack off and check electrical. Tap down with spanks and shear off with GS pull slick line out of hole. Re-test continuity to all phases to confirm motor assembly had successfully plugged into wet connection, good. Perform and record all data. 06:00 09:00 3.00 9.00 DRILL K 15 P Mobilize ESP completion equipment to rig floor. Rig down slick line sheave in derrick. Set aside Slick line tools. Hang and prep GBR power tongs. 09:00 11:00 2.00 11.00 DRILL K 4 P Pull up and replace 4.5” tubing joint #3, replace with joint of same length 31.51’. Pick up GBR power tongs and rig up. 11:00 12:30 1.50 12.50 DRILL K 15 P Make up and install retrievable completion assembly. Check rotation, good. Run in hole with slickline. Make up and run in hole with packoff assembly. Run in hole with slickline and jar down 15 times. Pull out of hole with slickline. 12:30 13:00 0.50 13.00 DRILL K 15 P Pressure test ESP pack off to 1200 psi for 10 minutes, charted, good test. 13:00 14:30 1.50 14.50 DRILL K 15 P Run in hole with tubing stop on slick line and set. Pull out of hole with slick line and rig down slick line. 14:30 23:00 8.50 23.00 DRILL K 4 P PJSM, run in hole with 4 ½” 12.6 #, L-80, HYD 563 TK-15XT tubing & retrievable ESP completion from 209’ to 1971’. Drifting every joint after make up with torque turn, testing discharge gauge tec wire and ESP cable every 1000’, keeping pressure on capillary tube. 23:00 00:00 1.00 24.00 DRILL K 20 U Test ESP cable and troubleshoot inconsistent readings, on phase to phase. 24 Hour mud loss to hole 43 bbls Total losses to hole 5429 bbls Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 4/30/2022 Report #: 7 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Clear WC -7° Temperature (°F) 9.5 Wind E @ 15 MPH Days LTI (days) 52.00 Days RI (days) 52.00 POB 87.0 Daily Summary Operations 24h Forecast Pull out of tubing the Retrievable ESP assemblies with wireline. Trouble shoot grounding issue and rerun assemblies into permanent completion. Continue to run 4 ½” tubing completion, drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. 24h Summary Finish troubleshooting electrical reading inconsistent. Continue to run 4 ½” tubing completion from 1971’ to 3107’, drifting every connection. Making electrical checks every 500’, continue to monitor cap tube pressure. Electrical reading fell below standard levels. Mobilize wireline crew. Spot slick line unit. Run in tubing with slick line to retrievable ESP assemblies. Pull pipe stop. Attempt to pull pack-off. Operation at 07.00 Retrieving ESP pump assembly. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 01:00 1.00 1.00 DRILL K 20 U Test ESP cable and troubleshoot inconsistent readings, on phase to phase. Good readings. 01:00 04:30 3.50 4.50 DRILL K 4 P Continue to run 4 ½” tubing completion from 1971’ to 3,107 ’, drifting every connection. Make electrical checks at 2500’ and 3107’, While continue to monitor cap tube pressure. 04:30 05:00 0.50 5.00 DRILL K 25 TD03 Stop running in hole. Test electrical, Electrical readings below standard levels. Mobilizing slick line crew. Rig down and set GBR power tongs out of the way. 05:00 09:00 4.00 9.00 DRILL K 20 U Mobilize wireline crew. Spot slick line unit. 09:00 11:30 2.50 11.50 DRILL K 15 U Rig up with slick line. Run in tubing and latch on to Tubing stop at 2972’ wire line length. Pull out of hole and lay down tubing stop. 11:30 13:00 1.50 13.00 DRILL K 15 U Make up and run in tubing with equalizing prong on slick line, tag pack off at 3007’ wire line measurement. Then slack off to 3012’ to equalize pressure on pack-off. Pull out of hole to surface. 13:00 17:30 4.50 17.50 DRILL K 15 U Run in tubing with GS and engage pack off at 2990’ WLM. Slick line was able to jar pack-off up hole to 2979’, GS sheared . Pull out of hole to surface. 17:30 18:30 1.00 18.50 DRILL K 15 U Rig down tools and cut 100’ of slick line. Test slick line, 23 twists, good test. Reattach rope socket, redress oil jars. 18:30 20:00 1.50 20.00 DRILL K 15 U Make up Prong, 3.46” OD centralizer, stem, 3.7” OD centralizer and run in with slick line to 2993’. Set down with prong to equilize pressure, 4 times. Pull out of hole. 20:00 21:00 1.00 21.00 DRILL K 15 U Run in hole with GS to 2990’. Engage pack-off. Slack off 3’, weight steady, Pick up with no overpull, slick line parted. Slick line wire was cut and twist tested and has good wire on previous trip. 21:00 00:00 3.00 24.00 DRILL K 15 U Mobilize T-bar and double male. Spool off slick line spool and retest line, good. Inspect and flush fluid and purge any air from load cell. Secure slick line wire. 24 Hour mud loss to hole 47 bbls Total losses to hole 5476 bbls Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 5/1/2022 Report #: 8 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC 0° Temperature (°F) 13.1 Wind N @ 10 MPH Days LTI (days) 53.00 Days RI (days) 53.00 POB 87.0 Daily Summary Operations 24h Forecast Prepare and pressure test pack-off. Run in tubing and set pipe stop. Pull out of tubing with slick line and rig down slick line and lay down all equipment. Continue to run 4 ½” tubing completion from 3108’, drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. 24h Summary Pull slick line out of tubing with slick line. Lay down slick line tools and restring with fresh wire from spool. Run in tubing and equalize pack-off and pull pack-off out of tubing. Make 3 runs to pull out of hole with retrievable ESP assemblies. Inspect motor assembly and dis-assemble and test motor to diagnose electrical issue of low readings from phase to ground. Pick up and run in with back up motor and same seal assembly to 3097’, Test electrical, all readings above standards. Pick up middle and tandem pumps, make up gas separator and intake run in tubing and set. Pick up and run in with tandem pump assembly and set. Run in and set pack-off, pull out of tubing with slick line. Prepare to pressure test pack-off. Operation at 07.00 Running in hole with 4 1/2" ESP completion at 3647' MD. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 01:30 1.50 1.50 DRILL K 15 U Install rope socket on both parts of slickline and connect. Pulled up with slick line and found packoff still attached to line. Shear off with and GS. Remove rope socket and tie loose end of slick line into second spool on wire line unit. 01:30 03:00 1.50 3.00 DRILL K 15 U Pull out of hole with slick line and GS to surface. Lay down slick line tools and restring with fresh wire from spool. 03:00 05:00 2.00 5.00 DRILL K 15 U Run in tubing with GS on slick line to 2979’ and latch on to pack-off, Jar loose pack-off loose pull up 5’, up weight increased. Stop and lower slick line to 100 LBS over up weight, allow pack –off to relax for 15 minutes. Pull up and jar 2 times and able to move pack-off with 400 lbs over pull. Pull out of hole and lay down pack-off. 05:00 07:00 2.00 7.00 DRILL K 15 U Run in tubing with GS on slick line and latch onto tandem pump section at 3012’. Pull to surface and lay down. 07:00 09:00 2.00 9.00 DRILL K 15 U Run in tubing to 3038’ WLM and latch onto middle and lower tandem pumps, gas separator and intake. Pull out of hole and lay down. 09:00 10:30 1.50 10.50 DRILL K 15 U Run in tubing with GS and latch onto seal and motor assembly at 3073’. Pull out of pipe and disconnect seal assembly and set in mouse hole. Lay down motor assembly to pipe shed. 10:30 12:00 1.50 12.00 DRILL K 15 U Inspect motor assembly and dis-assemble and test motor to diagnose electrical issue of low readings from phase to ground. 12:00 17:00 5.00 17.00 DRILL K 1 U AccessESP prepare spare motor for installation. Change out motor head adapter to seal assembly. Check rotation. Make up upper and lower tandem seals and service with oil. Run OD gauge ring over motor and seal assembly. 17:00 19:30 2.50 19.50 DRILL K 15 P Run in tubing with retrievable motor assembly on slick line to 3097’ tag no-go and deploy plug arm. Pick up orienting and come to second over pull, slack off and tap down. Pretest electrical, reading fluctuating, tap down several times. Test electrical, all readings above standards. Pull out of hole with slick line and GS. 19:30 21:30 2.00 21.50 DRILL K 15 P Check rotation on middle and tandem pumps, make up gas separator and intake. Run in tubing on slick line and engage seal assembly at 3041’. Tap down to assist seating and shear off. Pull out of tubing with slick line and GS. 21:30 23:30 2.00 23.50 DRILL K 15 P Change out tandem pump seals. Check rotation, good. Run in tubing on slick line and engage to top of middle pump. Shear out and pull out of hole with slick line and GS. 23:30 00:00 0.50 24.00 DRILL K 15 P Run in tubing with ESP pack off and set at 3014’. Pull out of hole. 24 Hour mud loss to hole 121 bbls Total losses to hole 5597 bbls Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 5/2/2022 Report #: 9 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC 7° Temperature (°F) 17.6 Wind SW @ 8 MPH Days LTI (days) 54.00 Days RI (days) 54.00 POB 87.0 Daily Summary Operations 24h Forecast Continue to run 4 ½” tubing completion as per program to setting depth. Make up tubing hanger, penetrator and cap tube pass through, test electrical. Drain and rinse stack. Run in hole and land out tubing hanger. Drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. Rig down GBR equipment. Perform flow check for 30 minutes. Install BPV, and nipple down BOP stack. Prepare to nipple up tree. 24h Summary Prepare and pressure test pack-off. Run in tubing and set pipe stop. Pull out of tubing with slick line, rig down slick line and lay down all equipment. Continue to run 4 ½” tubing with AccessESP through tubing retrievable completion from 3128’ to 7595’, drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. Operation at 07.00 Running in the hole with 4 1/2" ESP completion string at 8979' MD Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 01:30 1.50 1.50 DRILL K 15 P Rig up and attempt to test pack off. Pressure up to 400 psi and pressure bled off. Test fail. 01:30 02:00 0.50 2.00 DRILL K 15 P Rig up adding one more weight bar and run in tubing with slick line to 3014’. Hammer down on top of pack-off slacking off at higher rate. Spank down on pack off 30 times. Pull out of hole. 02:00 02:30 0.50 2.50 DRILL K 12 P Rig up and test pack-off to 1200 psi for 10 minutes, charted. Good test. Rig down test equipment. 02:30 04:00 1.50 4.00 DRILL K 15 P Run in tubing with tubing stop and set on top of the pack off. Pull out of hole. Rig down Slick line. 04:00 12:00 8.00 12.00 DRILL K 4 P Continue to run 4 ½” 12.6# L-80 Hyd 563 TK-15XT tubing with AccessESP through tubing retrievable completion from 3128’ to 4350’ MD, drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. SOW=85K. 12:00 00:00 12.00 24.00 DRILL K 4 P Continue to run 4 ½” 12.6# L-80 Hyd 563 TK-15XT tubing with AccessESP through tubing retrievable completion from 4350’ to 7595’ MD, drifting every connection. Making electrical checks every 1000’, continue to monitor cap tube pressure. SOW=85K. Note: Max gas =0 Back ground gas = 0 24 Hour mud loss to hole 22 bbls. Total losses to the hole = 5619 BBLS. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mike Grubb ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Mitch Billington ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Pat Ahern ASRC Energy Services HSE Patrick.Ahern@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Harold Richardson Doyon Drilling HSE hrichardson@doyondrilling.com 907-685-0796 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 5/3/2022 Report #: 10 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Overcast WC 8° Temperature (°F) 15.4 Wind WSW @ 6 MPH Days LTI (days) 55.00 Days RI (days) 55.00 POB 85.0 Daily Summary Operations 24h Forecast Complete rig down of equipment and sheaves from derrick and nipple down BOP and nipple up tree. Perform passport test. 24h Summary PJSM – Run in hole with Access ESP through tubing completion form 7,595’ to 11,778’ on 4-1/2” (12.6#L-80 Hydril 563 TK-15XT Internally coated tubing), GBR toque turn connection and a 3.833” drift after make up. Test Tec wire and ESP cable every 1,000’. Held 1000 psi. on capillary while running tubing. Pick-up hanger and make-up Fast Swivel make final PTF connector and pass through hanger with capillary and Tec line and Baker Centrilift tested pep procedure. Blow down choke and kill line. Land tubing hanger@ 11,835’. Operation at 07.00 Nipple down BOPs. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 16:30 16.50 16.50 COMP K 4 P PJSM - Continue to run 4 ½” tubing (12.6# L-80 Hydril 563 TK-15XT Internally coated tubing), with Access ESP through tubing retrievable completion from 7,595’ to 11,778’, GBR torque turn all connection and 3.833" drifted every connection. Making electrical checks every 1000’ and continue to monitor 1000 psi on capillary line pressure. Dn wt. 75K. 16:30 17:30 1.00 17.50 COMP K 5 P PJSM - Pick-up landing joint and make-up to hanger with Halliburton Fast Swivel assembly. GBR torque to 4,780 ft.