Alaska Logo
Department of Commerce, Community, and Economic Development
Alaska Oil and Gas Conservation
Commission
Loading...
HomeMy WebLinkAbout222-092DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 3 3 - 2 0 4 7 4 - 0 2 - 0 0 We l l N a m e / N o . CA N N E R Y L O O P U N I T 0 5 R D 2 Co m p l e t i o n S t a t u s 1- G A S Co m p l e t i o n D a t e 9/ 2 9 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 0 9 2 0 Op e r a t o r Hi l c o r p A l a s k a , L L C MD 99 4 0 TV D 84 2 4 Cu r r e n t S t a t u s 1- G A S 6/ 1 1 / 2 0 2 5 UI C No We l l L o g I n f o r m a t i o n : Di g i t a l Me d / F r m t Re c e i v e d St a r t S t o p OH / CH Co m m e n t s Lo g Me d i a Ru n No El e c t r Da t a s e t Nu m b e r Na m e In t e r v a l Li s t o f L o g s O b t a i n e d : LW D ( G R , R e s , D e n s i t y N e u t r o n ) , M u d l o g , O H W i r e l i n e ( S P / G R ) , C B L 9 - 2 7 - 2 2 , P e r f / T i e l n l o g s No No Ye s Mu d L o g S a m p l e s D i r e c t i o n a l S u r v e y RE Q U I R E D I N F O R M A T I O N (f r o m M a s t e r W e l l D a t a / L o g s ) DA T A I N F O R M A T I O N Lo g / Da t a Ty p e Lo g Sc a l e DF 10 / 5 / 2 0 2 2 66 5 0 9 9 4 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U 0 5 R D 2 L W D Fi n a l . l a s 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 65 5 0 9 9 4 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 0 5 R D 2 . l a s 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l M D . c g m 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l T V D . c g m 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 - D e f i n i t i v e S u r v e y Re p o r t . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 - D S R . t x t 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 - D S R _ G I S . t x t 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 - F i n a l S u r v e y s . x l s x 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 _ D S R Ac t u a l _ P l a n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 _ D S R Ac t u a l _ V S e c . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l M D . e m f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l T V D . e m f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l M D . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l T V D . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l M D . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 L W D F i n a l T V D . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D a i l y R e p o r t s . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F i n a l W e l l Re p o r t . p d f 37 1 0 1 ED Di g i t a l D a t a We d n e s d a y , J u n e 1 1 , 2 0 2 5 AO G C C P a g e 1 o f 6 CL U 0 5 R D 2 L W D Fi n al. l as CLU - 0 5 R D 2 . l a s DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 3 3 - 2 0 4 7 4 - 0 2 - 0 0 We l l N a m e / N o . CA N N E R Y L O O P U N I T 0 5 R D 2 Co m p l e t i o n S t a t u s 1- G A S Co m p l e t i o n D a t e 9/ 2 9 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 0 9 2 0 Op e r a t o r Hi l c o r p A l a s k a , L L C MD 99 4 0 TV D 84 2 4 Cu r r e n t S t a t u s 1- G A S 6/ 1 1 / 2 0 2 5 UI C No DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g M D 2 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g M D 5 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g T V D 2 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g T V D 5 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g