-lbs. check the gap after make-up was .02 mm. 17:30 23:00 5.50 23.00 COMP K 5 P PJSM – Access ESP performed final slice for PFT connector and Vault and Bake Centrilift dress hanger with capillary and Tec lines, Vault tested hanger voids to 5000 psi. for 5 mins. Centrilift performed TEC line gauge reads (goods). Tested Capillary line to 1000 psi for 10 mins. Continue pressure up to 4020 psi, observed no leaks on lines and continue pump through line for 5 mins., shut down and observed pressure fall-off to 1893 psi. Bled off line. 23:00 23:30 0.50 23.50 COMP K 1 P PJSM – blow down choke, kill lines and hole fill line. 23:30 00:00 0.50 24.00 COMP C 5 P Land hanger, verified by Vault rep. End of tubing string at 11,835' Up wt. -135K / Dn wt. 78K. Access Final Readings: P-P+14.5 Ohm Balanced AG= 2.05 Gohm BG= 2.66 Gohm CG= 3.58 Gohm Baker Discharge Pressure Gauge Readings: Pt - 1959.25 PSI Pa - 1960.11 PSI Tt - 81.9° F Ta - 82.6° F VX - 0.0 G Vz - 0.0 G Vt - 19.6 V Note: Max gas =0 Back ground gas = 0 24 Hour mud loss to hole 66 bbls. Total losses to the hole = 5685 BBLS. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 Well Name: SP03-NE2 L2 Wellbore Name: SP03-NE2 L2 Well Code: 33736 Job: COMPLETION WCEI: LEVEL 3 Daily Report Date: 5/4/2022 Report #: 11 Page: 1 of 1 Well Header Permit/Concession N° 40206177 - ADL-388583 Operator ENI US OPERATING CO.INC. Subsidiary ENI Petroleum Co. Inc. Initial Lahee Code Rotary Table Elevation (ft) 53.61 Ground Level (ft) 13.10 First Flange (ft) 16.71 RKB - Base Flange (ft) 36.90 RKB - Tubing Spool (ft) 31.30 Rig Information Rig Name RIG 15 Contractor DOYON Rig Type LAND RIG Rig Num 0723 Daily Information Weather Oveercast WC 11° Temperature (°F) 19.4 Wind NW @ 6 MPH Days LTI (days) 56.00 Days RI (days) 56.00 POB 80.0 Daily Summary Operations 24h Forecast Complete Expro flow back checklist. Baker Centrilift and AccessESP to terminate TEC line at wellhead and control panel and complete checklist for flow back. Perform flow back of SP03-NE2 L2 with Expro. Moving reports to Doyon 15 Cold Stack. 24h Summary Vault rep. screwed in lock down pins and tested hanger void to 5000 psi for 10 mins. AccessESP performed final ESP cable and gauge readings with the umbilical, (all good). Rig down Baker Centrilift, Access ESP and GBR equipment and sheaves from derrick. Nipple down BOP, terminate capillary and TEC lines through wellhead. Nipple-up tree and test voids to 5000 psi for 10 mins. Perform passport test as per Vault rep. AccessESP perform electrical check after passport testing. Perform walk down with Expro and working on pre-flow back checklist paper work. Baker Centrilift and AccessESP prep to flow back. Operation at 07.00 Waiting on Production / Expro to perform well clean up operations. Moving reports to Doyon 15 Cold Stack. Time Log Start Time End Time Dur (hr) Cum Dur (hr)Phase Opr. Act. Plan Oper. Descr. 00:00 01:00 1.00 1.00 COMP C 5 P PJSM - Vault rep. screwed in lock down pins and test hanger void to 5000 psi for 10 mins; back out landing joint and lay down. AccessESP performed final ESP cable and gauge readings with the umbilical, (all good). 01:00 02:00 1.00 2.00 COMP M 5 P PJSM - Pull AccessESP flat cable and capillary line back over sheaves to spooling house, remove sheaves from derrick. Remove AccessESP, Baker Centrilift and GBR equipment and components from rig floor. Remove Tec line spooler from rig floor. Flow check well for 30 min, well on vac. 02:00 10:30 8.50 10.50 COMP C 5 P PJSM – Nipple down BOP stack – remove choke and kill valves and hoses, set back stack and pull riser. 10:30 12:00 1.50 12.00 COMP C 5 P PJSM – Clean and inspect tubing hanger, terminate capillary and Tec lines through wellhead. Nipple-up tree and test tubing hanger neck void to 5000 psi. for 10 mins. 12:00 16:00 4.00 16.00 COMP C 12 P PJSM – Perform passport test as per Vault rep, (chart recorded). Good Test. 16:00 16:30 0.50 16.50 COMP M 12 P PJSM – Production tested Expro flow back line to 900 psi. 16:30 23:00 6.50 23.00 COMP M 1 P Expro performing pre-flow back checklist on equipment and components. Function tested line heater for high temperature shut down and ESD at production test header (good test). Perform and walk down with on Expro flow back equipment and tank farm, all lines are hooked up and confirmed they are clear, all valves in working order, centrifuge operational, bump tested for proper rotation. Note: AccessESP electrical readings after passport test: Phase to phase 14.06 G ohms - Balanced Phase A to ground 2.05 G ohms Phase B to ground 2.95 G ohms Phase C to ground 2.92 G ohms Intake pressure = 1873 psi. Intake temperature = 84.6° F Motor temperature = 86.9° F VX = 0.011 G VZ= 0.011 G VT= 120.4 volts Current= 9.9 mA 23:00 00:00 1.00 24.00 COMP M 9 P Production freeze protecting SP03-NE2 A annulus with 115 bbls diesel. Continued with Expro pre-flow back checklist. Moving reports to Doyon 15 Cold Stack. Daily Contacts Position Contact Name Company Title Email Office Mobile Eni representative Bruce Simonson ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative David Smith ASRC Energy Services Drilling Supv. siddrilling@eni.com 907-685-0715 Eni representative Bob Smejkal ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Eni representative Larry Theriot ASRC Energy Services Rig Clerk AKRigClerksDoyon15@eni.com 907-685-0722 Safety Representative Mark Hubler ASRC Energy Services HSE mark.hubler@external.eni.com 907-685-0721 Tool Push Ryan Pankratz Doyon Drilling Tool Pusher rig15@doyondrilling.com 907-685-0716 Tool Push Andrew Yochum Doyon Drilling Tour Pusher rig15@doyondrilling.com 907-685-0716 Safety Representative Dave Sena Doyon Drilling HSE dsena@doyondrilling.com 907-685-0796 Safety Representative Derek Ambrose Doyon Drilling HSE rig15@doyondrilling.com 907-685-0796 Last Casing Seat Cas. Type OD (in) ID (in) Grade Top (ftKB) Bottom (ftKB) TVD Bot. (ftKB) Landing Date LINER 5 1/2 4.95 L-80 12,555.0 22,052.0 4,039.4 4/23/2022 631(/6XUYH\*HRGHWLF5HSRUW'HI6XUYH\&RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH57( 1$ *ULG6FDOH)DFWRU9HUVLRQ3DWFK:HOO+HDG/RFDO&RRUG5HIHUHQFHG7R0DJQHWLF'HFOLQDWLRQ'HFOLQDWLRQ'DWH0DJQHWLF'HFOLQDWLRQ0RGHO1 : 7RUW$+''',(5'5DWLR&56*ULG&RQYHUJHQFH$QJOH$SULO/RFDWLRQ/DW/RQJ1IW86(IW86$3,631(/6WUXFWXUH6ORW:HOO%RUHKROH631(6S\,VODQG63/RFDWLRQ*ULG1(<;1$'$ODVND6WDWH3ODQH=RQH86)HHWIW&RRUGLQDWH5HIHUHQFH6\VWHP6XUYH\1DPH631(/6XUYH\'DWHIWDERYH06/79'5HIHUHQFH(OHYDWLRQ*URXQG(OHYDWLRQIWDERYH06/)LHOG5HSRUW'DWH$ODVND1LNDLWFKXT&OLHQW(QL3HWUROHXP$SULO300LQLPXP&XUYDWXUH/XELQVNL7UXH1RUWKIWIW5RWDU\7DEOH6XUYH\'/6&RPSXWDWLRQ79'5HIHUHQFH'DWXP9HUWLFDO6HFWLRQ$]LPXWK9HUWLFDO6HFWLRQ2ULJLQ7RWDO*UDYLW\)LHOG6WUHQJWKPJQ%DVHG7RWDO&RUU0DJ1RUWK!7UXH1RUWK*UDYLW\0RGHOQ7'2;7RWDO0DJQHWLF)LHOG6WUHQJWK0DJQHWLF'LS$QJOH1RUWK5HIHUHQFH0DUFK+'*07UXH1RUWK*ULG&RQYHUJHQFH8VHG'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 7LH,Q6XUYH\ 7RS:KLSVWRFN TOP OA 12807.0085.58 322.64 4042.72 4096.32 10685.65 10957.16 10832.27 10459.40-2817.64 4.95 6064121.81 508889.4070.58640951 -149.92698649 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW$+'IW&ORVXUHIW16IW(:IW'/6IW1RUWKLQJIW86(DVWLQJIW86/DWLWXGH/RQJLWXGH 3DUW0')URPIW0'7RIW(28)UHTIW+ROH6L]HLQ&DVLQJ'LDPHWHULQ $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 6/%B*:' 631(3%631(3%'HVFULSWLRQ6XUYH\7RRO7\SH %RUHKROH6XUYH\6XUYH\(UURU0RGHO,6&:6$5HY '&RQILGHQFHVLJPD6XUYH\3URJUDP6/%B0:'*0$* 631(631(6/%B0:'*0$* 631(/631(/6/%B0:'*0$* 631(3%631(3%6/%B0:'*0$* 631(3+631(3+6/%B%/,1'75(1' 631(/631(//HJDO'HVFULSWLRQ1RUWKLQJ< (DVWLQJ;6/%B0:',1&B21/<B),//(5 631(/631(/6/%B'8$/*0$*6$* 631(/631(/%+/)6/)(/6715(80 6XUIDFH)6/)(/6715(80 7RS2$)6/)(/6715(80 'ULOOLQJ2IILFH $ODVND1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/ 303DJHRI Eni US Operating Co, Inc WELL LOG/DATA TRANSMITTAL To: ůĂƐŬĂKŝůĂŶĚ'ĂƐŽŶƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶ 333 W. 7th Ave, Anchorage, AK 99501 May 27, 2022 Well:SP03-NE2 L2 LWD/MWD Logs PDF LAS DLIS Excel Drilling Mechanics Depth x x Drilling_Mechanics Time x x ScopeService RM x 2" & 5" ScopeServices RM MD X X 2" & 5" ScopeServices RM TVD X X ASP Final Survey X Mudlogs 2" & 5" MD Formation Evaluation Log X X 2" & 5" MD Drilling Evaluation Log X X 2" & 5" MD Gas Ratio Log X X E-line logs 9-5/8" Radial Cement Bond Log X X 9-5/8" Multi Finger Caliper X X PLEASE ACKNOWLEDGE RECEIPT BY SIGNING AND RETURNING A COPY OF THE TRANSMITTAL LETTER TO THE ATTENTION OF: Joshua Zuber Mail: joshua.zuber@eni.com Received By: ___________________________________Date:____________ Eni US Operating Co, Inc. PTD:222-015 T36669 Kayla Junke Digitally signed by Kayla Junke Date: 2022.05.27 10:26:31 -08'00' CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. From:Rig 15 To:Regg, James B (OGC);Brooks, Phoebe L (OGC);DOA AOGCC Prudhoe Bay Subject:Doyon 15 4-26-22 Date:Wednesday, April 27, 2022 2:35:09 PM Attachments:Doyon 15 4-26-22.xlsx Ryan Pankratz Rig 15 Toolpusher 907-685-0716 office 1LNDLWFKXT631(/ 37' STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* SSu b m i tt t o :jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Owner/Contractor: Rig No.:15 DATE: 4/26/22 Rig Rep.: Rig Phone: 685-0716 Operator: Op. Phone:685-0715 Rep.: E-Mail Well Name: PTD #22220150 Sundry # Operation: Drilling: X Workover: Explor.: Test: Initial: Weekly: Bi-Weekly: X Other: Rams:250/3500 Annular:250-3500 Valves:250/3500 MASP:1380 MISC. INSPECTIONS: TEST DATA FLOOR SAFETY VALVES: Test Result Test Result Quantity Test Result Location Gen.P Well Sign P Upper Kelly 1P Housekeeping P Rig P Lower Kelly 1P PTD On Location P Hazard Sec.P Ball Type 2P Standing Order Posted P Misc.NA Inside BOP 2P FSV Misc 0NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0NATrip Tank PP Annular Preventer 1 13.625 5K P Pit Level Indicators PP #1 Rams 1 4-1/2" X 7"P Flow Indicator PP #2 Rams 1 Blind Shear 5K P Meth Gas Detector PP #3 Rams 1 3-1/2" x 6"P H2S Gas Detector PP #4 Rams 0NAMS Misc 0NA #5 Rams 0NA #6 Rams 0NA Quantity Test Result Choke Ln. Valves 2 3.125 5K P Inside Reel valves 0NA HCR Valves 4 3.125 5K P Kill Line Valves 2 3.125 5K P Check Valve 0NAACCUMULATOR SYSTEM: BOP Misc 0 NA Time/Pressure Test Result System Pressure (psi)3000 P CHOKE MANIFOLD:Pressure After Closure (psi)2150 P Quantity Test Result 200 psi Attained (sec)11 P No. Valves 15 P Full Pressure Attained (sec)45 P Manual Chokes 1P Blind Switch Covers: All stations Yes Hydraulic Chokes 1P Nitgn. Bottles # & psi (Avg.): 10 @ 4100 P CH Misc 0NA ACC Misc 0NA Test Results Number of Failures:0 Test Time:4.5 Hours Repair or replacement of equipment will be made within days. Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 4/24/22 12:08PM Waived By Test Start Date/Time:4/26/2022 11:00 (date) (time)Witness Test Finish Date/Time:4/26/2022 15:30:00 PM BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Austin McLeod Doyon Tested with 4.5" test joint. Tested 1 ea. 4.5" Delta 425 FOSV, 1 ea. 4.5" Delta 425 Dart valve, 1 ea. TT 525 FOSV, 1 ea. TT 525 Dart. All tests from primary remote station. Performed draw down on Super choke and Manual choke to 2000 psi. PANKRATZ / YOCHUM ENI PETROLEUM SIMONSON/ GRUBB Nikaitchuq SP03-NE2L2 Test Pressure (psi): rig15@doyondrilling.com Form 10-424 (Revised 02/2022) 2022-0426_BOP_Doyon15_Nikaitchuq_SP03-NE2L2 9 9 9 9 9 9 9 9 9 9 - 5HJJ 4/26/22 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov Stefano Pierfelici Well Operations Project Manager Eni US Operating Co. Inc. 3700 Centerpoint Drive Suite 500 Anchorage, AK 99503 Re: Nikaitchuq Field, Schrader Bluff Oil Pool, SP03-NE2 L2 Eni US Operating Co. Inc. Permit to Drill Number: 222-015 Surface Location: 4486.0’FSL, 1186.3’FEL, Sec. 19, T14N, R9E, UM Bottomhole Location: 404’FSL, 131’FEL, Sec. 35, T15N, R8E, UM Dear Mr. Pierfelici: Enclosed is the approved application for the permit to drill the above referenced well. The permit is for a new wellbore segment of existing well Permit 219-089, API 50-629-23639-00- 00. Production should continue to be reported as a function of the original API number stated above. Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071,composite curves for well logs run must be submitted to the AOGCC within 90 days after completion, suspension or abandonment of this well. This permit to drill does not exempt you from obtaining additional permits or an approval required by law from other governmental agencies and does not authorize conducting drilling operations until all other required permits and approvals have been issued. In addition, the AOGCC reserves the right to withdraw the permit in the event it was erroneously issued. Operations must be conducted in accordance with AS 31.05 and Title 20, Chapter 25 of the Alaska Administrative Code unless the AOGCC specifically authorizes a variance. Failure to comply with an applicable provision of AS 31.05, Title 20, Chapter 25 of the Alaska Administrative Code, or an AOGCC order, or the terms and conditions of this permit may result in the revocation or suspension of the permit. Sincerely, Jeremy M. Price Chair DATED this ___ day of February, 2022. Jeremy Price Digitally signed by Jeremy Price Date: 2022.02.14 15:46:42 -09'00' D7\SHRI:RUNE3URSRVHG:HOO&ODVV ([SORUDWRU\*DV 6HUYLFH:$* 6HUYLFH'LVS F6SHFLI\LIZHOOLVSURSRVHGIRU 'ULOO /DWHUDO 6WUDWLJUDSKLF7HVW 'HYHORSPHQW2LO 6HUYLFH:LQM 6LQJOH=RQH &RDOEHG*DV *DV+\GUDWHV 5HGULOO 5HHQWU\ ([SORUDWRU\2LO 'HYHORSPHQW*DV 6HUYLFH6XSSO\ 0XOWLSOH=RQH *HRWKHUPDO 6KDOH*DV 2SHUDWRU1DPH%RQG %ODQNHW 6LQJOH:HOO :HOO1DPHDQG1XPEHU %RQG1R $GGUHVV3URSRVHG'HSWK )LHOG3RROV 0'79' D/RFDWLRQRI:HOO*RYHUQPHQWDO6HFWLRQ3URSHUW\'HVLJQDWLRQ 6XUIDFH 7RSRI3URGXFWLYH+RUL]RQ'15$SSURYDO1XPEHU $SSUR[LPDWH6SXG'DWH 7RWDO'HSWK $FUHVLQ3URSHUW\ 'LVWDQFHWR1HDUHVW3URSHUW\ E/RFDWLRQRI:HOO6WDWH%DVH3ODQH&RRUGLQDWHV1$'.%(OHYDWLRQDERYH06/IW 'LVWDQFHWR1HDUHVW:HOO2SHQ 6XUIDFH[\=RQH WR6DPH3RRO IURP63 'HYLDWHGZHOOV.LFNRIIGHSWK IHHW 0D[LPXP3RWHQWLDO3UHVVXUHVLQSVLJVHH$$& 0D[LPXP+ROH$QJOH GHJUHHV 'RZQKROH 6XUIDFH +ROH &DVLQJ :HLJKW *UDGH &RXSOLQJ /HQJWK 0' 79' 0' 79' / +\G 35(6(17:(//&21',7,216800$5<7REHFRPSOHWHGIRU5HGULOODQG5H(QWU\2SHUDWLRQV -XQNPHDVXUHG 1$ 79' +\GUDXOLF)UDFWXUHSODQQHG"<HV 1R $WWDFKPHQWV3URSHUW\3ODW %236NHWFK 'ULOOLQJ3URJUDP 7LPHY'HSWK3ORW 6KDOORZ+D]DUG$QDO\VLV 'LYHUWHU6NHWFK 6HDEHG5HSRUW 'ULOOLQJ)OXLG3URJUDP $$&UHTXLUHPHQWV &RQWDFW1DPH &RQWDFW(PDLO &RQWDFW3KRQH 'DWH 3HUPLWWR'ULOO $3,1XPEHU 3HUPLW$SSURYDO 1XPEHU'DWH &RQGLWLRQVRIDSSURYDO ,IER[LVFKHFNHGZHOOPD\QRWEHXVHGWRH[SORUHIRUWHVWRUSURGXFHFRDOEHGPHWKDQHJDVK\GUDWHVRUJDVFRQWDLQHGLQVKDOHV 6DPSOHVUHT G<HV1R 0XGORJUHT G<HV1R +6PHDVXUHV<HV1R 'LUHFWLRQDOVY\UHT G<HV1R 6SDFLQJH[FHSWLRQUHT G<HV1R ,QFOLQDWLRQRQO\VY\UHT G<HV1R 3RVWLQLWLDOLQMHFWLRQ0,7UHT G<HV1R $33529('%< $SSURYHGE\ &200,66,21(5 7+(&200,66,21 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ /HDGEEOVSSJ 7DLOEEOVSSJ (IIHFW'HSWK0'IW(IIHFW'HSWK79'IW &HPHQW9ROXPH 0'6L]H 3OXJVPHDVXUHG 6XUIDFH 3HUIRUDWLRQ'HSWK79'IW */%)(OHYDWLRQDERYH06/IW 3HUIRUDWLRQ'HSWK0'IW 1$ ,QWHUPHGLDWH /HQJWK&DVLQJ $XWKRUL]HG6LJQDWXUH VORWWHGOLQHULQRSHQKROH 3URGXFWLRQ /LQHU $XWKRUL]HG1DPH6WHIDQR3LHUIHOLFL :HOO2SHUDWLRQV3URMHFW0DQDJHU &RQGXFWRU6WUXFWXUDO 1$ /HDGEEOSSJ 7DLOEEOVSSJ ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEH GHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO $XWKRUL]HG7LWOH LQFOXGLQJVWDJHGDWD 6ORWWHG/LQHULQRSHQKROH &DVLQJ3URJUDP7RS6HWWLQJ'HSWK%RWWRP6SHFLILFDWLRQV 7RWDO'HSWK0'IW7RWDO'HSWK79'IW 685 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 3(50,772'5,// $$& )6/)(/715(80 )6/)(/715(80 $'/ &HQWHUSRLQW'ULYH6XLWH$QFKRUDJH (QL862SHUDWLQJ&R,QF )6/)(/6715(80 $'/ 631(/ 1LNDLWFKXT6FKUDGHUEOXII $PMDG&KDXGKU\ DPMDGFKDXGKU\#HQLFRP &HPHQW4XDQWLW\FIRUVDFNV &RPPLVVLRQ8VH2QO\ 6HHFRYHUOHWWHUIRURWKHU UHTXLUHPHQWV V1 \SHRI: / O 5 / E 6 &ODVV RV1 V1R V1 R 'V V V ' R ZHOOLVS * 6 6 66 6 V1RV1R 6 * \( 6 V1R V )RUP5HYLVHG7KLVSHUPLWLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDOSHU$$&J By Samantha Carlisle at 7:15 am, Feb 08, 2022 'LJLWDOO\VLJQHGE\6WHIDQR3LHUIHOLFL'1&1 6WHIDQR3LHUIHOLFL& $''DWH 6WHIDQR3LHUIHOLF L ; ;; ; %-0 1$ $OO ODWHUDOV PXVW EH GHSLFWHG RQ WKH ILQDO ZHOOERUH GLDJUDP VXEPLWWHG ZLWK WKH ;; %23 WHVW WR SVL '/% '65 ; '/% dts 2/14/2022 JLC 2/14/2022 2/14/22 Jeremy Price Digitally signed by Jeremy Price Date: 2022.02.14 15:46:24 -09'00' &HQWHUSRLQW'ULYH6XLWH $QFKRUDJH$ODVND 6WHIDQR3LHUIHOLFL 3KRQH (PDLO6WHIDQRSLHUIHOLFL#HQLFRP )HEUXDU\ $ODVND2LODQG*DV&RQVHUYDWLRQ&RPPLVVLRQ :HVWWK$YHQXH6XLWH $QFKRUDJH$ODVND 5( $SSOLFDWLRQIRU3HUPLWWR'ULOO3URGXFHU631(/ 'HDU&RPPLVVLRQHUV (QL862SHUDWLQJ&R,QFKHUHE\DSSOLHVIRUD3HUPLWWR'ULOO6LGHWUDFNLQJ([LVWLQJ:HOO631(IRU WKH2IIVKRUH3URGXFHUZHOO631(/7KLVZHOOZLOOEHGULOOHGVLGHWUDFNHGDQGFRPSOHWHGXVLQJWKHULJ 'R\RQ 7KHSODQQHGVSXGGDWHFRXOGEHDVHDUO\DV 3OHDVHILQGDWWDFKHGIRUWKHUHYLHZRIWKH&RPPLVVLRQIRUPVWKHLQIRUPDWLRQUHTXLUHGE\$&& ,I\RXKDYHDQ\TXHVWLRQVRUUHTXLUHIXUWKHULQIRUPDWLRQSOHDVHFRQWDFW$PMDG&KDXGKU\DW 6LQFHUHO\ 6WHIDQR3LHUIHOLFL :HOO2SHUDWLRQV3URMHFW0DQDJHU 'LJLWDOO\VLJQHGE\6WHIDQR3LHUIHOLFL '1&1 6WHIDQR3LHUIHOLFL& $' 'DWH 6WHIDQR 3LHUIHOLF L $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 1 of 7 Printed: 7-Feb-22 $SSOLFDWLRQIRU3HUPLWWR'ULOO'RFXPHQW 3URGXFHU:HOO631(/ 7DEOHRI&RQWHQWV :HOO1DPH 5HTXLUHPHQWVRI$$&I ........................................................................................................ 3 /RFDWLRQ6XPPDU\ 5HTXLUHPHQWVRI$$&F .................................................................................................... 3 3OHDVHVHH$WWDFKPHQW6XUIDFH3ODWW .................................................................................................. 3 5HTXLUHPHQWVRI$$&E......................................................................................................... 3 %ORZRXW3UHYHQWLRQ(TXLSPHQW,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F .................................................................................................... 4 'ULOOLQJ+D]DUGV,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F ................................................................................................... 4 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV 5HTXLUHPHQWVRI$$&F ................................................................................................... 4 &DVLQJDQG&HPHQWLQJ3URJUDP 5HTXLUHPHQWVRI$$&F .................................................................................................... 5 'LYHUWHU6\VWHP,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F....................................................................................................5 'ULOOLQJ)OXLG3URJUDP 5HTXLUHPHQWVRI$$&F .................................................................................................... 6 $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F ................................................................................................... 6 6HLVPLF$QDO\VLV 5HTXLUHPHQWVRI$$&F ................................................................................................. 6 6HDEHG&RQGLWLRQ$QDO\VLV 5HTXLUHPHQWVRI$$&F ................................................................................................. 6 $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 2 of 7 Printed: 7-Feb-22 (YLGHQFHRI%RQGLQJ 5HTXLUHPHQWVRI$$&F ................................................................................................. 6 3URSRVHG'ULOOLQJ3URJUDP 5HTXLUHPHQWVRI$$&F ................................................................................................. 7 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO 5HTXLUHPHQWVRI$$&F ................................................................................................. 7 $WWDFKPHQWV $WWDFKPHQW'ULOOLQJ3URFHGXUH ............................................................................................................. 7 $WWDFKPHQW'LUHFWLRQDO3ODQ ................................................................................................................. 7 $WWDFKPHQW'ULOOLQJ+D]DUGV6XPPDU\................................................................................................. 7 $WWDFKPHQW%23&RQILJXUDWLRQ............................................................................................................. 7 $WWDFKPHQW)RUPDWLRQ,QWHJULW\$QG/HDN2II7HVW3URFHGXUH ............................................................ 7 $WWDFKPHQW6XUIDFH3ODWW...................................................................................................................... 7 $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 3 of 7 Printed: 7-Feb-22 :HOO1DPH 5HTXLUHPHQWVRI$$&I (DFKZHOOPXVWEHLGHQWLILHGE\DXQLTXHQDPHGHVLJQDWHGE\WKHRSHUDWRUDQGDXQLTXH$3,QXPEHUDVVLJQHGE\WKHFRPPLVVLRQ XQGHU$$&E)RUDZHOOZLWKPXOWLSOHZHOOEUDQFKHVHDFKEUDQFKPXVWVLPLODUO\EHLGHQWLILHGE\DXQLTXHQDPHDQG$3, QXPEHUE\DGGLQJDVXIIL[WRWKHQDPHGHVLJQDWHGIRUWKHZHOOE\WKHRSHUDWRUDQGWRWKHQXPEHUDVVLJQHGWRWKHZHOOE\WKH FRPPLVVLRQ :HOO1DPH631(/ /RFDWLRQ6XPPDU\ 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DSODWLGHQWLI\LQJWKHSURSHUW\DQGWKHSURSHUW\ VRZQHUVDQGVKRZLQJ $WKHFRRUGLQDWHVRIWKHSURSRVHGORFDWLRQRIWKHZHOODWWKHVXUIDFHDWWKHWRSRIHDFKREMHFWLYHIRUPDWLRQDQGDWWRWDOGHSWK UHIHUHQFHGWRJRYHUQPHQWDOVHFWLRQOLQHV %WKHFRRUGLQDWHVRIWKHSURSRVHGORFDWLRQRIWKHZHOODWWKHVXUIDFHUHIHUHQFHGWRWKHVWDWHSODQHFRRUGLQDWHV\VWHPIRUWKLV VWDWHDVPDLQWDLQHGE\WKH1DWLRQDO*HRGHWLF6XUYH\LQWKH1DWLRQDO2FHDQLFDQG$WPRVSKHULF$GPLQLVWUDWLRQ &WKHSURSRVHGGHSWKRIWKHZHOODWWKHWRSRIHDFKREMHFWLYHIRUPDWLRQDQGDWWRWDOGHSWK /RFDWLRQDW6XUIDFH)6/)(/6715(80 $63=RQH1$'&RRUGLQDWHV 1RUWKLQJ (DVWLQJ 5.%(OHYDWLRQ¶IHHW¶$06/ 3DG(OHYDWLRQ¶IHHW¶$06/ /RFDWLRQDW7RSRI 3URGXFWLYH,QWHUYDO ³2$´6DQG )6/)(/715(80 $63=RQH1$'&RRUGLQDWHV 1RUWKLQJ (DVWLQJ 0HDVXUHG'HSWK5.% 7RWDO9HUWLFDO'HSWK5.%¶ 7RWDO9HUWLFDO'HSWK66¶ /RFDWLRQDW7RWDO'HSWK)6/)(/715(80 $63=RQH1$'&RRUGLQDWHV 1RUWKLQJ(DVWLQJ 0HDVXUHG'HSWK5.%¶ 7RWDO9HUWLFDO'HSWK5.%¶ 7RWDO9HUWLFDO'HSWK66¶ 3OHDVHVHH$WWDFKPHQW6XUIDFH3ODWW DQG 'RWKHULQIRUPDWLRQUHTXLUHGE\$$&E 5HTXLUHPHQWVRI$$&E ,IDZHOOLVWREHLQWHQWLRQDOO\GHYLDWHGWKHDSSOLFDWLRQIRUD3HUPLWWR'ULOO)RUPPXVW LQFOXGHDSODWGUDZQWRDVXLWDEOHVFDOHVKRZLQJWKHSDWKRIWKHSURSRVHGZHOOERUHLQFOXGLQJDOODGMDFHQWZHOOERUHVZLWKLQ IHHWRIDQ\SRUWLRQRIWKHSURSRVHGZHOO 3OHDVHVHH$WWDFKPHQW'LUHFWLRQDO3ODQ $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 4 of 7 Printed: 7-Feb-22 DQG IRUDOOZHOOVZLWKLQIHHWRIWKHSURSRVHGZHOOERUH $OLVWWKHQDPHVRIWKHRSHUDWRUVRIWKRVHZHOOVWRWKHH[WHQWWKDWWKRVHQDPHVDUHNQRZQRUGLVFRYHUDEOHLQSXEOLFUHFRUGV DQGVKRZWKDWHDFKQDPHGRSHUDWRUKDVEHHQIXUQLVKHGDFRS\RIWKHDSSOLFDWLRQE\FHUWLILHGPDLORU %VWDWHWKDWWKHDSSOLFDQWLVWKHRQO\DIIHFWHGRZQHU 7KH$SSOLFDQWLVWKHRQO\DIIHFWHGRZQHU %ORZRXW3UHYHQWLRQ(TXLSPHQW,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DGLDJUDPDQGGHVFULSWLRQRIWKHEORZRXWSUHYHQWLRQHTXLSPHQW%23(DVUHTXLUHGE\$$&$$&RU $$&DVDSSOLFDEOH 3OHDVHVHH$WWDFKPHQW%23DQG'LYHUWHU&RQILJXUDWLRQ 'ULOOLQJ+D]DUGV,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ LQIRUPDWLRQRQGULOOLQJKD]DUGVLQFOXGLQJ $WKHPD[LPXPGRZQKROHSUHVVXUHWKDWPD\EHHQFRXQWHUHGFULWHULDXVHGWRGHWHUPLQHLWDQGPD[LPXPSRWHQWLDOVXUIDFH SUHVVXUHEDVHGRQDPHWKDQHJUDGLHQW 7KHH[SHFWHGUHVHUYRLUSUHVVXUHLQWKH6FKUDGHU%OXIIVDQGLVSVLIWRUSSJ(0:HTXLYDOHQW PXGZHLJKW 7KHPD[LPXPSRWHQWLDOVXUIDFHSUHVVXUH0363EDVHGRQWKHDERYHPD[LPXPSUHVVXUHJUDGLHQWD PHWKDQHJUDGLHQWDQGWKHSODQQHGYHUWLFDOGHSWKRIWKH2$VDQGIRUPDWLRQLV 0363 ¶79'VVSVLIW SVL %GDWDRQSRWHQWLDOJDV]RQHV 7KHZHOOERUHLVQRWH[SHFWHGWRSHQHWUDWHDQ\JDV]RQHV DQG &GDWDFRQFHUQLQJSRWHQWLDOFDXVHVRIKROHSUREOHPVVXFKDVDEQRUPDOO\JHRSUHVVXUHGVWUDWDORVWFLUFXODWLRQ]RQHVDQG]RQHV WKDWKDYHDSURSHQVLW\IRUGLIIHUHQWLDOVWLFNLQJ 3OHDVHVHH$WWDFKPHQW'ULOOLQJ+D]DUGV6XPPDU\ 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DGHVFULSWLRQRIWKHSURFHGXUHIRUFRQGXFWLQJIRUPDWLRQLQWHJULW\WHVWVDVUHTXLUHGXQGHU$$&I 3OHDVHVHH$WWDFKPHQW)RUPDWLRQ,QWHJULW\DQG/HDNRII7HVW3URFHGXUH PXGZHLJKW 7KHH[SHFWHGUHVHUYRLUSUHVVXUHLQWKH6FKUDGHU%OXIIVDQGLVSVLIWRUSSJ(0:HTXLYDOHQWS '/% $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 5 of 7 Printed: 7-Feb-22 &DVLQJDQG&HPHQWLQJ3URJUDP 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DFRPSOHWHSURSRVHGFDVLQJDQGFHPHQWLQJSURJUDPDVUHTXLUHGE\$$&DQGDGHVFULSWLRQRIDQ\VORWWHGOLQHUSUH SHUIRUDWHGOLQHURUVFUHHQWREHLQVWDOOHG &DVLQJDQG&HPHQWLQJ3URJUDP 6HHDOVR$WWDFKPHQW&HPHQW6XPPDU\ &VJ7EJ 2'LQ +ROH 6L]H LQ :HLJKW OEIW *UDGH &RQQHFWLRQ /HQJWK IW 7RS 0'79' IW %WP 0'79' IW &HPHQW3URJUDP 'ULYHQ;:HOGHG¶¶3UH,QVWDOOHG /%7&¶¶¶,QSODFH&RPSOHWHG /+\GULO¶¶ ¶,QSODFH&RPSOHWHG 2$ 6DQG /DWHUDO /+\GULO¶ ¶ ¶ ¶/LQHULQ2SHQ+ROHQRFHPHQW 'LYHUWHU6\VWHP,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DGLDJUDPDQGGHVFULSWLRQRIWKHGLYHUWHUV\VWHPDVUHTXLUHGE\$$&XQOHVVWKLVUHTXLUHPHQWLVZDLYHGE\WKH FRPPLVVLRQXQGHU$$&K 3OHDVHVHH$WWDFKPHQW%23DQG'LYHUWHU&RQILJXUDWLRQ $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 6 of 7 Printed: 7-Feb-22 'ULOOLQJ)OXLG3URJUDP 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DGULOOLQJIOXLGSURJUDPLQFOXGLQJDGLDJUDPDQGGHVFULSWLRQRIWKHGULOOLQJIOXLGV\VWHPDVUHTXLUHGE\$$& 'ULOOLQJZLOOEHGRQHZLWKPXGVKDYLQJWKHIROORZLQJSURSHUWLHVRYHUWKHOLVWHGLQWHUYDOV )OXLGGHVFULSWLRQ0,)D]H3UR0LQHUDO2LO%DV9DOXH 'HQVLW\SSJ± 3ODVWLF9LVFRVWL\&3 <LHOG3RLQWOEVI +7+3)OXLGORVVPOPLQ#SVL ) 2LO:DWHU5DWLR (OHFWULFDO6WDELOLW\! 'ULOOLQJIOXLGSUDFWLFHVZLOOEHLQDFFRUGDQFHZLWKDSSURSULDWHUHJXODWLRQVVWDWHGLQ$$& $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ IRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOODWDEXODWLRQVHWWLQJRXWWKHGHSWKVRISUHGLFWHGDEQRUPDOO\JHRSUHVVXUHGVWUDWDDV UHTXLUHGE\$$&I 1RWDSSOLFDEOH$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HLVPLF$QDO\VLV 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ IRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOODVHLVPLFUHIUDFWLRQRUUHIOHFWLRQDQDO\VLVDVUHTXLUHGE\$$&D 1RWDSSOLFDEOH$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HDEHG&RQGLWLRQ$QDO\VLV 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ IRUDZHOOGULOOHGIURPDQRIIVKRUHSODWIRUPPRELOHERWWRPIRXQGHGVWUXFWXUHMDFNXSULJRUIORDWLQJGULOOLQJYHVVHODQDQDO\VLV RIVHDEHGFRQGLWLRQVDVUHTXLUHGE\$$&E 1RWDSSOLFDEOH$SSOLFDWLRQLVQRWIRUDQRIIVKRUHZHOO (YLGHQFHRI%RQGLQJ 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ HYLGHQFHVKRZLQJWKDWWKHUHTXLUHPHQWVRI$$&^%RQGLQJ`KDYHEHHQPHW (YLGHQFHRIERQGLQJIRU(1,LVRQILOHZLWKWKH&RPPLVVLRQ ± SSJ '/% 'HQVLW\SSJ 0LQLPXP (0: QHHGHG $SSOLFDWLRQIRU3HUPLWWR'ULOO 631(/ 6DYHG)HE AOGCC PERMIT Document rev1 Page 7 of 7 Printed: 7-Feb-22 3URSRVHG'ULOOLQJ3URJUDP 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ 3OHDVHUHIHUDOVRWR$WWDFKPHQW±'ULOOLQJ3URFHGXUH 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO 5HTXLUHPHQWVRI$$&F $QDSSOLFDWLRQIRUD3HUPLWWR'ULOOPXVWEHDFFRPSDQLHGE\HDFKRIWKHIROORZLQJLWHPVH[FHSWIRUDQLWHPDOUHDG\RQILOHZLWKWKH FRPPLVVLRQDQGLGHQWLILHGLQWKHDSSOLFDWLRQ DJHQHUDOGHVFULSWLRQRIKRZWKHRSHUDWRUSODQVWRGLVSRVHRIGULOOLQJPXGDQGFXWWLQJVDQGDVWDWHPHQWRIZKHWKHUWKH RSHUDWRULQWHQGVWRUHTXHVWDXWKRUL]DWLRQXQGHU$$&IRUDQDQQXODUGLVSRVDORSHUDWLRQLQWKHZHOO :DVWHIOXLGVJHQHUDWHGGXULQJWKHGULOOLQJSURFHVVZLOOEHGLVSRVHGRIE\LQMHFWLRQGRZQDQ2OLNWRN3RLQW RU6S\,VODQG&ODVV,GLVSRVDOZHOO$OWHUQDWLYHGLVSRVDOPHWKRGZLOOLQFOXGHKDXOLQJWKHIOXLGVWRWKH 3UXGKRH%D\*ULQGDQG,QMHFW)DFLOLW\ $WWDFKPHQWV $WWDFKPHQW'ULOOLQJ3URFHGXUH $WWDFKPHQW'LUHFWLRQDO3ODQ $WWDFKPHQW'ULOOLQJ+D]DUGV6XPPDU\ $WWDFKPHQW%23&RQILJXUDWLRQ $WWDFKPHQW)RUPDWLRQ,QWHJULW\$QG/HDN2II7HVW3URFHGXUH $WWDFKPHQW6XUIDFH3ODWW WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 'ULOOLQJ 3URFHGXUH 631(/ 6S\,VODQG &RQGXFWRUVORW 5HVHUYRLUORFDWLRQ1(/ 3URGXFHU6FKUDGHU%OXII 1LNDLWFKXT3URMHFW WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI +2/( &$6,1* 08',1)2 0' 79' 6,=( 63(&6 ,1)2 &HPHQWWR6XUIDFH ; &RQGXFWRU6KRH :HOGHG 6XUIDFH&VJ :HOOERUH6WDELOLW\ %3HUPDIURVW /%7& /RVW&LUFXODWLRQ +ROH&OHDQLQJ &DVLQJ6HFWLRQV .23 &DVLQJ:HDU 6XUIDFH77DLO&HPHQW 'HJ R) ,QWHU&DVLQJ :HOOERUH6WDELOLW\ /RVW&LUFXODWLRQ +ROH&OHDQLQJ /+\GULO7RUTXH 'UDJ &DVLQJ6HFWLRQV 7DQJHQW$QJOH&DVLQJ:HDU 'HJ %+$([SHQVH ,QWHUPHGLDWH72& 3LFNXS7RSRI6DQG 17RS ,QWHUPHGLDWH77DLO&HPHQW 72/ 'HJ %DVHRI:KLSVWRFN R) :HOOERUH6WDELOLW\ /RVW&LUFXODWLRQ 6ORWWHG/LQHU+ROH&OHDQLQJ 7RUTXH 'UDJ &DVLQJ6HFWLRQV /+\GULO &DVLQJ:HDU %+$([SHQVH 'HJ R)SSJ02%0 0:SSJ :%0 0:SSJ :%0 1$ 0:SSJ *55(63:' 6S\,VODQG 1LNDLWFKXT)LHOG 1RUWK6ORSH$ODVND631(/ ',5/:')250 '(37+ 0:' 'LU3:' 0XG0RWRU +ROH$QJOH R *55HV 'ULYHQ SSJ'HHS&5(7(6FKUDGHU%OXII/DWHUDO*55(6 (FRVFRSH3HUL6&23( +ROH$QJOH '/6SSJ'HHS&UHWH+ROH$QJOH ([FHHG ;FHHG +ROH$QJOH /LQHUVKRH SSJ'HHS&UHWH WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 7DEOHRI&RQWHQWV :(//3/$16800$5< :(//+,6725< 5,+:+,3672&.