M D 2i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g M D 5i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g T V D 2i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g T V D 5i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g M D 2i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g M D 5i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g T V D 2i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g T V D 5i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g MD 2 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g MD 5 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g TV D 2 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g TV D 5 i n . p d f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g M D 2 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g M D 5 i n . t i f 37 1 0 1 ED Di g i t a l D a t a We d n e s d a y , J u n e 1 1 , 2 0 2 5 AO G C C P a g e 2 o f 6 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 3 3 - 2 0 4 7 4 - 0 2 - 0 0 We l l N a m e / N o . CA N N E R Y L O O P U N I T 0 5 R D 2 Co m p l e t i o n S t a t u s 1- G A S Co m p l e t i o n D a t e 9/ 2 9 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 0 9 2 0 Op e r a t o r Hi l c o r p A l a s k a , L L C MD 99 4 0 TV D 84 2 4 Cu r r e n t S t a t u s 1- G A S 6/ 1 1 / 2 0 2 5 UI C No DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g T V D 2 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 D r i l l i n g D y n a m i c s Lo g T V D 5 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g M D 2i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g M D 5i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g T V D 2i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 F o r m a t i o n L o g T V D 5i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g M D 2i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g M D 5i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g T V D 2i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 G a s R a t i o L o g T V D 5i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g MD 2 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g MD 5 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g TV D 2 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 L W D C o m b o L o g TV D 5 i n . t i f 37 1 0 1 ED Di g i t a l D a t a DF 10 / 5 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 S h o w R e p o r t s . p d f 37 1 0 1 ED Di g i t a l D a t a DF 11 / 2 / 2 0 2 2 66 5 0 9 2 5 4 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U _ 0 5 R D 2 _ G R - SP _ 1 7 S E P 2 2 . l a s 37 2 1 7 ED Di g i t a l D a t a DF 11 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C L U _ 0 5 R D 2 _ G R - SP _ 1 7 S E P 2 2 . p d f 37 2 1 7 ED Di g i t a l D a t a DF 11 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C L U _ 0 5 R D 2 _ G R - SP _ 1 7 S E P 2 2 _ i m g . t i f f 37 2 1 7 ED Di g i t a l D a t a We d n e s d a y , J u n e 1 1 , 2 0 2 5 AO G C C P a g e 3 o f 6 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 3 3 - 2 0 4 7 4 - 0 2 - 0 0 We l l N a m e / N o . CA N N E R Y L O O P U N I T 0 5 R D 2 Co m p l e t i o n S t a t u s 1- G A S Co m p l e t i o n D a t e 9/ 2 9 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 0 9 2 0 Op e r a t o r Hi l c o r p A l a s k a , L L C MD 99 4 0 TV D 84 2 4 Cu r r e n t S t a t u s 1- G A S 6/ 1 1 / 2 0 2 5 UI C No DF 11 / 9 / 2 0 2 2 97 4 8 9 5 1 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : CL U _ 0 5 R D 2 _ C I B P _ 0 5 - O c t - 2 0 2 2 _ ( 3 9 9 5 ) . l a s 37 2 5 0 ED Di g i t a l D a t a DF 11 / 9 / 2 0 2 2 64 5 0 9 8 2 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : CL U _ 0 5 R D 2 _ G P T _ 0 5 - O c t - 2 0 2 2 _ ( 3 9 9 5 ) . l a s 37 2 5 0 ED Di g i t a l D a t a DF 11 / 9 / 2 0 2 2 E l e c t r o n i c F i l e : CL U _ 0 5 R D 2 _ G P T _ C I B P _ C e m e n t _ 0 5 - O c t - 20 2 2 _ ( 3 9 9 5 ) . p d f 37 2 5 0 ED Di g i t a l D a t a DF 11 / 1 7 / 2 0 2 2 60 8 5 9 7 8 2 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U 0 5 R D 2 C B L MA I N P A S S . l a s 37 2 6 5 ED Di g i t a l D a t a DF 11 / 1 7 / 2 0 2 2 E l e c t r o n i c F i l e : C L U 0 5 R D 2 C B L F I N A L . p d f 37 2 6 5 ED Di g i t a l D a t a DF 11 / 2 1 / 2 0 2 2 96 5 6 9 1 8 6 E l e c t r o n i c D a t a S e t , F i l e n a m e : CL U _ 0 5 R D 2 _ G P T _ 1 8 - O c t - 2 0 2 2 _ ( 4 0 0 3 ) . l a s 37 2 8 0 ED Di g i t a l D a t a DF 11 / 2 1 / 2 0 2 2 94 0 2 8 5 0 8 E l e c t r o n i c D a t a S e t , F i l e n a m e : CL U _ 0 5 R D 2 _ P e r f _ 1 8 - O c t - 2 0 2 2 _ ( 4 0 0 3 ) . l a s 37 2 8 0 ED Di g i t a l D a t a DF 11 / 2 1 / 2 0 2 2 E l e c t r o n i c F i l e : C L U _ 0 5 R D 2 _ P e r f _ G P T _ 1 8 - O c t - 20 2 2 _ ( 4 0 0 3 ) . p d f 37 2 8 0 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 97 7 3 9 5 3 2 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 0 5 R D 2 CO R R E L A T I O N L O G P E R F U T - 5 A . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 C O R R E L A T I O N LO G P E R F U T - 5 A . p d f 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 0 5 R D 2 P E R F F I N A L U T - 5A . p d f 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 79 6 8 8 6 7 1 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 0 3 0 - d n . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 87 2 1 7 9 6 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 0 3 0 - u p . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 79 5 0 8 6 6 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 0 6 0 - d n . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 86 7 1 7 9 6 8 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 0 6 0 - u p . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 79 5 0 8 6 5 2 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 0 9 0 - d n . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 86 6 8 7 9 5 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 0 9 0 - u p . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 79 4 9 8 6 3 6 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 1 2 0 - d n . l a s 37 3 1 3 ED Di g i t a l D a t a We d n e s d a y , J u n e 1 1 , 2 0 2 5 AO G C C P a g e 4 o f 6 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 3 3 - 2 0 4 7 4 - 0 2 - 0 0 We l l N a m e / N o . CA N N E R Y L O O P U N I T 0 5 R D 2 Co m p l e t i o n S t a t u s 1- G A S Co m p l e t i o n D a t e 9/ 2 9 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 0 9 2 0 Op e r a t o r Hi l c o r p A l a s k a , L L C MD 99 4 0 TV D 84 2 4 Cu r r e n t S t a t u s 1- G A S 6/ 1 1 / 2 0 2 5 UI C No We l l C o r e s / S a m p l e s I n f o r m a t i o n : Re c e i v e d St a r t S t o p C o m m e n t s To t a l Bo x e s Sa m p l e Se t Nu m b e r Na m e In t e r v a l IN F O R M A T I O N R E C E I V E D Co m p l e t i o n R e p o r t Pr o d u c t i o n T e s t I n f o r m a t i o n Ge o l o g i c M a r k e r s / T o p s Y Y / N A Y Mu d