$1'´0,//,1*23(5$7,216 352'8&7,216(&7,21 3URGXFWLRQ'ULOOLQJ 3URGXFWLRQ/LQHU 5,+(63&RPSOHWLRQ 5HFRPPHQGHG'ULOOLQJ3UDFWLFHV +HDOWK6DIHW\ (QYLURQPHQW 6DIHW\0HHWLQJ7RSLFV :HOO6KXW,Q3URFHGXUH:KLOH5XQQLQJ3URGXFWLRQ7XELQJ :(//3/$16800$5< 5LJ'R\RQ WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 7\SHRI:HOO3URGXFHU :HOO'HVLJQ´6XUIDFH[´,QWHUPHGLDWH[´/LQHU &ORVH$SSURDFKDQG2IIVHW:HOO,QWHUFHSWLRQ5LVNV ,WLVLPSRUWDQWWRVWD\DVFORVHDVSUDFWLFDOWRWKHSODQQHGGLUHFWLRQDOSURJUDP7KHGLUHFWLRQDOSURJUDPDQGD VXPPDU\RIFORVHDSSURDFKHVFDQEHIRXQGLQWKHDWWDFKPHQWV7KHVHFORVHDSSURDFKHVZLOOEHLQ FRQIRUPDQFHZLWKWKHPLQLPXPZHOOVHSDUDWLRQFULWHULDGHWDLOHGE\WKH'ULOOLQJ$QWL&ROOLVLRQ$QDO\VLVDQG &ORVH$SSURDFK*XLGHOLQHV,WLVWKHUHVSRQVLELOLW\RIWKH'LUHFWLRQDO'ULOOHUDQGWKH'ULOOLQJ6XSHUYLVRUWR HQVXUHWKDWWKHGLUHFWLRQDOSODQLVH[HFXWHGDVSODQQHGWKDWWKHSRVLWLRQRIWKHZHOODVLWLVGULOOHGLVPRQLWRUHG RQDQDQWLFROOLVLRQGLDJUDPDQGWKDWQRWROHUDQFHOLQHIRUFORVHDSSURDFKZHOOVLVFURVVHG ,WLVLPSRUWDQWWKDWWKHZHOOERUHUHPDLQVFORVHWRWKHSODQQHGZHOOSDWKDVDQ\PDMRUGHYLDWLRQVIURPWKH SURILOHPD\DGYHUVHO\DIIHFWWKHDELOLW\WRGULOOIXWXUHZHOOVDQGVWLOODGKHUHWRWKHFXUUHQWFORVHFURVVLQJ JXLGHOLQHV 6XUYH\3URJUDP 3URFHGXUHV 7DNH0:'VXUYH\VDVIUHTXHQWO\DVQHHGHGEXWQROHVVWKDQHYHU\IW&DUHIXOO\UHYLHZWKHDQWLFLSDWHG FORVHFURVVLQJVZLWKH[LVWLQJZHOOERUHVDQGIXWXUHZHOOSDWKV0DNHVXUHWKDWGLUHFWLRQDOGULOOHUVDUHDZDUHRI DOOGULOOLQJFORVHFURVVLQJLVVXHVKDUGOLQHVDQGQRJROLQHV,IDQRJRRUKDUGOLQHKDVEHHQRUZLOOEH FURVVHGVWRSGULOOLQJLPPHGLDWHO\DQGFRQWDFWWKH'ULOOLQJ6XSHULQWHQGHQWWRGLVFXVVRSWLRQV 0XG/RJJLQJ3URJUDP 0XGORJJLQJZLOOEHXWLOL]HGIURPVSXGWRSURGXFWLRQKROH7'5HIHUWRWKH*HRORJLFDO0XG/RJJLQJ 3URFHGXUHGRFXPHQW 2%-(&7,9(6 0XGORJJLQJZLOOEHXWLOL]HGIURP VSXGWRSURGXFWLRQKROH7'5HIHUWRWKH*HRORJLFDO0XG/RJJLQJJJ J 3URFHGXUHGRFXPHQW WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI x3HUIRUPZRUNLQDVDIHDQGSURIHVVLRQDOPDQQHUPHHWLQJDOO(1,3HWUROHXP+HDOWK6DIHW\DQG (QYLURQPHQWDOUHTXLUHPHQWV'ULOOWKHZHOODWRUXQGHU$)(FRVWDQGWLPH x5HPRYHFXUUHQW(63FRPSOHWLRQDVVHPEO\([HFXWHWKHVHWWLQJDQGRULHQWDWLRQRIWKHZKLSVWRFN SHUWKHZHOOSODQ x&XWZLQGRZLQWKH´FDVLQJDQGGULOOQGODWHUDOSHUWKHZHOOSODQ0D[LPXPGRJOHJ VHYHULW\LQWKHODQGLQJVKDOOEHQRJUHDWHUWKDQ '/6 x7DUJHW*UHDWHUWKDQZLWKLQWKH2$VDQG5HVHUYRLU xKROH/:')DLOXUH5HTXLUHPHQWV*55HV'LU3:'±5HTXLUH*55HV'LUWRDFKLHYH7' WELL 631(/ 631(/ 'ULOOLQJ:HOOSODQ 3DJH RI :(//+,6725< &XUUHQW6WDWXV :HOO631(LVFXUUHQWO\6KXWGRZQ :HOO+LVWRU\ 631(LVDGXDOODWHUDOSURGXFHUZHOOZLWK(63OLIW7KHZHOOZDVFRPSOHWHGRQ6S\,VODQGRQ1RYHPEHU VWZLWKDFRQYHQWLRQDO(637KHZHOOZDVKDQGRYHUHGWR3URGXFWLRQ'HSDUWPHQWVKRUWO\WKHUHDIWHU 7KHZHOOKDVEHHQRSHUDWHGXQWLO-XQHUGZKHQLWORVWFDSDELOLW\WRSURGXFHWXELQJDWVXUIDFH,WZDV GHFLGHGWRSXOOWKH(63FRPSOHWLRQPHFKDQLFDOO\LVRODWHPDLQERUHRI631(DQGUHFRPSOHWHLWZLWK DQHZFRQYHQWLRQDO(63V\VWHP:RUNRYHURSHUDWLRQVZHUHVXFFHVVIXO$ZRUNRYHUZDVZHOOZDVRSHUDWHG XQWLO-XO\ ZKHQDJDLQLWORVWFDSDELOLW\WRSURGXFHIOXLGWRVXUIDFH5LJZDVPRYHGWRZHOODQG´ ZRUNVWULQJZDVXVHGWRFOHDQRXWVDQGSOXJLQVLGHRIWXELQJWRWKHWRSRIWKH(63DQGZHOOZDVKDQGHGRYHUWR SURGXFWLRQ6LQFH-XO\ZHOOLVVKXWLQ 6FRSHRI:RUN 6FRSHRIWKLVZRUNLV WRSXOORXWRIKROHH[LVWLQJ(63FRPSOHWLRQ5XQDZKLSVWRFNDVVHPEO\DQG GULOODQHZ ò ´ODWHUDOVHFWLRQ5,+DVHFRQGò´VORWWHGOLQHUDQGFRPSOHWHLW ZLWKDQHZ(63V\VWHPWRKDYHD FRPPLQJOHSURGXFWLRQIRUERWKODWHUDO *HQHUDO:HOOLQIR 5HVHUYRLU3UHVVXUH79' 7KLVZHOOLVH[SHFWHGWRKDYHDVWDWLFPD[ERWWRPKROHSUHVVXUHRI DSSUR[LPDWHO\ SVLGXULQJWKHGULOOLQJWLPH :HOOKHDGW\SHSUHVVXUHUDWLQJ 9DXOW0%SVL %23FRQILJXUDWLRQ $QQXODUSLSHEOLQGSLSH WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI '(&203/(7,216(&7,21 3URFHGXUH 0,58'R\RQ %XOOKHDGWXELQJDQGDQQXODUYROXPHRISSJEULQH 6HW%391'WUHHDQG18%23DQGWHVWWRSVL 322+DQGOD\GRZQ´WXELQJDQG(63DVVHPEO\ 5,+:+,3672&.$1'´0,//,1*23(5$7,216 G18%23DQGWHVWWRSVL WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 5,+ZLWKD'ULIWFOHDQRXW%+$WRWKHWRSRIWKHSUHYLRXVò´OLQHU 380/=;3/+DVVHPEO\DQGVWLQJLQWRWKH6/=;3 3RVLWLRQKDQJHU SDFNHUDWWKHGHVLUHGGHSWK8VH0:'WRUHFRUGRULHQWDWLRQRI0/=;3SURILOHDV WKLVLVFULWLFDOIRUIXWXUHXVH5HSHDWPXOWLSOHWLPHVXQWLODOOSDUWLHVDUHLQDJUHHPHQWRQ0/=;3 KDQJHURULHQWDWLRQ 322+DQG/'UXQQLQJWRRO 0LOODZLQGRZLQ´FDVLQJ 1RWHV D,WLVLPSRUWDQWWKDWWKHZKLSVWRFNDVVHPEO\EHVSDFHGRXWWRHQVXUHWKDWWKHHQWLUHZLQGRZLVPLOOHG EHWZHHQFDVLQJFROODUV E7KHDSSUR[LPDWHRYHUDOOOHQJWKRIWKHFDVLQJZLQGRZWREHPLOOHGLV¶¶IW F$OOPHDVXUHPHQWDQGSURFHGXUHVDUHWREHGRXEOHFKHFNHGDQGDSSURYHGE\&R0DQSULRUWRUXQQLQJ WKHZKLSVWRFNZLQGRZPLOOLQJDVVHPEO\LQWKHKROH G(QVXUHGULOOSLSHSXSMRLQWVDUHDYDLODEOHIRUWKHFRUUHFWVSDFHRXW H$IWHUWKHZLQGRZLVPLOOHGWKHXSSHUZDWHUPHORQPLOOVKRXOGEHJDXJHG,IWKHXSSHUZDWHUPHORQ PLOOLVPRUHWKDW´XQGHUJDXJHDFOHDQXSWULSLVUHFRPPHQGHGWRHQVXUHZLQGRZLVIXOO\RSHQ$ EDFNXSVHWRIPLOOVVKRXOGEHRQORFDWLRQ I'LWFKPDJQHWVVKRXOGEHSODFHGLQWKHIORZOLQHWRUHFRYHUDOOPHWDOFLUFXODWHGRXWRIWKHZHOO :KLSVWRFN:LQGRZ0LOOLQJ*XLGHOLQHV ¾&KHFNZLWK*HRORJLVWWRFRQILUPLIWKHUHLVDFRQFUHWLRQDWWKHZLQGRZPLOOLQJGHSWK ¾1HYHUURWDWHDELWRQWKHIDFHRIWKHZKLSVWRFN ¾2ULHQWWKH%+$LIPRWRULVXVHGDERYHWKHZLQGRZEHIRUHDWWHPSWLQJWRH[LWWKHZLQGRZ%LW URWDWLRQPD\³FDWFK´WKHHGJHRIWKHZKLSVWRFNDQGGDPDJHWKHIDFHPDNLQJUHFRYHU\RSHUDWLRQV PRUHGLIILFXOW ¾,IDWDQ\WLPHGXULQJRSHUDWLRQVDSUREOHPLVHQFRXQWHUHGWULSSLQJWKURXJKWKHZLQGRZDUHDD ZDWHUPHORQRUVWULQJPLOOVKRXOGEHUXQLQWKHGULOOLQJDVVHPEO\WRFOHDQXSWKHZLQGRZDUHD ¾$OZD\VWULSVORZO\DQGFDUHIXOO\VHFRQGVSHUVWDQGZLWKDOO%+$¶VWKURXJKWKHPLOOHG ZLQGRZ WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 3URFHGXUH 3ULRUWRPLOOWKHZLQGRZKROGD7HFK3ODQQLQJPHHWLQJWRGLVFXVVWKLVSKDVHRIWKHZHOO5HYLHZWKH ZHOOSODQDQGGLVFXVVDQ\GLVFUHSDQFLHVRUFRQFHUQVZLWKWKHGULOOLQJVXSHULQWHQGHQW 5,+WKHZKLSVWRFNDVVHPEO\ $WVXUIDFHDOLJQWKH0:'ZLWKWKHZKLSVWRFNIDFH 6KDOORZWHVWWKH0:'WRROV 5,+WRVHWWLQJGHSWK ¶DERYHVHWWLQJGHSWKHVWDEOLVKFLUFXODWLRQDQGZRUNWRUTXHRXWRIVWULQJ 2ULHQWWKHZKLSVWRFNDVSHUZHOOSODQ2QFHWKHFRUUHFWRULHQWDWLRQLVFRQILUPHG6ODFNRIIVORZO\WR ODQGWKH$QFKRUDQGODWFKWR0/=;3 ,QLWLDWHFLUFXODWLRQDQGREWDLQDVXUYH\RIWKHLQVWDOOHGZKLSVWRFNRULHQWDWLRQ 6WDUW´FDVLQJPLOOLQJRSHUDWLRQ(VWDEOLVKURWDWLRQWREHJLQPLOOLQJWKHZLQGRZ $IWHUWKHZLQGRZLVFRPSOHWHDQGEHIRUH322+VKXWSXPSVDQGZRUNPLOOLQJDVVHPEO\WKURXJK ZLQGRZVHYHUDOWLPHVZDWFKLQJIRUGUDJ322+DQG/'PLOOLQJDVVHPEO\ WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 3LFN8S3URGXFWLRQ'ULOOLQJ$VVHPEO\ 38WKH´ELWDQGWKH%+$DVVHPEO\DVSHUWKH%+$GLDJUDP ¾´3'& ¾5RWDU\6WHHUDEOH ¾)ORZUDWH*30 ¾±530 2LO%DVHG0XG)OXLG'LVSODFHPHQW 'ULOO¶¶RIQHZKROHXVLQJWKH2LO%DVHG5HVHUYRLU'ULOO,QIOXLG 3HUIRUP/HDN2II7HVWDVSHU$2*&&UHTXLUHPHQWVIROORZLQJWKHDWWDFKHG/273URFHGXUH ¾38LQWRFDVLQJDQGSHUIRUP/27 ¾,IWKHSUHVVXUHFRQWLQXHVWRULVHSDVWSSJ(0:VKXWGRZQDQGFDOOLWD),7SHUWKH),7 *XLGHOLQHVDWWDFKHG ¾,I/27LVXQDFFHSWDEOHWRGULOODKHDGOHVVWKDQSSJ(0:FRQWDFW'ULOOLQJ6XSHULQWHQGHQWWR GLVFXVVRSWLRQV ¾'RQRWSXPSPRUHWKDQEEODIWHUOHDNRIILVGHWHUPLQHG7KHUHLVQRQHHGWRSXPSPRUHWKDQ EEOLQWRWKHOHDNRIIDQGH[WHQGWKHIUDFWXUH ¾3ORWRQ/27IRUPLQ1GULYH 352'8&7,216(&7,21 :LOO RWKHU ODWHUDOV EH LVRODWHG GXULQJ GULOOLQJ RSHUDWLRQV" WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 3URGXFWLRQ0XG3URJUDP)D]H3UR ,QWHUYDO'HQVLW\ SSJ<3+7+3)/ POPLQ 2LOZDWH U (OHFWULFDO 6WDELOLW\ PO9ROWV 3URGXFWLRQ! 3URGXFWLRQ/RJJLQJ)RUPDWLRQ(YDOXDWLRQ3URJUDP 3URGXFWLRQ 0:''LUHFWLRQDO3:'3UHVVXUH:KLOH'ULOOLQJ /:'*55HV(FRVFRSH3HUL6&23( 3URGXFWLRQ'ULOO3LSH Pipe WT (ppf)Grade Conn. type Tool Join t OD (in) Tool Joint ID (in) Body ID (in) Make Up Torque (ft.lbs) Joint Torsio nal Yield (ft lbs) Body Torsio nal Yield (ft.lbs) DP capacit y w/ conn. (gal / ft) Tensile Capacit y (kips) ´'36'HOWD ´'3677 3URGXFWLRQ6HFWLRQ1RWHV D0RQLWRUKROHFRQGLWLRQVFDUHIXOO\%HDOHUWIRUHDUO\VLJQVRIORVWFLUFXODWLRQDQGGLIIHUHQWLDO VWLFNLQJ,IDQ\RIWKHVHSUREOHPVDUHREVHUYHGLPPHGLDWHO\QRWLI\WKH'ULOOLQJ6XSHUYLVRURU 7RROSXVKHUDWWHPSWWRNHHSWKHSLSHPRYLQJDQGFLUFXODWLRQHVWDEOLVKHG(QVXUHWKDWDOOWHDP PHPEHUVDUHFRPPXQLFDWLQJZLWKHDFKRWKHURQDQ\REVHUYHGGULOOLQJWUHQGVDQGWKDWHYHU\RQH XQGHUVWDQGVWKHSRWHQWLDOULVNV E6KDOORZWHVW0:'WRROV F*RRGGULOOLQJDQGWULSSLQJSUDFWLFHVDUHYLWDOIRUDYRLGDQFHRIGLIIHUHQWLDOVWLFNLQJ0DNHHYHU\ HIIRUWWRNHHSWKHGULOOVWULQJPRYLQJZKHQHYHUSRVVLEOHDQGDYRLGVWRSSLQJZLWKWKH%+$DFURVV WKHVDQGIRUDQ\H[WHQGHGSHULRGRIWLPH G.HHSVKXWGRZQWLPHVWRDPLQLPXPGXULQJFRQQHFWLRQV:KHQVXUYH\LQJLQWKLVKROHVHFWLRQ UHFLSURFDWHWKHSLSHVORZO\ZKLOHWKHVXUYH\LVWUDQVPLWWHGXSKROH.HHSWKHSLSHURWDWLQJ ZKHQHYHUSRVVLEOH H(QVXUHWKH7RS'ULYH7RUTXH/LPLWLVVHWEHORZWKHORZHVWPDNHXSWRUTXHLQWKHVWULQJ'RQRW UXQWKHULVNRIIXUWKHUPDNHXSWRDFRQQHFWLRQZKLOHGULOOLQJ 2SHQKROH6LGHWUDFNLQJ3UDFWLFHV I/RZVLGHLQDIDVWGULOOLQJLQWHUYDOZKHUHWKHZHOOERUHLVKHDGLQJXSDQGZKHUHWKH$%,¶VVKRZD JRRGEXLOGUDWH J2ULHQWZLWKLQGHJUHHVHLWKHUVLGHRIORZVLGHDQGWURXJKZLWKKLJKURWDU\530¶VZKLOH UHFLSURFDWLQJIURPWKHNLFNRIISRLQWEDFNWRWKHILUVWVWDELOL]HU7URXJKIRUDSSUR[LPDWHO\ PLQXWHV !'/% WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI K7LPHGULOODWWRIHHWSHUKRXUZLWKKLJKIORZUDWHVDQGURWDU\530¶VIRUWKHILUVWIHHW *UDGXDOO\LQFUHDVHWKHSHQHWUDWLRQUDWHDVWKHRSHQKROHVLGHWUDFNLVDFKLHYHG L,IDQ\RSHQKROHVLGHWUDFNVDUHGULOOHGFRQIHUZLWK'ULOOLQJ6XSWDQGFRQVLGHUWULSSLQJZLWKRXW FLUFXODWLQJRUZLWKRXWURWDWLQJSDVWWKHVLGHWUDFNSRLQW 3URGXFWLRQ'ULOOLQJ 'LUHFWLRQDOO\GULOOWKH´KROHWR7' ¾*HRVWHHULQJZLOOEHUHTXLUHGWRUHPDLQLQWKHWDUJHWERXQGDU\RIWKHWLPH ¾0DLQWDLQVXIILFLHQWIORZUDWHZLWKPD[LPXPSLSHURWDWLRQDVQHHGHGWREULQJPXGZHOOSURSHUWLHVLQ OLQH ¾0DLQWDLQSURSHU&DOFLXP&DUERQDWHFRQFHQWUDWLRQSHU0,PXGSODQ (QVXUH&HQWULIXJHVDUHRSHUDWLQJHIIHFWLYHO\WRUHPRYHILQHGULOOVROLGV %DFNUHDPDW7' ¾$W7'FLUFXODWHRIFDOFXODWHG7$'FOHDQXSF\FOHSXOOLQJVWDQGSHUERWWRPVXS2QFHWKHILUVW FOHDQXSF\FOHLVFRPSOHWHGFLUFXODWHWKHUHPDLQLQJRIWKHFDOFXODWHGFOHDQXSF\FOHSXOOLQJ VWDQGVSHUERWWRPVXS'HFUHDVHEDFNUHDPLQJVSHHGDVWRUTXHDQGSXPSSUHVVXUHGLFWDWH *30 530 ¾%DFNUHDPWRXSSHUVWDELOL]HU¶ZLQGRZ¶EHORZZLQGRZ7DNHFDUHZKHQSXOOLQJLQWRWKH ZLQGRZDV FXWWLQJVDFFXPXODWLRQLVSRVVLEOH ¾!'R127UHDPDFURVVZKLSVWRFN x*30 530 x3XOOZLWKSXPSVRQO\LQWRWKHZLQGRZDQGDERYHWKHZKLSVWRFN3HUIRUPFOHDQ XSF\FOHDVQHHGHGREVHUYLQJFXWWLQJVYROXPHDWWKHVKDNHUV x'HFUHDVHEDFNUHDPLQJVSHHGDVWRUTXHDQGSXPSSUHVVXUHGLFWDWH &RQWLQXHEDFNUHDPLQJXQWLOGHSWKDWZKLFKLWLVSRVVLEOHWRSXOORXWRQHOHYDWRUVDW!VZDE(0: DW PLQVWDQG L*30 LL530 'HWHUPLQHGHSWKDWZKLFKVZDEFDQEHNHSW!(0:DVSHU. 07$' 0RGHO &LUFXODWHXQWLOVKDNHUVDUHFOHDQDVSHU. 0 LLL*30 LY530 WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 6OXJ'3DQGWULSRXWRIKROHRQHOHYDWRUV E8WLOL]H. 0¶VVZDEPRGHOWRFRQWUROWULSVSHHGDQGDYRLGVZDEELQJWKHRSHQKROHEHORZ SSJ (0: /D\GRZQ%+$ ¾F :KHQRXWRIKROHGRZQORDGWKHUHFRUGHGWRROGDWDDQGVHQGWRWKH*HRORJLVWLQWRZQ:KHQ RXWRIKROHGRZQORDGWKHUHFRUGHGWRROGDWDDQGVHQGWRWKH*HRORJLVWLQWRZQ 5,+ZLWKUHWULHYLQJWRRODVVHPEO\WRUHWULHYHWKHZKLSVWRFNDVVHPEO\ &RPSOHWLRQ'35$%%,76,=(:LOO%(´2' 3URGXFWLRQ/LQHU OD (in) WT (ppf)Grade Conn. Type Cplg OD (in) ID (in) Drift (in) Collapse (psi) Burst (psi) Tensile Yield (kips) /+\GULO 3URGXFWLRQ/LQHU&RQQHFWLRQ0DNH8S7RUTXHIWOEV OD (in) WT (ppf)Grade Conn. Type 0LQ 0DNH8S 7RUTXHIW OEV 7DUJHW 0DNH8S 7RUTXH 0D[ 0DNH 8S 7RUTXH <LHOG 7RUTXH /+\GULO1$ 6HHDWWDFKHG7HQDULV+\GULO*XLGHOLQHVIRUPDNHXSWRUTXHUHFRPPHQGDWLRQV 3URGXFWLRQ/LQHU&HQWUDOL]DWLRQ )URP7R4XDQWLW\-RLQW)L[HG)ORDWLQJ7\SH 6KRH/LQHU WRS MRLQW 0LGMRLQW )L[HG &ULPSHGRQ ´[´ +\GURIRUP9RODQW&ULPS RQ /LQHU5XQQLQJ3URFHGXUH 1RWHV x(QVXUHSURSHUFURVVRYHUIURP'3WRVORWWHGOLQHULVRQWKHULJIORRULQFDVHRIDZHOOFRQWURO VLWXDWLRQ x/LQHUWRSVKRXOGEHSODFHGDPLQLPXPRIIWDERYHWKHLQWHUPHGLDWHFDVLQJVKRH x(QVXUHDFFXUDWHWRUTXHDQGGUDJGDWDLVJDWKHUHG5HFRUGSLFNXSDQGVODFNRIIZHLJKWVHYHU\ VWDQGDQGIUHHURWDWLQJWRUTXHHYHU\ILYHVWDQGV'DWDJDWKHUHGZLOODVVLVWLQIXWXUHOLQHUUXQQLQJ RSHUDWLRQVWKURXJKRXWWKHSURMHFW 3URGXFWLRQ/LQHU WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI x3HUIRUPYLVXDOLQVSHFWLRQPHDVXUHDQGFDOLSHUDOOFRPSRQHQWVSULRUWRUXQQLQJDQ\DVVHPEO\LQ WKHKROH(QVXUHDFFXUDWHGLPHQVLRQDOGDWDLVUHFRUGHGIRUDOOHTXLSPHQWUXQLQWKHZHOODQG UHFRUGHGLQ:HOO9LHZ x(QVXUHDOOHTXLSPHQWKDVEHHQK\GUDXOLFDOO\DQGRSHUDWLRQDOO\WHVWHG$OVRHQVXUHDOOHTXLSPHQW WREHUXQLVGLPHQVLRQDOO\FRPSDWLEOHZLWKDOORWKHUHTXLSPHQW x5HYLHZDOOVHWWLQJRSHUDWLRQVDQGVKHDUSUHVVXUHVZLWK%DNHU2LO7RROVVHUYLFHKDQG x(QVXUHWKDWDOOZRUNVWULQJFRPSRQHQWVKDYHEHHQUDEELWHGDVEDOOZLOOEHGURSSHGWRDFWXDWH GRZQKROHWRROV5DEELW'3RQODVWWULSRXWRISULRUWRUXQQLQJOLQHU x,IDQ\RSHQKROHVLGHWUDFNVKDYHEHHQGULOOHGPRQLWRUVLGHWUDFNGHSWKVGXULQJUXQLQDQGHQVXUH VKRHHQWHUVWKHFRUUHFWKROH x7RUTXHUDWLQJVIRUVWULQJFRPSRQHQWV 6WULQJ&RPSRQHQWV<LHOG7RUTXHIWOE 77'ULOO3LSH +5'5XQQLQJ7RRO +\GULO ´+\GULO x6KHDUSUHVVXUHVIRUOLQHUKDQJHUDVVHPEO\ ,WHP'HVFULSWLRQ6KHDU9DOXH6KHDU5DQJH +5'5XQQLQJ7RRO1RPLQDOSVLSVL PFKUHOSLQVSVL 3XVKHU7RRO$FWLYDWLRQ1RPLQDOSVLSVL SVL 3XVKHU7RRO1HXWUO]1RPLQDOSVLSVL SVL %DOO6HDW62/,' 0DNHXSWRUTXHIRUOLQHUKDQJHUVXEDVVHPEO\LQFOXGLQJUXQQLQJWRROFRQQHFWLRQVVKRXOGEH WRUTXHGWRIWOEVSULRUWRGHOLYHUWRULJ 3URFHGXUH +ROG3UHMREVDIHW\PHHWLQJWRHQVXUHDOOSDUWLHVXQGHUVWDQGRSHUDWLRQ 38WKH/LQHU$VVHPEO\DQG5XQQLQJ,QQHU6WULQJDVRXWOLQHGDERYH 5,+ZLWK/LQHU$VVHPEO\5HFRUG38DQG62ZHLJKWVDVUHTXLUHG 3LFNXSOLQHUKDQJHUDVVHPEO\DQGPDNHXSWRSURSHUWRUTXH)LOO/LQHU7LHEDFN6OHHYHZLWK³SDOPL[´DQG HQVXUHPL[WXUHLVWKLQHQRXJKWRWUDYHOSDVWWKH+5'WRRODQGGRZQWRWKHSDFNRII:DLWPLQXWHVIRU PL[WXUHWRVHWXS 7ULSLQKROHRQHVWDQGDQGFLUFXODWHEEOVWRHQVXUHDOOIORZSDWKVDUHIUHH5HFRUG527$7(38DQG62 RIOLQHUDVVHPEO\ 5,+LQKROHWRFDVLQJVKRHZLWK'35,+ZLWK/LQHU$VVHPEO\DVKROHFRQGLWLRQVDOORZEXWGRQRWH[FHHG UXQQLQJVSHHGRIRQHVWDQGSHUPLQXWH%UHDNFLUFXODWLRQDQGILOO'3DVQHFHVVDU\ 0RQLWRUPXGIORZZKLOHUXQQLQJLQRSHQKROHDQGVORZUXQQLQJVSHHGLIQHFHVVDU\&LUFXODWHPLQLPXPRI RQH'3YROXPHDQGUHFRUG527$7(38DQG62ZHLJKWV WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 5HFRUG3862DQG5RWDWLQJWRUTXHLQRSHQKROHHYHU\¶WRHQVXUHIULFWLRQIDFWRUVDUHVXIILFLHQWWRUXQ WKHOLQHUWRERWWRPVXFFHVVIXOO\,IIULFWLRQWUHQGLQGLFDWHVOLQHUZLOOQRWJRWRERWWRPWKHQFDOO'ULOOLQJ 6XSWLPPHGLDWHO\ 5RWDWLQJOLQHU530ZLOOEHQHFHVVDU\WRUXQWRERWWRP &RQWLQXH5,+ZLWK/LQHU$VVHPEO\WRSURSHUVHWWLQJGHSWK/LQHUVKRXOGEHVSDFHGRXWWRORFDWHWKHOLQHU WRSDSSUR[LPDWHO\IHHWDERYH´ZLQGRZ 11.7ULSVOLJKWO\GHHSHUWKDQGHVLUHGOLQHUWRSORFDWLRQZLWKOLQHUWRS/DVWPRWLRQRIWKHOLQHUVKRXOGEHXSWR HQVXUHLWLVVHWLQWHQVLRQEnsure Liner Hanger assembly does not exit 9-5/8” Window. 3ULRUWRVHWWLQJWKHKDQJHU SDFNHUGRXEOHFKHFNDOOSLSHWDOOLHVDQGUHFRUGDPRXQWRIGULOOSLSHRQORFDWLRQ 5LJXSWRSXPSGRZQZRUNVWULQJZLWKULJSXPSV3UHVVXUHWHVWOLQHV%OHHGRIIWHVWSUHVVXUH 'URSVHWWLQJEDOOGRZQWKHZRUNVWULQJDQGSXPSVORZO\ESP6ORZSXPSEHIRUHWKHEDOOVHDWV'R QRWDOORZEDOOWRVODPLQWREDOOVHDW 3UHVVXUHXSWRSVLDQGKROGIRUPLQXWHVWRVHW6/=;3KDQJHUSDFNHU&RQWLQXHSUHVVXULQJXSLQ SVLLQFUHPHQWVKROGLQJIRUPLQXWHVHDFKXSWRSVL 3DFNHUFDQQRZEHSUHVVXUHWHVWHG%OHHG'3SUHVVXUHWR]HURFORVHDQQXODUSUHYHQWHUDQGWHVWDQQXOXVWR SVLIRUPLQXWHVDQGFKDUW %OHHGRIISUHVVXUHDQGSLFNXSWRYHULI\WKDWWKH+5'UXQQLQJWRROKDVUHOHDVHG,ISDFNHUGLGQRWWHVW URWDWLQJGRJVXEFDQEHXVHGWRVHWSDFNHU,IUXQQLQJWRROFDQQRWEHK\GUDXOLFDOO\UHOHDVHGIWOEVRI OHIWKDQGWRUTXHFDQPHFKDQLFDOO\UHOHDVHWKHWRRO 2QFHUXQQLQJWRROLVIUHHDQGSDFNHULVWHVWHG'LVSODFHPXGIURPOLQHUWRSWRVXUIDFHZLWKSSJ.&O EULQHSHU0,UHFRPPHQGHGSURJUDP 322+DQG/'DQGLQVSHFWWKHOLQHUUXQQLQJWRROV 3UHSDUHWR5,+FRPSOHWLRQ 08(63DVVHPEO\DQG5,+WRVHWWLQJGHSWK /DQGKDQJHU5,/'6DQGWHVWKDQJHU ,QVWDOO%39DQGQLSSOHGRZQ%23 18WXELQJDGDSWHUDQGWUHH 3XOO%39LQVWDOOWHVWSOXJDQGWHVWWUHH &LUFXODWH)UHH]HSURWHFWWKURXJKWUHHGRZQ,$ 6KXWLQZHOO %HORZWKHILQDOSODQQHGVFKHPDWLFRIWKHZHOODIWHUFRPSOHWLRQ 5,+(63&RPSOHWLRQ WDQQXOXVWRS SVLIRUPLQXWHVDQGFKDUW %OHHG'3SUHVVXUHWR]HURFORVHDQQXODUSUHYHQWHUDQGW WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI /RZHU ODWHUDO QRW VKRZQ ,W LV LVRODWHG Z ,%3 EMP WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI $77$&+0(176 5HFRPPHQGHG'ULOOLQJ3UDFWLFHV +HDOWK6DIHW\DQG(QYLURQPHQW 6DIHW\0HHWLQJ7RSLFV :HOO6KXW,Q3URFHGXUH:KLOH5XQQLQJ7XELQJ WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 5HFRPPHQGHG'ULOOLQJ3UDFWLFHV +ROH&OHDQLQJ :LWKDGHYLDWHGZHOOSDWKDQGSRWHQWLDOIRUORVVHVKROHFOHDQLQJZLOOUHTXLUHVSHFLDOSUDFWLFHV3LSHURWDWLRQLV FULWLFDOIRUHIIHFWLYHKROHFOHDQLQJ7KHPD[LPXPVWULQJ530DVGHWHUPLQHGE\WKH%+$LVVSHFLILHGIRU HDFKKROHVHFWLRQLQWKHGHWDLOHGSURFHGXUHV7KHVKDNHUVVKRXOGEHPRQLWRUHGDVDQLQGLFDWRURIDGHTXDWH FLUFXODWLQJWLPH,IFLUFXODWLRQLVRIORQJGXUDWLRQWKHQSLSHPRYHPHQWWRSUHYHQWFDVLQJZHDULVFULWLFDODQGD VWDQGVKRXOGEHODLGGRZQRFFDVLRQDOO\WRSUHYHQWH[FHVVKROHHURVLRQRYHUWKHOHQJWKRISLSHUHFLSURFDWLRQ ,QDGGLWLRQWKHIROORZLQJSUDFWLFHVVKRXOGEHHPSOR\HGDWDOOWLPHV D8VHDOODYDLODEOHVROLGVFRQWUROHTXLSPHQWWRNHHSPXGDVFOHDQDVSRVVLEOH E(PSKDVL]HSURSHUKROHFOHDQLQJDIWHUVOLGHVE\URWDWLQJDWPD[LPXPDOORZDEOH530 F$VWKHKROHDQJOHLQFUHDVHVKROHFOHDQLQJSUDFWLFHVPXVWEHDOWHUHG0D[LPXPSLSHURWDWLQJ VSHHGVDORQJZLWKPD[LPXPDFKLHYDEOHIORZUDWHVZLOOLQFUHDVHKROHFOHDQLQJHIILFLHQFLHV &LUFXODWLQJWLPHVSULRUWRWULSVVKRXOGEHLQFUHDVHGDFFRUGLQJO\WRDFFRXQWIRUORQJHUWLPHV UHTXLUHGWRUHPRYHFXWWLQJVIURPKLJKHUDQJOHZHOOV G8VHJRRGFRQQHFWLRQSUDFWLFHVZKLOHGULOOLQJ$IWHUUHDFKLQJWKHERWWRPRIDVWDQGDOORZDVPDOO DPRXQWRIFLUFXODWLQJWLPHWRDOORZFXWWLQJVWRJHWDERYHWKH%+$SULRUWRSLFNLQJXSRIIERWWRP %HVXUHWRSLFNXSVORZO\WRSUHYHQWSDFNLQJRIIWKHFXWWLQJVEHGDURXQGWKHWRSRIWKHGULOO FROODUV 6ORZHU7ULS&RQQHFWLRQ6SHHGV +LJK322+DQG5,+VSHHGVFDQDJJUDYDWHIUDJLOHVKDOHVIRUPDWLRQVGXHWRWKHSUHVVXUHYDULDWLRQVEHWZHHQ VXUJHVZDE3:'GDWDVKRZVWKDWH[FHVVLYHWULSSLQJDQGUHDPLQJVSHHGVFDQH[HUWSUHVVXUHVSLNHVLQH[FHVV RISSJHTXLYDOHQW (IIHFWLYH523 6WULYHWRILQGWKHPD[LPXPHIIHFWLYHUDWHRISHQHWUDWLRQ7KDWLVWKHPD[LPXPUDWHDWZKLFKDFOHDQKROHFDQ EHSURGXFHG:KLOHRQERWWRP523VLQH[FHVVRIIWSKPD\EHSRVVLEOHEXWVXFK523VPD\ORDGDKLJK DQJOHKROHZLWKFXWWLQJVWKDWDUHQRWEHLQJUHPRYHGIDVWHQRXJK8VLQJWRUTXHDQGGUDJWUHQGV(&'DQGWKH VKDNHUVHVWDEOLVKDEDVHOLQHFOHDQKROH523DQGWKHQWU\WRLPSURYHLWE\DOWHULQJWKHKROHFOHDQLQJ SUDFWLFHV 6ORZHU,QLWLDO3XPS5DWHV 3:'GDWDKDVVKRZQWKDWWKHPRVWVLJQLILFDQWSHULRGIRULQFUHDVHG(&'RFFXUVZKHQWKHSXPSVDUHEURXJKW RQDWGULOOLQJUDWHZKLOHZDVKLQJDFRQQHFWLRQWRERWWRP7KHVWXG\DOVRFRQFOXGHGWKHOHDVWGDPDJLQJ SURFHGXUHLVLISXPSUDWHVDUHKHOGDWRUOHVVRIGULOOLQJUDWHZKLOHUHDPLQJFRQQHFWLRQV WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI +HDOWK6DIHW\ (QYLURQPHQW 7KHIROORZLQJDUHSDUWRIWKHPLWLJDWLRQ FRQWLQJHQF\PHDVXUHVWREHSXWLQSODFHLQRUGHUWRFRPSOHWHWKLV SURMHFWZKLOHKHOSLQJWRPHHWRXU+6 (JRDOV,WLVWKH'ULOOLQJ6XSHUYLVRU¶VUHVSRQVLELOLW\WKDWWKHVH PHDVXUHVDUHLPSOHPHQWHGDQGFRPPXQLFDWHGWRWKHUHOHYDQWSDUWLHVRQORFDWLRQ*RRGFRPPXQLFDWLRQZKHQ GULOOLQJLVHVVHQWLDOIRULQFUHDVLQJWKHVDIHW\RISHUVRQQHODQGHTXLSPHQW +6&RQWLQJHQF\0HDVXUHV $VVXPHDOOORFDWLRQVKDYHWKHSRWHQWLDOIRU+6 7KH$2*&&ZLOOEHQRWLILHGZLWKLQKRXUVLI+6LVHQFRXQWHUHGLQH[FHVVRISSPGXULQJGULOOLQJ RSHUDWLRQV 7KHULJZLOOKDYHIXOO\IXQFWLRQLQJDXWRPDWLF+6GHWHFWLRQHTXLSPHQWPHHWLQJWKHUHTXLUHPHQWVRI $$&0DQXDOGHWHFWRUVLQDFFRUGDQFHZLWK$$&ZLOODOVREHPDLQWDLQHGRQORFDWLRQ 6HOIFRQWDLQHG%UHDWKLQJ$SSDUDWXVIRUDOOULJSHUVRQQHOZLOOEHPDLQWDLQHGRQORFDWLRQ $OOSHUVRQQHOHQJDJHGLQWKHGULOOLQJRSHUDWLRQZLOOEHWUDLQHGLQ+6HPHUJHQF\SURFHGXUHVDQGWKHXVH RISURSHUSHUVRQDOSURWHFWLYHHTXLSPHQW $VWDQGDUG+6FRQWLQJHQF\SODQZLOOEHSRVWHGDWWKHULJ$OOULJSHUVRQQHOVKRXOGUHDGDQGIDPLOLDUL]H WKHPVHOYHVZLWKWKLVGRFXPHQWDQGFRSLHVVKRXOGEHSRVWHGLQWKHULJIORRUGRJKRXVHDQGLQWKHFDPSRQ ORFDWLRQ +6WUHDWLQJPDWHULDOIRUWKHGULOOLQJPXGV\VWHPZLOOEHDYDLODEOHRQORFDWLRQLQWKHHYHQWWKDWDQ\+6LV HQFRXQWHUHG ,WLVH[SHFWHGWKDWWKHULJDQGSHUVRQQHOZLOOKDYHWKHHTXLSPHQWDQGWUDLQLQJWRLGHQWLI\DQGFRQWDLQD+6 HPHUJHQF\VLWXDWLRQ,ILWEHFRPHVQHFHVVDU\WRQRWLI\WKH$2*&&RIDQ+6HQFRXQWHUGULOOLQJZLOOEH VXVSHQGHGDQGZLOOUHVXPHRQO\DIWHUWKHGHYHORSPHQWRIGHWDLOHGUHPHGLDODQGFRQWLQJHQF\SURFHGXUHVIXOO FRPSOLDQFHZLWK$$&DQGWKHDSSOLFDEOHUHIHUHQFHGVHFWLRQVRI$3,53DQGDSSURYDORIWKH $2*&& /HVVRQV/HDUQHG 'RFXPHQWDWLRQRIOHVVRQVOHDUQHGKDVEHHQSURYHQWRUHGXFHGRZQWLPHDQGLQFUHDVHHIILFLHQF\RIULJ RSHUDWLRQV,WLVH[SHFWHGWKDWSODQQLQJPHHWLQJVGDLO\RSHUDWLRQVPHHWLQJVDQGSUHWRXUPHHWLQJVZLOOEH KHOGRQDUHJXODUDQGFRQVLVWHQWEDVLVDQGWKDWWKHUHFRUGVRIWKRVHPHHWLQJVZLOOEHSODFHGRQWKH1GULYHLQ WKHDSSURSULDWHIROGHUIRUWKLVZHOO +6 LV QRW DQWLFLSDWHG EMP WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI 6DIHW\0HHWLQJ7RSLFV 0RYH,Q5LJ8S ¾3ULRUWRVSXGDVDIHW\PHHWLQJVKRXOGEHKHOGZLWKWKHULJFUHZVWRGLVFXVVRSHQKROHGULOOLQJ SURFHGXUHV 6XEVLGHQFHDURXQGZHOOKHDGVXVHRIEXGG\V\VWHP &RQGXFWRUEURDFKLQJRSHUDWLRQVDQGFRQWLQJHQFLHV 6KDOORZJDVK\GUDWHGULOOLQJSUDFWLFHV 3URSHUWULSSLQJSUDFWLFHVDQGKROHILOOFDOFXODWLRQVZLWKYDULRXVVL]HVRISLSHDQGWXELQJ :HOOFRQWUROSURFHGXUHV )ORZUDWHVDQGKROHFOHDQLQJDQG 'LYHUWHURSHUDWLRQDQGFUHZUHVSRQVLELOLWLHV ¾$ 'LYHUWLQJ6KDOORZ*DV GULOOVKRXOGEHKHOGZLWKULJFUHZVSULRUWRVSXGXQOHVVHDFKFUHZRQ WRXUKDVFRPSOHWHGWKLVGULOOZLWKLQWKHSDVWPRQWKV'RFXPHQWGULOODQGUHFRUGRQPRUQLQJ UHSRUW ¾$Q $FFXPXODWRU GULOOVKRXOGEHKHOGZLWKULJFUHZVSULRUWRVSXG'RFXPHQWGULOODQGUHFRUGRQ PRUQLQJUHSRUW ¾6KXWLQGULOOVVKRXOGEHKHOGRQDUHJXODUO\VFKHGXOHGEDVLV$VXJJHVWHGPLQLPXPLVRQFHSHU GD\RQDOWHUQDWLQJWRXUV'RFXPHQWDQGUHFRUGRQPRUQLQJUHSRUW ¾&KHFNWULSWDQNIRUOHDNVDQGFRQILUPJDXJHVDUHFDOLEUDWHG&RPSOHWHWULSVKHHWVDQGVXEPLWWR WKH'ULOOLQJ6XSHUYLVRUDIWHUHDFKWULS ¾3HUIRUPDQGGRFXPHQWDOOGULOOV ¾'HVLJQDWHFUHZPHPEHUWRFRQWURODFFHVVDWWKHSDGHQWUDQFHLQFDVHRIGLYHUWHURSHUDWLRQ 6XUIDFH ¾$ 6WULSSLQJ GULOOVKRXOGEHKHOGZLWKULJFUHZVSULRUWRGULOORXWXQOHVVHDFKFUHZRQWRXUKDV FRPSOHWHGWKLVGULOOZLWKLQWKHSDVWPRQWKV'RFXPHQWGULOODQGUHFRUGRQPRUQLQJUHSRUW ¾$ :HOO.LOO GULOOVKRXOGEHKHOGZLWKULJFUHZVSULRUWRGULOORXWXQOHVVHDFKFUHZRQWRXUKDV FRPSOHWHGWKLVGULOOZLWKLQWKHSDVWPRQWKV'RFXPHQWGULOODQGUHFRUGRQPRUQLQJUHSRUW ¾$ZHOONLOOVKHHWVKDOOEHSRVWHGLQWKHGRJKRXVHDQGXSGDWHGHDFKWRXU ,QWHUPHGLDWH ¾3ULRUWRSLFNLQJXSWKH%+$DVDIHW\PHHWLQJVKRXOGEHKHOGZLWKWKHULJFUHZVWRGLVFXVVKROH ULVNVDQGRSHQKROHGULOOLQJSURFHGXUHV ¾3RWHQWLDOIRUPDWLRQSUHVVXUHVDQGPXGZHLJKW:HOOFRQWUROSURFHGXUHV ¾+ROHFOHDQLQJEHVWSUDFWLFHVIORZUDWHV ¾6WXFNSLSH/RVWFLUFXODWLRQ ¾3URSHUWULSSLQJSUDFWLFHVDQGKROHILOOFDOFXODWLRQVZLWKYDULRXVVL]HVRISLSHDQGWXELQJ 3URGXFWLRQ ¾3ULRUWRSLFNLQJXSWKH%+$DVDIHW\PHHWLQJVKRXOGEHKHOGZLWKWKHULJFUHZVWRGLVFXVV SURGXFWLRQKROHULVNVDQGRSHQKROHGULOOLQJSURFHGXUHV ¾3RWHQWLDOIRUPDWLRQSUHVVXUHVDQGPXGZHLJKW:HOOFRQWUROSURFHGXUHV WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI ¾+ROHFOHDQLQJEHVWSUDFWLFHVIORZUDWHV ¾6WXFNSLSH/RVWFLUFXODWLRQ ¾3URSHUWULSSLQJSUDFWLFHVDQGKROHILOOFDOFXODWLRQVZLWKYDULRXVVL]HVRISLSHDQGWXELQJ &RPSOHWLRQ ¾2SHUDWLRQRIWKHFRQWUROOLQHVSRROHU ¾3LQFKSRLQWVDVVRFLDWHGZLWKWRQJVDQGVOLSV ¾3URSHUWULSSLQJSUDFWLFHVDQGKROHILOOFDOFXODWLRQVZLWKWXELQJDQGFRQWUROOLQH ¾:HOOFRQWUROSUDFWLFHVZKLOHUXQQLQJSURGXFWLRQWXELQJZLWKFRQWUROOLQH ¾3UHVVXUHWHVWLQJDQGPLQLPL]LQJSHUVRQQHOH[SRVXUHWRSUHVVXUL]HGOLQHV WELL 631(/ 631(/'ULOOLQJ:HOOSODQ 3DJHRI :HOO6KXW,Q3URFHGXUH:KLOH5XQQLQJ3URGXFWLRQ7XELQJ ,IZHOOLVVXVSHFWHGWREHIORZLQJ ,QVWDOO7,:YDOYHDQGSXOOEDFNWRWKHILUVWEDQGLQJSRLQWEHORZWKH%23VWDFN 6KXWRIIDLUWRFRQWUROOLQHVSRRODQGEOHHGRIIOLQHSUHVVXUHZKLOHFKHFNLQJZHOOIRUIORZ ,IZHOOLVFRQILUPHGWREHIORZLQJFXWFRQWUROOLQHZLWKEROWFXWWHUVGLUHFWO\DERYHDEDQGLQJSRLQW 6ODFNRIIXQWLOIXOOMRLQWRISLSHZLWKQRFRQWUROOLQHDWWDFKHGLVVSDFHGRXWDFURVV%23VWDFN &ORVHDQQXODUDQGPRQLWRUSUHVVXUH ,IZHOOLVFRPLQJLQUDSLGO\DQGWLPHLVQRWSHUPLWWHGWRFRPSOHWHDERYHRSHUDWLRQV ,QVWDOO7,:DQGFORVHDQQXODUDURXQGSLSHDQGFRQWUROOLQH 6KXWRIIDLUWRFRQWUROOLQHVSRRODQGEOHHGRIIOLQHSUHVVXUHZKLOHSLFNLQJXSDMRLQWRIGULOOSLSHDQG PDNLQJLWXSWR7,:DQGWRSGULYH &ORVH,%23RQWRSGULYHDQGRSHQ7,:YDOYH &XWFRQWUROOLQHDQGVWULSWKHMRLQWRIGULOOSLSHDFURVVVWDFNIRUUDPFORVXUHLIQHHGHG ,IDQQXODUGRHVQRWVHDORIIDURXQGWXELQJDQGFRQWUROOLQHDQGWKHMRLQWRIGULOOSLSHFDQQRWEHVDIHO\ SLFNHGXSFORVHEOLQGVKHDUUDPVRQSURGXFWLRQWXELQJ 1RWHV x6SHFLI\ORFDWLRQRIEROWFXWWHUVUHTXLUHGWRFXWFRQWUROOLQH xNeed to have access to a joint of drill pipe and the appropriately sized elevators at all times. January 24 2011 5(&(,9(' Document Control 7DUJHW 7HH V 'LYHUWHU OLQH RQ WRS RI ZHOO KRXVH 'LYHUWHU OLQH RQ JURXQG 3UHYDLOLQJ :LQG LQ CompiledBy:CCDate:10/01/10CheckedBY:DHSDate:10/03/1063<,6/$1''5,//6,7(&RQGXFWRU$V%XLOWV$ODVND6WDWH3ODQH1$' 1$'Lounsbury&AssociatesEniͲNikaitchuqDoc.EͲ087Rev.0'Y' 'X' Latitude(N) Longitude(W) 'Y' 'X' Latitude(N) Longitude(W) F.N.L F.E.L(USft.) (USft.)1 6,053,423.20 1,651,769.82 70°33'27.209" 149°54'24.765" 6,053,671.08 511,739.02 70°33'28.246" 149°54'13.383" 797 1171 12.42 6,053,421.65 1,651,761.87 70°33'27.194" 149°54'25.000" 6,053,669.53 511,731.06 70°33'28.231" 149°54'13.618" 798 1179 12.43 6,053,420.07 1,651,754.10 70°33'27.179" 149°54'25.229" 6,053,667.95 511,723.30 70°33'28.216" 149°54'13.847" 800 1186 12.44 6,053,418.56 1,651,746.17 70°33'27.164" 149°54'25.463" 6,053,666.44 511,715.38 70°33'28.201" 149°54'14.081" 801 1194 12.45 6,053,417.03 1,651,738.44 70°33'27.149" 149°54'25.692" 6,053,664.91 511,707.64 70°33'28.186" 149°54'14.309" 803 1202 12.46 6,053,415.54 1,651,730.54 70°33'27.134" 149°54'25.925" 6,053,664.91 511,699.74 70°33'28.171" 149°54'14.543" 804 1210 12.47 6,053,412.44 1,651,714.77 70°33'27.104" 149°54'26.391" 6,053,660.34 511,683.97 70°33'28.141" 149°54'15.009" 807 1226 12.48 6,053,410.91 1,651,706.96 70°33'27.089" 149°54'26.622" 6,053,658.80 511,676.16 70°33'28.126" 149°54'15.239" 809 1234 12.49 6,053,409.39 1,651,699.11 70°33'27.074" 149°54'26.853" 6,053,657.28 511,668.32 70°33'28.111" 149°54'15.471" 810 1241 12.410 6,053,407.94 1,651,691.31 70°33'27.060" 149°54'27.084" 6,053,655.83 511,660.51 70°33'28.097" 149°54'15.702" 812 1249 12.411 6,053,406.32 1,651,683.39 70°33'27.044" 149°54'27.318" 6,053,654.21 511,652.60 70°33'28.082" 149°54'15.935" 813 1257 12.412 6,053,404.80 1,651,675.51 70°33'27.029" 149°54'27.551" 6,053,652.82 511,644.69 70°33'28.067" 149°54'16.168" 815 1265 12.413 6,053,400.38 1,651,652.80 70°33'26.986" 149°54'28.221" 6,053,648.26 511,622.00 70°33'28.023" 149°54'16.839" 819 1288 12.414 6,053,398.83 1,651,644.95 70°33'26.971" 149°54'28.453" 6,053,646.72 511,614.15 70°33'28.008" 149°54'17.071" 821 1296 12.415 6,053,397.31 1,651,637.12 70°33'26.956" 149°54'28.685" 6,053,645.20 511,606.32 70°33'27.993" 149°54'17.302" 822 1304 12.416 6,053,395.82 1,651,629.26 70°33'26.942" 149°54'28.917" 6,053,643.71 511,598.46 70°33'27.979" 149°54'17.534" 824 1311 12.417 6,053,394.32 1,651,621.47 70°33'26.927" 149°54'29.147" 6,053,642.21 511,590.68 70°33'27.964" 149°54'17.764" 825 1319 12.418 6,053,392.78 1,651,613.58 70°33'26.912" 149°54'29.380" 6,053,640.67 511,582.79 70°33'27.949" 149°54'17.997" 827 1327 12.419 6,053,389.63 1,651,597.90 70°33'26.881" 149°54'29.843" 6,053,637.52 511,567.11 70°33'27.919" 149°54'18.460" 830 1343 12.420 6,053,388.17 1,651,590.00 70°33'26.867" 149°54'30.076" 6,053,636.06 511,559.21 70°33'27.904" 149°54'18.694" 831 1351 12.421 6,053,386.60 1,651,582.24 70°33'26.852" 149°54'30.306" 6,053,634.49 511,551.44 70°33'27.889" 149°54'18.923" 833 1358 12.422 6,053,385.19 1,651,574.35 70°33'26.838" 149°54'30.538" 