L o g s , I m a g e F i l e s , D i g i t a l D a t a Co m p o s i t e L o g s , I m a g e , D a t a F i l e s Cu t t i n g s S a m p l e s Y / N A Y Y / N A Di r e c t i o n a l / I n c l i n a t i o n D a t a Me c h a n i c a l I n t e g r i t y T e s t I n f o r m a t i o n Da i l y O p e r a t i o n s S u m m a r y Y Y / N A Y Co r e C h i p s Co r e P h o t o g r a p h s La b o r a t o r y A n a l y s e s Y / N A Y / N A Y / N A CO M P L I A N C E H I S T O R Y Co m p l e t i o n D a t e : 9/ 2 9 / 2 0 2 2 Re l e a s e D a t e : 8/ 4 / 2 0 2 2 DF 11 / 2 9 / 2 0 2 2 86 5 4 7 9 5 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ 1 2 0 - u p . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 86 5 2 8 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ P O O H . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 79 5 0 8 6 8 8 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ P r o c e s s e d L o g - V 1 . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 -1 2 8 7 0 4 E l e c t r o n i c D a t a S e t , F i l e n a m e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ R I H . l a s 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 . p d f 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ i m g . t i f f 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ R e p o r t - V 1 . p d f 37 3 1 3 ED Di g i t a l D a t a DF 11 / 2 9 / 2 0 2 2 E l e c t r o n i c F i l e : C L U - 05 R D 2 _ P P R O F _ 1 1 N O V 2 2 _ V 1 . k e 5 37 3 1 3 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 81 0 4 7 7 0 3 E l e c t r o n i c D a t a S e t , F i l e n a m e : CL U _ 0 5 R D 2 _ P e r f _ 1 7 - N o v - 2 0 2 2 _ ( 4 0 7 2 ) . l a s 37 3 4 8 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C L U _ 0 5 R D 2 _ P e r f _ 1 7 - N o v - 20 2 2 _ ( 4 0 7 2 ) . p d f 37 3 4 8 ED Di g i t a l D a t a 10 / 5 / 2 0 2 2 66 6 0 9 9 4 0 2 Cu t t i n g s We d n e s d a y , J u n e 1 1 , 2 0 2 5 AO G C C P a g e 5 o f 6 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 3 3 - 2 0 4 7 4 - 0 2 - 0 0 We l l N a m e / N o . CA N N E R Y L O O P U N I T 0 5 R D 2 Co m p l e t i o n S t a t u s 1- G A S Co m p l e t i o n D a t e 9/ 2 9 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 0 9 2 0 Op e r a t o r Hi l c o r p A l a s k a , L L C MD 99 4 0 TV D 84 2 4 Cu r r e n t S t a t u s 1- G A S 6/ 1 1 / 2 0 2 5 UI C No Co m m e n t s : Co m p l i a n c e R e v i e w e d B y : Da t e : Da t e C o m m e n t s De s c r i p t i o n We d n e s d a y , J u n e 1 1 , 2 0 2 5 AO G C C P a g e 6 o f 6 6/ 1 1 / 2 0 2 5 M. G u h l 1. Type of Request:Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: Install Cap String 2.Operator Name:4. Current Well Class: 5. Permit to Drill Number: Exploratory Development 3. Address:Stratigraphic Service 6. API Number: 7. If perforating:8. Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Yes No 9. Property Designation (Lease Number):10. Field: Current Pools: 11. Total Depth MD (ft):Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: Junk (MD): 9,940'N/A Casing Collapse Conductor Surface 1,540psi Intermediate 6,620psi Intermediate 5,300psi Intermediate Lnr 4,790psi Production Lnr 7,500psi Packers and SSSV Type:Packers and SSSV MD (ft) and TVD (ft): 12. Attachments:Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations:OIL WINJ WDSPL Suspended 16. Verbal Approval:Date: GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Contact Email: Contact Phone: Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other