6,053,633.08 511,543.56 70°33'27.875" 149°54'19.156" 834 1366 12.423 6,053,383.64 1,651,566.41 70°33'26.823" 149°54'30.773" 6,053,631.53 511,535.62 70°33'27.860" 149°54'19.391" 836 1374 12.424 6,053,382.12 1,651,558.61 70°33'26.808" 149°54'31.003" 6,053,630.01 511,527.82 70°33'27.845" 149°54'19.621" 837 1382 12.425 6,053,377.65 1,651,535.94 70°33'26.764" 149°54'31.673" 6,053,625.54 511,505.15 70°33'27.802" 149°54'20.291" 842 1405 12.426 6,053,376.14 1,651,528.13 70°33'26.750" 149°54'31.904" 6,053,624.03 511,497.34 70°33'27.787" 149°54'20.521" 843 1413 12.427 6,053,374.53 1,651,520.23 70°33'26.734" 149°54'32.137" 6,053,622.43 511,489.44 70°33'27.771" 149°54'20.754" 845 1421 12.428 6,053,373.11 1,651,512.46 70°33'26.720" 149°54'32.366" 6,053,621.01 511,481.67 70°33'27.758" 149°54'20.984" 846 1428 12.4PadElev.AlaskaStatePlane,NAD83GRID NAD83GeographicWellNo.SectionLineOffsetAlaskaStatePlane,NAD27GRID NAD27GeographicDocEͲ087ConductorAsbuiltsNAD27_NAD83.xlsx 1of211/2/2010 CompiledBy:CCDate:10/01/10CheckedBY:DHSDate:10/03/1063<,6/$1''5,//6,7(&RQGXFWRU$V%XLOWV$ODVND6WDWH3ODQH1$' 1$'Lounsbury&AssociatesEniͲNikaitchuqDoc.EͲ087Rev.0'Y' 'X' Latitude(N) Longitude(W) 'Y' 'X' Latitude(N) Longitude(W) F.N.L F.E.LPadElev.AlaskaStatePlane,NAD83GRID NAD83GeographicWellNo.SectionLineOffsetAlaskaStatePlane,NAD27GRID NAD27Geographic29 6,053,371.56 1,651,504.49 70°33'26.705" 149°54'32.602" 6,053,619.45 511,473.70 70°33'27.742" 149°54'21.219" 848 1436 12.430 6,053,370.06 1,651,496.66 70°33'26.690" 149°54'32.833" 6,053,617.96 511,465.87 70°33'27.728" 149°54'21.451" 849 1444 12.431 6,053,367.05 1,651,480.97 70°33'26.661" 149°54'33.296" 6,053,614.95 511,450.17 70°33'27.698" 149°54'21.914" 852 1460 12.432 6,053,365.47 1,651,473.16 70°33'26.646" 149°54'33.527" 6,053,613.37 511,442.37 70°33'27.683" 149°54'22.145" 854 1468 12.433 6,053,363.93 1,651,465.22 70°33'26.631" 149°54'33.762" 6,053,611.83 511,434.43 70°33'27.668" 149°54'22.379" 855 1476 12.434 6,053,362.44 1,651,457.37 70°33'26.616" 149°54'33.993" 6,053,610.33 511,426.58 70°33'27.653" 149°54'22.611" 857 1483 12.435 6,053,360.91 1,651,449.52 70°33'26.601" 149°54'34.225" 6,053,608.81 511,418.73 70°33'27.638" 149°54'22.843" 858 1491 12.436 6,053,359.33 1,651,441.62 70°33'26.586" 149°54'34.459" 6,053,607.23 511,410.83 70°33'27.623" 149°54'23.076" 860 1499 12.437 6,053,356.19 1,651,425.30 70°33'26.555" 149°54'34.941" 6,053,604.09 511,394.51 70°33'27.592" 149°54'23.558" 863 1516 12.438 6,053,354.74 1,651,417.32 70°33'26.541" 149°54'35.177" 6,053,602.64 511,386.54 70°33'27.578" 149°54'23.794" 864 1524 12.4DocEͲ087ConductorAsbuiltsNAD27_NAD83.xlsx 2of211/2/2010 631(/3E3URSRVDO*HRGHWLF5HSRUW'HI3ODQ&RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW16IW(:IW7)'/6IW'LUHFWLRQDO'LIILFXOW\,QGH[([FOXVLRQ=RQH$OHUW([FOXVLRQ=RQH$QJOH*HR0DJ7KQ71RUWKLQJIW86(DVWLQJIW86/DWLWXGH16 /RQJLWXGH(: 7LH,Q6XUYH\ /1$ 1 : / 1 :7RS:KLSVWRFN 5 1 :%DVH:KLSVWRFN +6 1 :&UY 5 1 : 5 1 : 5 1 : 5 1 : 5 1 :&UY / 1 : / 1 : / 1 :OA Top 13101.00 88.33326.174035.024088.629719.44 10725.56-2952.49 91.74L 4.00 6.8682.4756905.776064387.74 508754.15 N 70 35 13.69 W 149 55 41.14 / 1 :OA-2 Top 13269.00 88.14 319.45 4040.19 4093.79 9885.90 10859.27-3053.9291.53L 4.00 6.89 83.1356988.536064521.26508652.51 N 70 35 15.01 W 149 55 44.14(QG&UY +6 1 : +6 1 :OA-3 Top 13387.00 88.11 318.49 4044.074097.6710003.6610947.71 -3131.93HS0.00 6.90 83.2357000.78 6064609.58 508574.37N 70 35 15.88 W 149 55 46.45&UY / 1 : / 1 : / 1 :63/7JW / 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 : +6 1 :Fault A 13903.00 90.01 311.80 4047.75 4101.35 10518.85 11300.78 -3507.67HS0.00 6.95 86.0357263.466064962.01 508198.11 N 70 35 19.35 W 149 55 57.56&UY 5 1 : 5 1 :63/7JW 5 1 : 5 1 :OA-2 Top 14118.00 88.54 315.934049.94 4103.54 10733.64 11448.68 -3663.62109.63R2.50 6.9784.00 57086.80 6065109.65 508041.94 N 70 35 20.80 W 149 56 2.18(QG&UY +6 1 : +6 1 :OA-3 Top 14220.00 88.22316.84 4053.00 4106.60 10835.5711522.83-3733.58 HS0.00 6.98 83.55 57038.266065183.69 507971.87N 70 35 21.53W 149 56 4.25 +6 1 :&UY / 1 : / 1 : / 1 :63/7JW / 1 : / 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 :&UY 5 1 : 5 1 :63/7JW 5 1 :OA-3 Top 15064.00 93.20 316.134042.34 4095.94 11679.08 12129.97-4319.21 26.52R1.00 7.04 88.58 57383.68 6065789.83507385.34 N 70 35 27.50 W 149 56 21.58 5 1 :(QG&UY +6 1 : +6 1 : +6 1 :7RWDO*UDYLW\)LHOG6WUHQJWKPJQ%DVHG7RWDO&RUU0DJ1RUWK!7UXH1RUWK*UDYLW\0RGHOQ7'2;7RWDO0DJQHWLF)LHOG6WUHQJWK0DJQHWLF'LS$QJOH1RUWK5HIHUHQFH0DUFK%**07UXH1RUWK*ULG&RQYHUJHQFH8VHGIWDERYH06/79'5HIHUHQFH(OHYDWLRQ*URXQG(OHYDWLRQIWDERYH06/)LHOG5HSRUW'DWH1LNDLWFKXT&OLHQW(QL3HWUROHXP)HEUXDU\$00LQLPXP&XUYDWXUH/XELQVNL7UXH1RUWKIWIW5RWDU\7DEOH6XUYH\'/6&RPSXWDWLRQ79'5HIHUHQFH'DWXP9HUWLFDO6HFWLRQ$]LPXWK9HUWLFDO6HFWLRQ2ULJLQ$3,631(/6WUXFWXUH6ORW:HOO%RUHKROH631(6S\,VODQG63/RFDWLRQ*ULG1(<;1$'$ODVND6WDWH3ODQH=RQH86)HHWIW&RRUGLQDWH5HIHUHQFH6\VWHP6XUYH\1DPH631(/3E6XUYH\'DWH*ULG6FDOH)DFWRU9HUVLRQ3DWFK:HOO+HDG/RFDO&RRUG5HIHUHQFHG7R0DJQHWLF'HFOLQDWLRQ'HFOLQDWLRQ'DWH0DJQHWLF'HFOLQDWLRQ0RGHO1 : 7RUW$+''',(5'5DWLR&56*ULG&RQYHUJHQFH$QJOH)HEUXDU\/RFDWLRQ/DW/RQJ1IW86(IW86'ULOOLQJ2IILFH$03DJHRI1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E^ĐŚůƵŵďĞƌŐĞƌͲWƌŝǀĂƚĞ &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW16IW(:IW7)'/6IW'LUHFWLRQDO'LIILFXOW\,QGH[([FOXVLRQ=RQH$OHUW([FOXVLRQ=RQH$QJOH*HR0DJ7KQ71RUWKLQJIW86(DVWLQJIW86/DWLWXGH16 /RQJLWXGH(: Fault B 15317.00 93.59 316.334026.64 4080.24 11931.5712312.55 -4493.64 HS0.00 7.0688.95 57391.366065972.12507210.64 N 70 35 29.29 W 149 56 26.74&UY 5 1 : 5 1 : 5 1 :63/7JW 5 1 : 5 1 :(QG&UY +6 1 :OA-3 Top 15670.00 91.78 320.90 4009.234062.8312283.5712575.39 -4728.39 HS0.00 7.09 86.55 57296.61 6066234.56506975.50 N 70 35 31.87W 149 56 33.68 +6 1 : +6 1 :OA-2 Top 15851.00 91.78 320.90 4003.61 4057.21 12463.68 12715.79 -4842.48 HS0.00 7.10 86.55 57296.55 6066374.76506861.19 N 70 35 33.25 W 149 56 37.06 +6 1 :&UY / 1 : / 1 :63/7JW / 1 : / 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 :&UY / 1 : / 1 :63/7JW / 1 : / 1 : / 1 :(QG&UY +6 1 :OA-2 Top 16706.00 88.18 313.81 3998.88 4052.48 13317.6213346.94 -5418.54 HS0.00 7.1683.9357079.04 6067004.94 506284.20 N 70 35 39.46W 149 56 54.11 +6 1 :OA-3 Top 16837.00 88.18 313.81 4003.04 4056.64 13448.50 13437.59 -5513.03HS0.00 7.1783.9357079.09 6067095.43506189.58 N 70 35 40.35 W 149 56 56.91 +6 1 :&UY 5 1 : 5 1 :63/7JW 5 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 : +6 1 :&UY / 1 : / 1 :63/7JW / 1 : / 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 :&UY 5 1 : 5 1 :63/7JW 5 1 : 5 1 :OA-3 Top 18108.00 91.54 315.734003.21 4056.81 14717.84 14306.66-6439.65 85.29R2.50 7.25 87.00 57322.036067962.94 505261.67N 70 35 48.89 W 149 57 24.34 5 1 :(QG&UY +6 1 : +6 1 : +6 1 :&UY / 1 : / 1 :63/7JW / 1 : / 1 : / 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 :&UY / 1 :63/7JW / 1 : / 1 : / 1 :(QG&UY +6 1 : +6 1 :OA-2 Top 19310.00 88.56306.763993.174046.7715916.64 15133.79 -7308.30 HS0.00 7.34 85.3257208.98 6068788.62504391.81 N 70 35 57.01 W 149 57 50.06 +6 1 :&UY 5 1 :OA-3 Top 19446.00 88.60 307.363996.59 4050.19 16051.04 15215.26-7417.15 85.71R2.50 7.34 85.2757205.45 6068869.90 504282.84 N 70 35 57.81 W 149 57 53.28 5 1 :63/7JW 5 1 : 5 1 :'ULOOLQJ2IILFH$03DJHRI1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E^ĐŚůƵŵďĞƌŐĞƌͲWƌŝǀĂƚĞ &RPPHQWV0'IW,QFO$]LP7UXH79'66IW79'IW96(&IW16IW(:IW7)'/6IW'LUHFWLRQDO'LIILFXOW\,QGH[([FOXVLRQ=RQH$OHUW([FOXVLRQ=RQH$QJOH*HR0DJ7KQ71RUWKLQJIW86(DVWLQJIW86/DWLWXGH16 /RQJLWXGH(: (QG&UY +6 1 : +6 1 : +6 1 : +6 1 :&UY 5 1 : 5 1 :63/7JW 5 1 : 5 1 : 5 1 :(QG&UY +6 1 : +6 1 : +6 1 :&UY / 1 : / 1 :63/7JW / 1 :Fault C20594.00 91.91 316.163989.85 4043.45 17196.3316030.12-8221.95 96.34L 2.50 7.4387.30 57337.05 6069683.41 503476.83N 70 36 5.82W 149 58 17.12 / 1 :(QG&UY +6 1 : +6 1 : +6 1 :OA-3 Top 20839.00 91.69 314.233982.474036.0717441.18 16201.87-8396.50 HS0.00 7.44 87.35 57339.366069854.86503302.03N 70 36 7.51 W 149 58 22.29 +6 1 :OA-2 Top 20934.00 91.69 314.233979.674033.2717536.11 16268.11 -8464.54 HS0.00 7.44 87.35 57339.34 6069920.99 503233.89 N 70 36 8.16W 149 58 24.30&UY / 1 : / 1 :63/7JW / 1 : / 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 : +6 1 :&UY 5 1 :63/7JW 5 1 : 5 1 :(QG&UY +6 1 : +6 1 : +6 1 : +6 1 : +6 1 :7' 1 :3DUW0')URPIW0'7RIW(28)UHTIW+ROH6L]HLQ&DVLQJ'LDPHWHULQ([SHFWHG0D[,QFOLQDWLRQGHJ $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 7'%+/ )6/)(/6715(80 7RS2$ )6/)(/6715(80 6XUIDFH )6/)(/6715(80 7LH,Q )6/)(/6715(80 6/%B0:'*0$* 631(/631(/3E/HJDO'HVFULSWLRQ1RUWKLQJ< (DVWLQJ;6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:',1&B21/<B),//(5 631(/631(/3E6/%B0:'6$* 631(/631(/3E6/%B0:'*0$* 631(631(6/%B0:'*0$* 631(/631(/3E6/%B0:'*0$* 631(3+631(3+6/%B0:',1&B21/<B),//(5 631(631(6/%B*:' 631(3%631(3%6/%B0:'*0$* 631(3%631(3%'HVFULSWLRQ6XUYH\7RRO7\SH %RUHKROH6XUYH\6XUYH$UURU0RGHO,6&:6$5HY '&RQILGHQFHVLJPD6XUYH\3URJUDP'ULOOLQJ2IILFH$03DJHRI1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E^ĐŚůƵŵďĞƌŐĞƌͲWƌŝǀĂƚĞ %RUHKROH :HOO )LHOG 6WUXFWXUH631(/3E 631( 1LNDLWFKXT 6S\,VODQG*UDYLW\ 0DJQHWLF3DUDPHWHUV 6XUIDFH/RFDWLRQ 1$'$ODVND6WDWH3ODQH=RQH86)HHW 0LVFHOODQHRXV0RGHO %**0 'LS 'DWH 0DU0DJ'HF )6 Q7 *UDYLW$6 PJQ%DVHG/DW 1 1RUWKLQJ IW86 *ULG&RQY /RQ : (DVWLQJ IW86 6FDOH)DFW 6ORW 63 79'5HI 5RWDU\7DEOHIWDERYH06/3ODQ 631(/3E 9HUWLFDO6HFWLRQIW$]LP 6FDOH IW2ULJLQ 16(:79'IW6FDOH IW631(/3E7LH,Q6XUYH\0'79'7RS:KLSVWRFN0'79'%DVH:KLSVWRFN0'79'&UY0'79'&UY0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'631(3+631(0'79'0'79'631(3%631(/631(3%9HUWLFDO6HFWLRQIW$]LP 6FDOH IW2ULJLQ 16(:79'IW6FDOH IW631(/3E&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'7'0'79'631(3%631(/ (:IW6FDOH IW16IW6FDOH IW631(/3E7LH,Q6XUYH\0'79'7RS:KLSVWRFN0'79'%DVH:KLSVWRFN0'79'&UY0'79'&UY0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'&UY0'79'63/7JW0'79'(QG&UY0'79'7'0'79'631(3+631(0'79'0'79'631(3%631(/631(3%(1,/HDVH/LQH7$'/%RUHKROH :HOO )LHOG 6WUXFWXUH631(/3E 631( 1LNDLWFKXT 6S\,VODQG*UDYLW\ 0DJQHWLF3DUDPHWHUV 6XUIDFH/RFDWLRQ 1$'$ODVND6WDWH3ODQH=RQH86)HHW 0LVFHOODQHRXV0RGHO %**0 'LS 'DWH 0DU0DJ'HF )6 Q7 *UDYLW\)6 PJQ%DVHG/DW 1 1RUWKLQJ IW86 *ULG&RQY /RQ : (DVWLQJ IW86 6FDOH)DFW 6ORW 63 79'5HI 5RWDU\7DEOHIWDERYH06/3ODQ 631(/3E7UXH1RUWK7RW&RUU0!70DJ'HF*ULG&RQY7UXH*ULG0DJ %RUHKROH :HOO )LHOG 6WUXFWXUH631(/3E 631( 1LNDLWFKXT 6S\,VODQG*UDYLW\ 0DJQHWLF3DUDPHWHUV 6XUIDFH/RFDWLRQ 1$'$ODVND6WDWH3ODQH=RQH86)HHW 0LVFHOODQHRXV0RGHO %**0 'LS 'DWH 0DU0DJ'HF )6 Q7 *UDYLW\)6 PJQ%DVHG/DW 1 1RUWKLQJIW86*ULG&RQY /RQ : (DVWLQJ IW86 6FDOH)DFW 6ORW 63 79'5HI 5RWDU\7DEOHIWDERYH06/3ODQ 631(/3E(:IW6FDOH IW16IW6FDOH IW631(/3E79'79'79'79'79'79'79'631(3+79'79'6,)179'79'79'79'79'79'79'79'79'79'79'79'79'63)179'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'63)1/79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'6,(379'6,1(379'79'79'79'79'79'79'79'79'63)179'63(379'79'1179'63)13%79'79'79'79'79'79'79'79'79'6,1(79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(79'79'63)1/3E79'79'79'79'79'79'79'79'631(3%79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'63)179'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(/79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(379'79'79'79'79'79'6,)179'79'79'79'79'79'79'631(3%79'79'(1,/HDVH/LQH$'/(1,/HDVH/LQH7$'/ %RUHKROH :HOO )LHOG 6WUXFWXUH631(/3E 631( 1LNDLWFKXT 6S\,VODQG*UDYLW\ 0DJQHWLF3DUDPHWHUV 6XUIDFH/RFDWLRQ 1$'$ODVND6WDWH3ODQH=RQH86)HHW 0LVFHOODQHRXV0RGHO %**0 'LS 'DWH 0DU0DJ'HF )6 Q7 *UDYLW\)6 PJQ%DVHG/DW 1 1RUWKLQJIW86*ULG&RQY /RQ : (DVWLQJ IW86 6FDOH)DFW 6ORW 63 79'5HI 5RWDU\7DEOHIWDERYH06/3ODQ 631(/3E(:IW6FDOH IW16IW6FDOH IW631(/3E79'79'79'79'79'79'79'79'79'79'79'79'631(3+79'79'79'79'79'79'63(/79'79'79'79'79'79'63)179'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'6,(379'6,1(379'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'63(379'79'79'79'63)13%79'79'79'79'79'79'79'79'79'79'79'6,1(79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'63(79'79'79'79'79'631(79'79'79'79'79'63)1/3E79'79'79'79'79'79'79'79'79'631(3%79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(/79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(379'79'79'79'79'79'79'79'79'79'631(3%79'79'79'79'79'79'(1,/HDVH/LQH$'/(1,/HDVH/LQH7$'/7UXH*ULG0DJ 631( 631(3% 631(/ 631(3% 75$9(/,1*&</,1'(53/27 &OLHQW (QL3HWUROHXP )LHOG 1LNDLWFKXT 6WUXFWXUH 6S\,VODQG :HOO 631( %RUHKROH 631(/ 'DWH )HE 1R*R5HJLRQ(28 VEDVHGRQ2ULHQWHG(28'LPHQVLRQ0LQRU5LVN $QWL&ROOLVLRQUXOHXVHG' 0$QWL&ROOLVLRQ6WDQGDUG6Y :HOO7LFNV7\SH 0'RQ631(/3E &DOFXODWLRQ0HWKRG 1RUPDO3ODQH 5LQJ,QWHUYDO IW $]LPXWK,QWHUYDO GHJ 6WDUW'HSWK IW (QG'HSWK IW 2IIVHW:HOO&RXQW 631( 631(3% 631(/ 631(3% 75$9(/,1*&</,1'(53/27 &OLHQW (QL3HWUROHXP )LHOG 1LNDLWFKXT 6WUXFWXUH 6S\,VODQG :HOO 631( %RUHKROH 631(/ 'DWH )HE 1R*R5HJLRQ(28 VEDVHGRQ2ULHQWHG(28'LPHQVLRQ0LQRU5LVN $QWL&ROOLVLRQUXOHXVHG' 0$QWL&ROOLVLRQ6WDQGDUG6Y :HOO7LFNV7\SH 0'RQ631(/3E &DOFXODWLRQ0HWKRG 1RUPDO3ODQH 5LQJ,QWHUYDO IW $]LPXWK,QWHUYDO GHJ 6WDUW'HSWK IW (QG'HSWK IW 2IIVHW:HOO&RXQW $QDO\VLV'DWHKU7LPH &OLHQW )LHOG 6WUXFWXUH 6ORW :HOO %RUHKROH 6FDQ0'5DQJH 7UDMHFWRU$UURU0RGHO :HOOKHDGGLVWDQFHVFDQ 6HOHFWLRQILOWHUV 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU )DLO0DMRU 26) 26) 26) 26) (QWHU0DMRU 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 631(3%'HI6XUYH$DLO0DMRU 26) 26) 26) 26) (QWHU0DMRU 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 631(/'HI6XUYH\)DLO0DMRU 26) 26) 26) 26) (QWHU0DMRU 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 26)! ([LW0DMRU 26) 26)! ([LW0LQRU 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3WV 26) 0LQ3WV 26) 0,1372(28 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3WV 26) 26) (QWHU0LQRU 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 26) (QWHU0DMRU 26) 0LQ3WV 631(3%'HI6XUYH\)DLO0DMRU 26) 26) 26) 26) (QWHU0DMRU 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 $OO1RQ'HI6XUYH\VZKHQQR'HI6XUYH\LVVHWLQDERUHKROH$OO1RQ'HI3ODQVZKHQQR'HI3ODQLVVHWLQDERUHKROH 'DWDEDVH?3URMHFW ,6&:6$'&RQILGHQFHVLJPDIRUVXEMHFWZHOO)RU RIIVHWZHOOVHUURUPRGHOYHUVLRQLVVSHFLILHGZLWKHDFKZHOOUHVSHFWLYHO\ 631('HI6XUYH\ (YHU\0HDVXUHG'HSWKIW1LNDLWFKXT 'HSWK,QWHUYDO ' 0$QWL&ROOLVLRQ6WDQGDUG6Y $OOORFDOPLQLPDLQGLFDWHG 6S\,VODQG 6HSDUDWLRQ 631(/ 2IIVHW7UDMHFWRULHV6XPPDU\ 2IIVHW6HOHFWLRQ&ULWHULD 1RWSHUIRUPHG 'HILQLWLYH6XUYH\V'HILQLWLYH3ODQV'HILQLWLYHVXUYH\VH[FOXGHGHILQLWLYHSODQV ORFDOKRVW?GULOOLQJ1LNDLWFKXT 5LVN/HYHO 631(/3E$QWL&ROOLVLRQ6XPPDU\5HSRUW 9HUVLRQ3DWFK 63 631( 0LQ3WV 5XOH6HW 5HIHUHQFH7UDMHFWRU\ 1RUPDO3ODQH 631(/3E'HI3ODQ(QL3HWUROHXP )HEUXDU\$QDO\VLV0HWKRG IWaIW 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3WV 6,1(3'HI3ODQ:DUQLQJ$OHUW 26) 26) (QWHU$OHUW 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 6,1('HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 631(3'HI3ODQ3DVV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 7' 631(3+'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 11'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 63)1'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 63)13%'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 63)1/3E'HI3ODQ3DVV 26) 0LQ3W&W&W 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0,1372(28 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 631/'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0LQ3WV 6,)1'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0,1372(28 26) 0LQ3W&W&W 26) 0,1372(28 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 63)1'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 63)1/'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 6,)1'HI6XUYH\3DVV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W2$'3 26) 0,1372(28 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 63)1'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 63)1/'HI6XUYH\3DVV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 6,)1'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3W&W&W 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 63)1'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 63)13%'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W&W&W 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 63)13%'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 63)13%'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0,1372(28 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 63)13%'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 631:/'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 631:3%'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3WV 631:'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 6,1:'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 63:'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 63:/'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 631:'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 631:/'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W2$'3 26) 0LQ3WV 6,:'HI6XUYH\3DVV 26) 0LQ3W26) 26) 0LQ3WV 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3WV 63:'HI6XUYH\3DVV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 63:/'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 6,:'HI6XUYH\3DVV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 63:'HI6XUYH\3DVV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0,1372(28 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3WV 63:/'HI6XUYH\3DVV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3WV 6,:'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W2$'3 26) 0,1372(28 26) 0LQ3W&W&W 26) 0LQ3WV 26) 0LQ3W&W&W 26) 0,1372(28 26) 0LQ3W2$'3 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3W26) 26) 0LQ3W26) 63:/'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 26) 0LQ3WV 26) 0LQ3WV 63:'HI6XUYH\3DVV 26) 0LQ3WV 26) 0LQ3WV 26) 0LQ3W26) 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 2IIVHW7UDMHFWRU\ $OORZ 6HS &RQWUROOLQJ 5HIHUHQFH7UDMHFWRU\$OHUW 6WDWXV &W&WIW 0$6IW (28IW 'HYIW )DFW 5XOH 0'IW 79'IW $OHUW 0LQRU 0DMRU 6HSDUDWLRQ 5LVN/HYHO 26) 0LQ3WV 26) 0LQ3WV 6''63'HI6XUYH\3DVV 6,1'HI6XUYH\3DVV 636(/'HI6XUYH\3DVV 63(/'HI6XUYH\3DVV 636('HI6XUYH\3DVV 636('HI6XUYH\3DVV 6,13%'HI6XUYH\3DVV 6,6('HI6XUYH\3DVV 63:3%'HI6XUYH\3DVV 636(/'HI6XUYH\3DVV 631'HI6XUYH\3DVV 636('HI6XUYH\3DVV 631(3%'HI6XUYH\3DVV 6313%'HI6XUYH\3DVV 631'HI6XUYH\3DVV 6,1'HI6XUYH\3DVV 631/'HI6XUYH\3DVV 63:/3%'HI6XUYH\3DVV 6,(3'HI3ODQ3DVV 6,6('HI6XUYH\3DVV 6,6(3%'HI6XUYH\3DVV 636('HI6XUYH\3DVV 631/'HI6XUYH\3DVV 631/'HI6XUYH\3DVV 636(/'HI6XUYH\3DVV 6,6('HI6XUYH\3DVV 6,6(3%'HI6XUYH\3DVV 6,6'HI6XUYH\3DVV 63(3'HI3ODQ3DVV 6,(*0$*1RQ'HI 6XUYH\3DVV 631'HI6XUYH\3DVV 631'HI6XUYH\3DVV 6,(3F'HI3ODQ3DVV 6,1'HI6XUYH\3DVV 6313%'HI6XUYH\3DVV 636(/'HI6XUYH\3DVV 63('HI6XUYH\3DVV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E 3DJHRI 6/%$OHUW=RQH7KUHVKROG&W&W P6Y $OHUW &7B&7 0$6 IW 6/%6XUIDFH5XOH6Y 0DMRU &7B&7 0$6 IW 6/%0DMRU5LVN7KUHVKROG26) 6Y 0DMRU 5DWLR 26) 6/%0LQRU5LVN7KUHVKROG26) 6Y 0LQRU 5DWLR 26) ; 6/%$OHUW=RQH7KUHVKROG26) 6Y $OHUW 5DWLR 26) 5XOH1DPH 5LVN/HYHO 5XOH7\SH 5XOH/DEHO 1R*R5XOH 5HVXOWVKLJKOLJKWHG(28(28VHSDUDWLRQ IW $QWL&ROOLVLRQ5XOHV8VHG 5XOH6HW1DPH ' 0$QWL&ROOLVLRQ6WDQGDUG6Y([HPSWLRQ5LVN/HYHO0LQRU 127(0HDVXUHG'HSWKLVUHIHUHQFHGWRLQGLYLGXDOERUHKROHHOHYDWLRQ 79'16(:DUHUHIHUHQFHGWRWKHUHIHUHQFHWUDMHFWRU\ VZHOOKHDGORFDWLRQDQGERUHKROHHOHYDWLRQ $PLQLPXPRIPLVDOZD\VLQFOXGHGIRUERUHKROHGLDPHWHUV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 'DWDEDVH?3URMHFWORFDOKRVW?GULOOLQJ1LNDLWFKXT 9HUVLRQ3DWFK $QDO\VLV'DWHKU7LPH)HEUXDU\1RUWK5HIHUHQFH7UXH $QDO\VLV0DFKLQH6/%+.'4+&OLHQW (QL3HWUROHXP 'HSWK,QWHUYDO(YHU\IW0HDVXUHG'HSWK $]LPXWK8QLWGHJ 6WHSGRZQ7UDMHFWRU\5HIHUHQFH7UDMHFWRU\7&$]LPXWK5HIHUHQFH1RUWK 631(/3E$QWL&ROOLVLRQ'HWDLOHG5HSRUW $QDO\VLV0HWKRG'/HDVW'LVWDQFH 'LVWDQFH8QLWIW 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 0DUFK 3DUW 0')URPIW 0'7RIW (28)UHTIW $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'6$*1R*OREDO 631(/631(/3E 6/%B0:',1&B21/<B),//(51R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(/631(/3E 6/%B0:'*0$*1R*OREDO 631(631( 6/%B0:',1&B21/<B),//(51R*OREDO 631(631( 6/%B0:'*0$*1R*OREDO 631(3+631(3+ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B*:'1R*OREDO 631(3%631(3% %RUHKROH6XUYH\ 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ:KLOH'ULOOLQJ 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2L2 (P1b) &OLHQWEni Petroleum Def Plan 5HIHUHQFH7UDMHFWRU\6XPPDU\ )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2L2 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 631(3% 631(3% 631( 'HI6XUYH\ 63)1/3E 3ODQ63)1/ 63)1 'HI3ODQ 63)163)1 63)1 'HI6XUYH\ 63)13% 63)13% 63)1 'HI6XUYH\ 1111 11 'HI6XUYH\ 631(3 631( 631(3ODQ 'HI3ODQ 631(3+ 631(3+ 631( 'HI6XUYH\ 63(3 63( 63(3ODQ 'HI3ODQ 6,1(6,1( 6,1( 'HI6XUYH\ 63(/63(/ 63( 'HI6XUYH\ 6,1(3 6,1( 6,1(3ODQ 'HI3ODQ 63(63( 63( 'HI6XUYH\ 6,(3 6,( 6,(3ODQ 'HI3ODQ 631(3% 631(3% 631( 'HI6XUYH\ 631(/ 631(/ 631( 'HI6XUYH\ 631(3% 631(3% 631( 'HI6XUYH\ 3DVVLQJ([FOXGHG 631(631( 631( 'HI6XUYH\ 1RQ'HI3ODQV6HOHFWHG 7RWDO7UDMHFWRULHV 26)ILOWHULQGHWDLOHGUHSRUW1RQH ([FOXGHG7KHWUDMHFWRU\ZDVDQDO\]HGDQGIXOO\SDVVHGDOOFULWHULDVRWKHGHWDLOHGUHVXOWVKDYHEHHQH[FOXGHGIURPWKLVUHSRUWIRUFODULW\ 7UDMHFWRU\%RUHKROH :HOO 7\SH :HOOV6HOHFWHG %RUHKROHV6HOHFWHG 'HILQLWLYH6XUYH\V6HOHFWHG 1RQ'HI6XUYH\V6HOHFWHG 'HILQLWLYH3ODQV6HOHFWHG 2IIVHW7UDMHFWRU\6XPPDU\ 2IIVHW6HOHFWLRQ&ULWHULD 2IIVHW6HOHFWLRQ&ULWHULD'HILQLWLYH6XUYH\V'HILQLWLYH3ODQV'HILQLWLYHVXUYH\VH[FOXGHGHILQLWLYHSODQV $OO1RQ'HI6XUYH\VZKHQQR'HI6XUYH\LVVHWLQDERUHKROH$OO1RQ'HI3ODQVZKHQQR'HI3ODQLVVHWLQDERUHKROH 2IIVHW6HOHFWLRQ6XPPDU\ 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XO\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) :DUQLQJ 26) :DUQLQJ 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 631(3%631(3% EKD 6/%B0:'*0$*1R*OREDO 631(3%631(3% EKD 6/%B0:'*0$*1R*OREDO 631(3%631(3% EKD 6/%B0:',1&B21/<B),//(51R*OREDO 631(3%631(3% 6/%B0:'*0$*1R*OREDO 631(3+631(3+ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B*:'1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2PB2 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2PB2 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V631(3% (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XO\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 631(/631(/ EKD 6/%B0:'*0$*1R*OREDO 631(/631(/ EKD 6/%B0:',1&B21/<B),//(51R*OREDO 631(/631(/ 72: 6/%B0:'*0$*1R*OREDO 631(/631(/ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B0:',1&B21/<B),//(51R*OREDO 631(3%631(3% 6/%B0:'*0$*1R*OREDO 631(3+631(3+ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B*:'1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2L1 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2L1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 7UDMHFWRU\631(/3E9V631(/ (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XO\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 631(3%631(3% EKD 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B0:',1&B21/<B),//(51R*OREDO 631(3%631(3% 6/%B0:'*0$*1R*OREDO 631(3+631(3+ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B*:'1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2PB3 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2PB3 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 7UDMHFWRU\631(/3E9V631(3% (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XO\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) )DLO 26) :DUQLQJ 26) :DUQLQJ 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 631(631( EKD 6/%B0:'*0$*1R*OREDO 631(631( EKD 6/%B0:'*0$*1R*OREDO 631(631( EKD 6/%B0:',1&B21/<B),//(51R*OREDO 631(631( 6/%B0:'*0$*1R*OREDO 631(3+631(3+ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B*:'1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V631( (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 3DUW 0')URPIW 0'7RIW (28)UHTIW 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B0:'*0$*1R*OREDO 6,(6,(3 6/%B0:'6$*1R*OREDO 6,(6,(3 6/%B0:'*0$*1R*OREDO 6,(6,(3 6/%B0:'6$*1R*OREDO 6,(6,(3 6/%B0:'*0$*1R*OREDO 6,(6,(3 6/%B0:'6$*1R*OREDO 6,(6,(3 6/%B*:'1R*OREDO 6,(6,(3 %RUHKROH6XUYH\ 6/%B*:''HSWK2QO\1R*OREDO 6,(6,(3 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ:KLOH'ULOOLQJ 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO+'*0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP42 SI42-E3 (P2) &OLHQWEni Petroleum Def Plan )LHOGNikaitchuq SI42-E3 - Plan 6WUXFWXUHSpy Island SI42-E3 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V6,(3 (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 1RYHPEHU 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B%/,1'75(1'1R*OREDO 63(63( 6/%B'8$/*0$*6$*1R*OREDO 63(63( 6/%B'8$/*0$*6$*1R*OREDO 63(63( 6/%B0:',1&B21/<B),//(51R*OREDO 63(63( 6/%B0:'*0$*1R*OREDO 63(63( 6/%B*<520:'6$*1R*OREDO 63(63( 6/%B*<520:'6$*'HSWK2QO\1R*OREDO 63(63( 6/%B*<520:'6$*'HSWK2QO\1R*OREDO 63(63( 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO+'*0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP09 SP09-E2 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP09-E2 6WUXFWXUHSpy Island SP09-E2 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V63( (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 3DUW 0')URPIW 0'7RIW (28)UHTIW 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B0:'*0$*1R*OREDO 6,1(6,1(3 6/%B0:'6$*1R*OREDO 6,1(6,1(3 6/%B0:'*0$*1R*OREDO 6,1(6,1(3 6/%B0:'6$*1R*OREDO 6,1(6,1(3 6/%B0:'*0$*1R*OREDO 6,1(6,1(3 6/%B0:'6$*1R*OREDO 6,1(6,1(3 6/%B*:'1R*OREDO 6,1(6,1(3 %RUHKROH6XUYH\ 6/%B*:''HSWK2QO\1R*OREDO 6,1(6,1(3 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ:KLOH'ULOOLQJ 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO+'*0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP44 SI44-NE3 (P2) &OLHQWEni Petroleum Def Plan )LHOGNikaitchuq SI44-NE3 - Plan 6WUXFWXUHSpy Island SI44-NE3 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 26) :DUQLQJ 7UDMHFWRU\631(/3E9V6,1(3 (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 63(/63(/ EKD 6/%B'8$/*0$*6$*1R*OREDO 63(/63(/ EKD 6/%B0:',1&B21/<B),//(51R*OREDO 63(/63(/ 6/%B'8$/*0$*6$*1R*OREDO 63(63( 6/%B0:',1&B21/<B),//(51R*OREDO 63(63( 6/%B0:'*0$*1R*OREDO 63(63( 6/%B*<520:'6$*1R*OREDO 63(63( 6/%B*<520:'6$*'HSWK2QO\1R*OREDO 63(63( 6/%B*<520:'6$*'HSWK2QO\1R*OREDO 63(63( 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO+'*0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP09 SP09-E2L1 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP09-E2 6WUXFWXUHSpy Island SP09-E2L1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V63(/ (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -DQXDU\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 6,1(6,1( EKD 6/%B0:'*0$*1R*OREDO 6,1(6,1( EKD 6/%B0:'*0$*1R*OREDO 6,1(6,1( EKD 6/%B0:',1&B21/<B),//(51R*OREDO 6,1(6,1( EKD 6/%B0:'*0$*1R*OREDO 6,1(6,1( EKD6/%B*:'1R*OREDO 6,1(6,1( EKD 6/%B*:''HSWK2QO\1R*OREDO 6,1(6,1( EKD 6/%B*:''HSWK2QO\1R*OREDO 6,1(6,1( 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP06 SI06-NE1 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SI06-NE1 6WUXFWXUHSpy Island SI06-NE1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V6,1( (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 3DUW 0')URPIW 0'7RIW (28)UHTIW 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B0:'*0$*1R*OREDO 63(63(3 6/%B0:'6$*1R*OREDO 63(63(3 6/%B0:'*0$*1R*OREDO 63(63(3 6/%B0:'6$*1R*OREDO 63(63(3 6/%B0:'*0$*1R*OREDO 63(63(3 6/%B0:'6$*1R*OREDO 63(63(3 6/%B*:'1R*OREDO 63(63(3 %RUHKROH6XUYH\ 6/%B*:''HSWK2QO\1R*OREDO 63(63(3 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ:KLOH'ULOOLQJ 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO+'*0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP40 SP40-E4 (P2) &OLHQWEni Petroleum Def Plan )LHOGNikaitchuq SP40-E4 - Plan 6WUXFWXUHSpy Island SP40-E4 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V63(3 (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XO\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 631(3+631(3+ EKD 6/%B0:'*0$*1R*OREDO 631(3+631(3+ EKD 6/%B0:',1&B21/<B),//(51R*OREDO 631(3+631(3+ EKD 6/%B0:'*0$*1R*OREDO 631(3+631(3+ 6/%B0:'*0$*1R*OREDO 631(3%631(3% 6/%B*:'1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2PH1 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2PH1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V631(3+ (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 3DUW 0')URPIW 0'7RIW (28)UHTIW 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B0:'*0$*1R*OREDO 631(631(3 6/%B0:'6$*1R*OREDO 631(631(3 6/%B0:'*0$*1R*OREDO 631(631(3 6/%B0:'6$*1R*OREDO 631(631(3 6/%B0:'*0$*1R*OREDO 631(631(3 6/%B0:'6$*1R*OREDO 631(631(3 6/%B*:'1R*OREDO 631(631(3 %RUHKROH6XUYH\ 6/%B*:''HSWK2QO\1R*OREDO 631(631(3 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ:KLOH'ULOOLQJ 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO+'*0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP43 SP43-NE4 (P2) &OLHQWEni Petroleum Def Plan )LHOGNikaitchuq SP43-NE4 - Plan 6WUXFWXUHSpy Island SP43-NE4 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V631(3 (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XQH 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 1111 EKD 6/%B'8$/*0$*6$*1R*OREDO 1111 EKD 6/%B0:',1&B21/<B),//(51R*OREDO 1111 EKD 6/%B'8$/*0$*6$*1R*OREDO 1111 EKD6/%B*:'1R*OREDO 1111 EKD 6/%B*:''HSWK2QO\1R*OREDO 1111 EKD 6/%B*:''HSWK2QO\1R*OREDO 1111 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP39 NN01 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq NN01 6WUXFWXUHSpy Island NN01 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V11 (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B%/,1'75(1'1R*OREDO 63)163)1 6/%B0:'*0$*1R*OREDO 63)163)1 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B16*06+271R*OREDO 63)13%63)13% 6/%B16*06+27'HSWK2QO\1R*OREDO 63)13%63)13% 6/%B16*06+27'HSWK2QO\1R*OREDO 63)13%63)13% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP05 SP05-FN7 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP05-FN7 6WUXFWXUHSpy Island SP05-FN7 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V63)1 (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH 'HFHPEHU 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B%/,1'75(1'1R*OREDO 63)13%63)13% 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B16*06+271R*OREDO 63)13%63)13% 6/%B16*06+27'HSWK2QO\1R*OREDO 63)13%63)13% 6/%B16*06+27'HSWK2QO\1R*OREDO 63)13%63)13% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP05 SP05-FN7PB1 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP05-FN7 6WUXFWXUHSpy Island SP05-FN7PB1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V63)13% (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH )HEUXDU\ 3DUW 0')URPIW 0'7RIW (28)UHTIW $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW 6/%B'8$/*0$*6$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'67'1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:',1&B21/<B),//(51R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 3ODQ63)1/63)1/3E 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B0:'*0$*1R*OREDO 63)13%63)13% 6/%B16*06+271R*OREDO 63)13%63)13% %RUHKROH6XUYH\ 6/%B16*06+27'HSWK2QO\1R*OREDO 63)13%63)13% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ:KLOH'ULOOLQJ 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP05 SP05-FN7L1 (P3b) &OLHQWEni Petroleum Def Plan )LHOGNikaitchuq SP05-FN7 6WUXFWXUHSpy Island Plan: SP05-FN7L1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V63)1/3E (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI :HOO %RUHKROH 7UDMHFWRU\ 7\SH -XO\ 0')URPIW 0'7RIW (28)UHT $FW6WQV $FW6WQV $FW6WQV $FW6WQV 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV $OOORFDOPLQLPDLQGLFDWHG 5HVXOWVILOWHUHG'HSWKIW 0' IW 5HVXOWVKLJKOLJKWHG&W&WVHSDUDWLRQ IW EKD 6/%B%/,1'75(1'1R*OREDO 631(3%631(3% EKD 6/%B0:'*0$*1R*OREDO 631(3%631(3% EKD6/%B*:'1R*OREDO 631(3%631(3% EKD 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% EKD 6/%B*:''HSWK2QO\1R*OREDO 631(3%631(3% 7UDMHFWRU\(UURU0RGHO,6&:6$'&RQILGHQFHVLJPD 6XUYH\LQJ3URJ$V'ULOOHG 'HVFULSWLRQ 6XUYH\7RRO7\SH +ROH6L]HLQ &DVLQJ'LDPHWHULQ %RUHKROH6XUYH\ IW86 IW86 IW06/ IWVLJPD IWVLJPD 1RUWKLQJ (DVWLQJ (OHYDWLRQ 6WUXFWXUH8QF6ORW8QF 5HIHUHQFH3RLQW 0DJQHWLF'HFOLQDWLRQ0DJQHWLF'HFOLQDWLRQ'DWH 0DJQHWLF0RGHO%**0 &RRUGLQDWH6\VWHPNAD27 Alaska State Plane, Zone 04, US Feet 1RUWK5HIHUHQFH7UXH *ULG&RQYHUJHQFH$QJOH*ULG6FDOH)DFWRU 6ORWSP03 SP03-NE2PB1 &OLHQWEni Petroleum Def Survey )LHOGNikaitchuq SP03-NE2 6WUXFWXUHSpy Island SP03-NE2PB1 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI 5HIHUHQFH0' 5HIHUHQFH79' 5HIHUHQFH16 5HIHUHQFH(: 2IIVHW0' 2IIVHW79' 2IIVHW16 2IIVHW(: 7UDYHOLQJ&\OLQGHU 1RUWK$]LP &W&W'LVWDQFH 0LQLPXP $OORZDEOH 6HSDUDWLRQ $OORZDEOH 'HYLDWLRQIURP 5HIHUHQFH (28(28 &OHDUDQFH 26) &RQWUROOLQJ 5XOH 6WDWXV IW IW IW IW IW IW IW IW IW IW IW IW 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 26) 3DVV 7UDMHFWRU\631(/3E9V631(3% (QGRIUHVXOWV 'ULOOLQJ2IILFH 1LNDLWFKXT?6S\,VODQG?631(?631(/?631(/3E $03DJHRI %RUHKROH :HOO )LHOG 6WUXFWXUH631(/3E 631( 1LNDLWFKXT 6S\,VODQG*UDYLW\ 0DJQHWLF3DUDPHWHUV 6XUIDFH/RFDWLRQ 1$'$ODVND6WDWH3ODQH=RQH86)HHW 0LVFHOODQHRXV0RGHO %**0 'LS 'DWH 0DU0DJ'HF )6 Q7 *UDYLW\)6 PJQ%DVHG/DW 1 1RUWKLQJIW86*ULG&RQY /RQ : (DVWLQJ IW86 6FDOH)DFW 6ORW 63 79'5HI 5RWDU\7DEOHIWDERYH06/3ODQ 631(/3E(:IW6FDOH IW16IW6FDOH IW631(/3E79'79'79'79'79'79'79'79'79'79'79'79'631(3+79'79'79'79'79'79'63(/79'79'79'79'79'79'63)179'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'6,(379'6,1(379'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'63(379'79'79'79'63)13%79'79'79'79'79'79'79'79'79'79'79'6,1(79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'63(79'79'79'79'79'631(79'79'79'79'79'63)1/3E79'79'79'79'79'79'79'79'79'631(3%79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(/79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'79'631(379'79'79'79'79'79'79'79'79'79'631(3%79'79'79'79'79'79'(1,/HDVH/LQH$'/(1,/HDVH/LQH7$'/7UXH*ULG0DJ &DUOLVOH6DPDQWKD-2*& )URP0F/HOODQ%U\DQ-2*& 6HQW0RQGD\)HEUXDU\30 7R&KDXGKU\$PMDG 6XEMHFW5(>(;7(51$/@631(/37'TXHVWLRQV ŵũĂĚ͕ WůĞĂƐĞĚĞƉŝĐƚĂůůϯůĂƚĞƌĂůƐŽŶƚŚĞĨŝŶĂůĚŝĂŐƌĂŵƚŚĂƚǇŽƵƐƵďŵŝƚǁŝƚŚƚŚĞϭϬͲϰϬϳ͘ dŚĂŶŬǇŽƵ ƌǇĂŶDĐ>ĞůůĂŶ ^ĞŶŝŽƌWĞƚƌŽůĞƵŵŶŐŝŶĞĞƌ ůĂƐŬĂKŝůΘ'ĂƐŽŶƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶ ϯϯϯtϳƚŚǀĞ ŶĐŚŽƌĂŐĞ͕<ϵϵϱϬϭ ƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀ нϭ;ϵϬϳͿϮϱϬͲϵϭϵϯ &ƌŽŵ͗ŚĂƵĚŚƌǇŵũĂĚфŵũĂĚ͘ŚĂƵĚŚƌǇΛĞŶŝ͘ĐŽŵх ^ĞŶƚ͗&ƌŝĚĂǇ͕&ĞďƌƵĂƌǇϭϭ͕ϮϬϮϮϰ͗ϬϱWD dŽ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх ^ƵďũĞĐƚ͗Z͗΀ydZE>΁^WϬϯͲEϮ>Ϯ;WdϮϮϮͲϬϭϱͿƋƵĞƐƚŝŽŶƐ ,ĞůůŽƌǇĂŶ͕ƉůĞĂƐĞƐĞĞŵǇĐŽŵŵĞŶƚƐŝŶƌĞĚ͕ƚŚĂŶŬƐ ŵũĂĚ &ƌŽŵ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх ^ĞŶƚ͗&ƌŝĚĂǇ͕&ĞďƌƵĂƌǇϭϭ͕ϮϬϮϮϭ͗ϬϬWD dŽ͗ŚĂƵĚŚƌǇŵũĂĚфŵũĂĚ͘ŚĂƵĚŚƌǇΛĞŶŝ͘ĐŽŵх ^ƵďũĞĐƚ͗΀ydZE>΁^WϬϯͲEϮ>Ϯ;WdϮϮϮͲϬϭϱͿƋƵĞƐƚŝŽŶƐ dŚŝƐŵĞƐƐĂŐĞŝƐĨƌŽŵĂŶydZE>^EZƚŽƚŚĞŶŝƐǇƐƚĞŵƐ͗ƉĂǇddEd/KE͕ĞƐƉĞĐŝĂůůǇǁŝƚŚůŝŶŬƐĂŶĚĂƚƚĂĐŚŵĞŶƚƐ͘ ŵũĂĚ͕ ĐŽƵƉůĞƋƵĞƐƚŝŽŶƐĂďŽƵƚƚŚĞĚƌŝůůŝŶŐƉůĂŶĨŽƌƚŚŝƐǁĞůů͗ ϭ͘tŚĂƚŝƐŚĂƉƉĞŶŝŶŐǁŝƚŚƚŚĞŽƌŝŐŝŶĂůǁĞůůďŽƌĞ͍/ƚŚĂƐĚŝƐĂƉƉĞĂƌĞĚĨƌŽŵƚŚĞƉƌŽƉŽƐĞĚǁĞůůďŽƌĞĚŝĂŐƌĂŵ͘/ƐŝƚƐƚŝůů ŽƉĞŶƚŽƉƌŽĚƵĐƚŝŽŶ͍^ŚŽƵůĚŶ͛ƚŝƚďĞŝŶĐůƵĚĞĚŝŶƚŚĞĚŝĂŐƌĂŵ͍DĂŝŶďŽƌĞǁĂƐŽŶůǇĐŽŵƉůĞƚĞĚϯϮϯĨĞĞƚĂŶĚ &$87,217KLVHPDLORULJLQDWHGIURPRXWVLGHWKH6WDWHRI$ODVNDPDLOV\VWHP'RQRWFOLFNOLQNVRURSHQ DWWDFKPHQWVXQOHVV\RXUHFRJQL]HWKHVHQGHUDQGNQRZWKHFRQWHQWLVVDIH ďĞĐĂƵƐĞŽĨĞǆĐĞƐƐŝǀĞƐĂŶĚƉƌŽĚƵĐƚŝŽŶǁŽƌŬŽǀĞƌǁĂƐƉĞƌĨŽƌŵĞĚĂŶĚŵĂŝŶďŽƌĞǁĂƐŝƐŽůĂƚĞĚǁŝƚŚƚǁŽWƉůĂĐĞĚ ďĞůŽǁƚŚĞƐĞĂůďŽƌĞĚŝǀĞƌƚĞƌ͘ Ϯ͘ƌĞƚŚĞůŽǁĞƌůĂƚĞƌĂůƐƉƌĞƐƐƵƌĞͲŝƐŽůĂƚĞĚĨƌŽŵƚŚĞ>ϮůĂƚĞƌĂůĚƵƌŝŶŐƚŚĞĚƌŝůůŝŶŐƉŚĂƐĞ͍tŽŶĚĞƌŝŶŐŝĨƚŚĞ&/dǁŝůů ŽŶůǇƚĞƐƚƚŚĞŶĞǁǁŝŶĚŽǁ͕ŽƌĐĂŶĨůƵŝĚƐůĞĂŬŽĨĨŝŶƚŽƚŚĞůŽǁĞƌůĂƚĞƌĂůƐ͘zĞƐŝƚǁŝůůďĞŵĞĐŚĂŶŝĐĂůůǇƉƌĞƐƐƵƌĞ ŝƐŽůĂƚĞĚďǇƵƐŝŶŐD>yWƐǇƐƚĞŵ ϯ͘/Ɛ,Ϯ^ĞǆƉĞĐƚĞĚ͍EK dŚĂŶŬǇŽƵ ƌǇĂŶDĐ>ĞůůĂŶ ^ĞŶŝŽƌWĞƚƌŽůĞƵŵŶŐŝŶĞĞƌ ůĂƐŬĂKŝůΘ'ĂƐŽŶƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶ ϯϯϯtϳƚŚǀĞ ŶĐŚŽƌĂŐĞ͕<ϵϵϱϬϭ ƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀ нϭ;ϵϬϳͿϮϱϬͲϵϭϵϯ ---------------------------------------------------------------------------------------------------------------------------------------------------- -------------------- Message for the recipient only, if received in error, please notify the sender and read http://www.eni.com/disclaimer/ 5HYLVHG 75$160,77$//(77(5&+(&./,67 :(//1$0(BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 37'BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBB'HYHORSPHQWBBB6HUYLFHBBB([SORUDWRU\BBB6WUDWLJUDSKLF7HVWBBB1RQ&RQYHQWLRQDO ),(/'BBBBBBBBBBBBBBBBBBBBBBBBBBBB322/BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KHFN%R[IRU$SSURSULDWH/HWWHU3DUDJUDSKVWREH,QFOXGHGLQ7UDQVPLWWDO/HWWHU &+(&. 237,216 7(;7)25$33529$//(77(5 08/7, /$7(5$/ ,IODVWWZRGLJLWV LQ$3,QXPEHUDUH EHWZHHQ 7KH SHUPLW LV IRU D QHZ ZHOOERUH VHJPHQW RI H[LVWLQJ ZHOO 3HUPLW 1R BBBBBBBBBBBBB $3, 1R BBBBBBBBBBBBBBBBBBBBBBB 3URGXFWLRQVKRXOGFRQWLQXHWREHUHSRUWHGDVDIXQFWLRQRIWKHRULJLQDO $3,QXPEHUVWDWHGDERYH 3LORW+ROH ,Q DFFRUGDQFH ZLWK $$& I DOO UHFRUGV GDWD DQG ORJV DFTXLUHG IRU WKH SLORW KROH PXVW EH FOHDUO\ GLIIHUHQWLDWHG LQ ERWK ZHOO QDPH BBBBBBBBBBBBBBBBBBBBBBB3+ DQG $3, QXPEHU BBBBBBBBBBBBBBBBBBBBBIURPUHFRUGVGDWDDQGORJVDFTXLUHGIRU ZHOOQDPHRQSHUPLW 6SDFLQJ ([FHSWLRQ 7KHSHUPLWLVDSSURYHGVXEMHFWWRIXOOFRPSOLDQFHZLWK$$& $SSURYDO WR SURGXFHLQMHFW LV FRQWLQJHQW XSRQ LVVXDQFH RI D FRQVHUYDWLRQ RUGHU DSSURYLQJ D VSDFLQJ H[FHSWLRQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBDV2SHUDWRUDVVXPHVWKHOLDELOLW\ RIDQ\SURWHVWWRWKHVSDFLQJH[FHSWLRQWKDWPD\RFFXU 'U\'LWFK6DPSOH $OOGU\GLWFKVDPSOHVHWVVXEPLWWHGWRWKH$2*&&PXVWEHLQQRJUHDWHU WKDQ VDPSOHLQWHUYDOVIURPEHORZWKHSHUPDIURVWRUIURPZKHUH VDPSOHVDUHILUVWFDXJKWDQG VDPSOHLQWHUYDOVWKURXJKWDUJHW]RQHV 1RQ &RQYHQWLRQDO :HOO 3OHDVHQRWHWKHIROORZLQJVSHFLDOFRQGLWLRQRIWKLVSHUPLW 3URGXFWLRQRUSURGXFWLRQWHVWLQJRIFRDOEHGPHWKDQHLVQRWDOORZHGIRU ZHOOXQWLODIWHU KDVGHVLJQHGDQGLPSOHPHQWHGDZDWHUZHOOWHVWLQJSURJUDPWRSURYLGH EDVHOLQH GDWD RQ ZDWHU TXDOLW\ DQG TXDQWLW\ BBBBBBBBBBBBBBBBBBBBBBBB PXVW FRQWDFW WKH $2*&& WR REWDLQ DGYDQFHDSSURYDORIVXFKZDWHUZHOOWHVWLQJSURJUDP :HOO/RJJLQJ 5HTXLUHPHQWV 5HJXODWLRQ$$&DDXWKRUL]HVWKH$2*&&WRVSHFLI\W\SHV RIZHOOORJVWREHUXQ,QDGGLWLRQWRWKHZHOOORJJLQJSURJUDPSURSRVHG E\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQWKHDWWDFKHGDSSOLFDWLRQ WKHIROORZLQJZHOOORJVDUHDOVRUHTXLUHGIRUWKLVZHOO 3HU6WDWXWH$6G%DQG5HJXODWLRQ$$& FRPSRVLWHFXUYHVIRUZHOOORJVUXQPXVWEHVXEPLWWHGWRWKH$2*&& ZLWKLQGD\VDIWHUFRPSOHWLRQVXVSHQVLRQRUDEDQGRQPHQWRIWKLV ZHOO 631(/ ; 1LNDLWFKXT ; ; 6FKUDGHU %OXII 2LO ; :(//3(50,7&+(&./,67&RPSDQ\(QL862SHUDWLQJ&RPSDQ\,QF:HOO1DPH1,.$,7&+84631(/,QLWLDO&ODVV7\SH'(93(1'*HR$UHD8QLW2Q2II6KRUH2II3URJUDP'(9)LHOG 3RRO:HOOERUHVHJ$QQXODU'LVSRVDO37'1,.$,7&+846&+5$'(5%/8))2,/1$ 1RQFRQYHQJDVFRQIRUPVWR$6M$M$'1$ 3HUPLWIHHDWWDFKHG<HV /HDVHQXPEHUDSSURSULDWH<HV 8QLTXHZHOOQDPHDQGQXPEHU<HV :HOOORFDWHGLQDGHILQHGSRRO<HV :HOOORFDWHGSURSHUGLVWDQFHIURPGULOOLQJXQLWERXQGDU\<HV :HOOORFDWHGSURSHUGLVWDQFHIURPRWKHUZHOOV<HV 6XIILFLHQWDFUHDJHDYDLODEOHLQGULOOLQJXQLW<HV ,IGHYLDWHGLVZHOOERUHSODWLQFOXGHG<HV 2SHUDWRURQO\DIIHFWHGSDUW\<HV 2SHUDWRUKDVDSSURSULDWHERQGLQIRUFH<HV 3HUPLWFDQEHLVVXHGZLWKRXWFRQVHUYDWLRQRUGHU<HV 3HUPLWFDQEHLVVXHGZLWKRXWDGPLQLVWUDWLYHDSSURYDO<HV &DQSHUPLWEHDSSURYHGEHIRUHGD\ZDLW1$ :HOOORFDWHGZLWKLQDUHDDQGVWUDWDDXWKRUL]HGE\,QMHFWLRQ2UGHUSXW,2LQFRPPHQWV)RUVHUY1$ $OOZHOOVZLWKLQPLOHDUHDRIUHYLHZLGHQWLILHG)RUVHUYLFHZHOORQO\1$ 3UHSURGXFHGLQMHFWRUGXUDWLRQRISUHSURGXFWLRQOHVVWKDQPRQWKV)RUVHUYLFHZHOORQO\1$ &RQGXFWRUVWULQJSURYLGHG1$ 7KLVLVDVLGHWUDFN 6XUIDFHFDVLQJSURWHFWVDOONQRZQ86':V1$ &07YRODGHTXDWHWRFLUFXODWHRQFRQGXFWRU VXUIFVJ1R 7KLVLVDODWHUDOWKDWZLOOH[LWSURGXFWLRQFDVLQJZLWKLQWKHUHVHUYRLU,WZLOOKDYHDVORWWHGOLQHU &07YRODGHTXDWHWRWLHLQORQJVWULQJWRVXUIFVJ1R 6ORWWHGOLQHU6LGHWUDFNZLQGRZLVZLWKLQWKH6FKUDGHU%OXIIUHVHUYRLU &07ZLOOFRYHUDOONQRZQSURGXFWLYHKRUL]RQV<HV &DVLQJGHVLJQVDGHTXDWHIRU&7% SHUPDIURVW<HV $GHTXDWHWDQNDJHRUUHVHUYHSLW1$ /DWHUDO/DQGPRWKHUERUHZLOOUHPDLQRSHQ$OOLQWKHVDPHSRRO ,IDUHGULOOKDVDIRUDEDQGRQPHQWEHHQDSSURYHG<HV &ORVHDSSURDFKHVOLVWHGLQGLUHFWLRQDODUHZLWKWKHRWKHUODWHUDOVLQWKLVZHOO $GHTXDWHZHOOERUHVHSDUDWLRQSURSRVHG1$ ,IGLYHUWHUUHTXLUHGGRHVLWPHHWUHJXODWLRQV<HV 'ULOOLQJIOXLGSURJUDPVFKHPDWLF HTXLSOLVWDGHTXDWH<HV %23(VGRWKH\PHHWUHJXODWLRQ<HV 0363 SVL%23UDWHGWRN7HVWSUHVVXUH SVL %23(SUHVVUDWLQJDSSURSULDWHWHVWWRSXWSVLJLQFRPPHQWV<HV &KRNHPDQLIROGFRPSOLHVZ$3,530D\<HV :RUNZLOORFFXUZLWKRXWRSHUDWLRQVKXWGRZQ1R ,VSUHVHQFHRI+6JDVSUREDEOH1$ 0HFKDQLFDOFRQGLWLRQRIZHOOVZLWKLQ$25YHULILHG)RUVHUYLFHZHOORQO\<HV +6QRWH[SHFWHG5LJKDVVHQVRUVDQGDODUPVDQG+6VHTXHVWHULQJPDWHULDOVDUHRQVLWH 3HUPLWFDQEHLVVXHGZRK\GURJHQVXOILGHPHDVXUHV<HV 'DWDSUHVHQWHGRQSRWHQWLDORYHUSUHVVXUH]RQHV1$ 6HLVPLFDQDO\VLVRIVKDOORZJDV]RQHV1$ 6HDEHGFRQGLWLRQVXUYH\LIRIIVKRUH1$ &RQWDFWQDPHSKRQHIRUZHHNO\SURJUHVVUHSRUWV>H[SORUDWRU\RQO\@$SSU'/%'DWH$SSU%-0'DWH$SSU'/%'DWH$GPLQLVWUDWLRQ(QJLQHHULQJ*HRORJ\*HRORJLF&RPPLVVLRQHU'DWH(QJLQHHULQJ&RPPLVVLRQHU'DWH3XEOLF&RPPLVVLRQHU'DWH-03JLC 2/14/2022