Conditions of Approval: Post Initial Injection MIT Req'd? Yes No APPROVED BY Approved by: COMMISSIONER THE AOGCC Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng Suspension Expiration Date: 12.6# / L-80 TVD Burst 6,229' 142' Kenai C.L.U.Beluga Gas chelgeson@hilcorp.com 907-777-8405 Noel Nocas, Operations Manager 907-564-5278 Perforation Depth TVD (ft): Subsequent Form Required: Will perfs require a spacing exception due to property boundaries? MPSP (psi):Plugs (MD): 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: Tubing Size: PRESENT WELL CONDITION SUMMARY Chad Helgeson, Operations Engineer Proposed Pools: 3800 Centerpoint Drive, Suite 1400 Anchorage, Alaska 99503 AOGCC USE ONLY 8,430psi Tubing Grade:Tubing MD (ft): 252' Length STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 Fee-Private, Fee-Hilcorp (formerly ADL 060569) ADL 324602 222-092 50-133-20474-02-00 Hilcorp Alaska, LLC Size 2,970' 9-5/8"5,315' 1,212' MD 142' 7,930psi 2,571' 5,355' 2,970' 1,212' 6,890psi 1,200' April 26, 2024 9,938'3,724' 4-1/2" 8,422' 142'20" 6,685' Perforation Depth MD (ft): 6,527' Cannery Loop Unit (CLU) 05RD2CO 231A Same 5,506'7-5/8" ~350 psi 8,710; 9,678' 9,440psi 3,090psi SLZXP & ZXP Liner Top Pkrs; S-5 TRSSSV 6,214' MD/5,053'TVD; 6,433' MD/5,663' TVD; 141' MD/TVD 8,424'8,710'7,309' 13-3/8" 9-5/8" See Attached Schematic 4-1/2" See Attached Schematic m n P s t g N 66 Form 10-403 Revised 06/2023 Approved application valid for 12 months from date of approval.Submit PDF to aogcc.permitting@alaska.gov By Samantha Coldiron at 9:17 am, Apr 15, 2024 324-215 Digitally signed by Noel Nocas (4361) DN: cn=Noel Nocas (4361) Date: 2024.04.12 17:42:14 - 08'00' Noel Nocas (4361) SFD 4/15/2024 DSR-4/23/24BJM 4/15/24 10-404 *&: Brett W. Huber, Sr. Digitally signed by Brett W. Huber, Sr. Date: 2024.04.24 10:23:48 -08'00'04/24/24 RBDMS JSB 042624 Cap String Well: CLU 05RD2 Well Name: CLU 05RD2 API Number: 50-133-20474-02-00 Current Status: Gas Producer Permit to Drill Number: 222-092 First Call Engineer: Chad Helgeson (907) 777-8405 (O) Second Call Engineer: Jake Flora (907) 777-8442 (O) (720) 988-5375 (C) Current flowing BHP: 850 psi @ 7336 TVD Based on CLU-5RD2 PLT Data 11/22/22 Maximum Potential Surface Pressure: ~350 psi Max SI buildup in last 2 years Well Status: Gas producer making 762 mcfd, 16 bwpd @ 68psi Brief Well Summary CLU 5RD2 was drilled in 2022. Currently production has slid below unloading rate and has become more erratic and dropping soap sticks several times a day to unload the well. The purpose of this work/sundry is to set a 3/8” stainless steel capillary string to inject liquid soap downhole and keep the well from slugging as the well tapers out below unloading rate. The TRSSSV will be bypassed when the Capillary string is installed which is allowed per 20AAC25.265(c)(4). Wellbore Condition x Well TRSSSV will be hydraulically locked open. x Minimum ID is 3.813” Profile inside SSSV x Maximum Angle is 48.54° @ 4,121’ MD x SSSV at 141’ x Liner/seal assembly @ 6,214’ x CINGSA Pool bottom – 6,304’ MD (5,140’ TVD) Procedure 1. RU Slickline, PT lubricator to 2500 psi 2. RIH with GR and tag bottom 3. Run PT Survey to determine gas influx and fluid level 4. RDMO SL 5. Block open/bypass the TRSSSV at surface 6. RU Cap String Truck 7. Stab 3/8” capillary line into wellhead pack-off assembly. Make up BHA components. Install pack-off and pressure test against swab valve to 1500 psi 8. RIH with 3/8” capillary string to ±8400’ MD. a. Set cap string as deep as practical per SL survey results 9. Install slips and connect tubing to chemical injection pump 10. Set spool of remaining line near well 11. RD cap string Unit, and turn well over to production. Attachments: 1. Proposed Schematic Updated by CAH 4-11-24 PROPOSED Cannery Loop Unit CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 PBTD = 9,851’ / TVD = 8,343’ TD = 9,940’ / TVD = 8,424’ RKB to GL = 18.12’ Cingsa From 6071’ - 6295’ MD CASING & TUBING DETAIL Size Type Wt Grade Conn. ID Top Btm 20” Conductor 129 - Weld - Surf 142’ 13-3/8" Surf Csg 61.0 K-55 BTC 12.515” Surf 2,970’ 9-5/8” Intermediate Csg 53.5 L-80 BTC 8.535” Surf 1,212’ 9-5/8” Intermediate Csg 47 P-110 BTC 8.681” 1,212’ 6,527’ 7-5/8” Intermediate Lnr 29.7# L-80 Hyd 521 6.875” 6,433’ 6,685’ 4-1/2" Prod Lnr 12.6 L-80 DWC/C 3.958” 6,214’ 9,938’ 4-1/2” Tubing 12.6 L-80 DWC/C 3.958” Surf 6,229’ 3/8” Capillary String 306 SS NA Surf ±8600’ 2 20” 13-3/8” 16” hole 4-1/2” JEWELRY DETAIL No. Depth ID OD Item 1 141 3.813” 6.600” Baker S-5 TRSSSV 2 6,214’ 7.37” 7”x 9-5/8” SLZXP HRDE Liner top packer, w/ 7.37” PBR 3 6,433’ 3.958” 6.875” 7-5/8” ZXP Liner Top Packer 4 8,710’ 3.958” CIBP set 10/20/22 5 9,678’ - 3.958” CIBP w/ 26’ of cement 10/5/22, tagged 9,667’ CTM OPEN HOLE / CEMENT DETAIL 13-3/8” Fully cemented with 140bbls back to surface (CLU-05 in 1996) 9-5/8” 12-1/4” hole: Pumped from 9178’ MD. 850sxs lead (375bbls) and 1069 sxs (222bbls) tail (CLU-05 in 1996) 11/19/96 USIT shows 9-5/8” cemented up to at least 2800’ MD (stopped logging there) 7-5/8” 8-1/2” hole: Cemented with 102.7bbls 15.3ppg class G. had losses and got no cement back to surface. 9/24/20 SCMT shows good cement up to at least 6,525 MD (behind tubing above that) 4-1/2” 6-3/4” hole: Lead - 250 sx / 12.5 ppg / 90 bbls Tail - 185 sx / 15.3 ppg / 39 bbls TOC 6,700’ MD – CBL 9/27/22 4 9-5/8” 1 CLU-05RD (Abandoned) Window @ 6,666’ 6-3/4” hole 7-5/8” 3 Squeezed perfs 7/22/22 PERFORATION DETAIL Sands Top (MD) Btm (MD) Top (TVD) Btm (TVD) FT Date Status LB 7,880' 7,898' 6,565' 6,581' 18' 11/08/22 Open LB1 7,921' 7,927' 6,602' 6,607' 6' 11/08/22 Open LB1C Upper 7,984' 7,993' 6,658' 6,666' 9' 11/08/22 Open LB1G Upper 8,162' 8,177' 6,816' 6,830' 15' 11/08/22 Open LB1G Lower 8,186' 8,204' 6,838' 6,854' 18' 11/08/22 Open LB2 Lower 8,265' 8,282' 6,908' 6,923' 17' 11/08/22 Open LB2C Upper 8,382' 8,402' 7,013' 7,031' 20' 11/08/22 Open LB2C Lower 8,414' 8,424' 7,042' 7,051' 20' 11/07/22 Open LB2D Upper 8,438' 8,452' 7,064' 7,076' 14' 11/01/22 Open LB2E Lower 8,576' 8,593' 7,188' 7,204' 17' 11/01/22 Open LB Upper 8,597' 8,606' 7,207' 7,215' 9' 11/01/22 Open LB3A Upper 8,643' 8,648' 7,249' 7,253' 5' 11/01/22 Open LB1B Lower 7,952' 7,958' 6,629' 6,635' 6' 10/27/22 Open LB1B 7,969' 7,974' 6,644' 6,649' 5' 10/28/22 Open LB1F Upper 8,076' 8,082' 6,740' 6,745' 6' 10/27/22 Open LB1F Mid 8,094' 8,119' 6,756' 6,778' 26' 10/27/22 Open LB1F Lower 8,128' 8,140' 6,786' 6,797' 12' 10/27/22 Open LB2B 8,328' 8,348' 6,964' 6,982' 20' 10/27/22 Open LB3A Lower 8,668' 8,678’ 7,271' 7,280' 10’ 10/20/22 Open LB3C Upper 8,718' 8,730' 7,316' 7,327' 12' 10/17/22 Plugged LB 3C Lower 8,740' 8,747' 7,336' 7,342' 7' 10/17/22 Plugged LB 4 Upper 8,765' 8,783’ 7,358' 7,374' 28' 10/17/22 Plugged LB 4 Lower 8,806' 8,814' 7,395' 7,402' 8' 10/17/22 Plugged LB 4A 8,844' 8,856' 7,429' 7,440' 12' 10/17/22 Plugged LB4C Upper 8,919’ 8,939’ 7,496' 7,514' 20' 10/14/22 Plugged LB 4C Lower 8,955' 8,972' 7,528' 7,544' 17' 10/14/22 Plugged LB4D Mid 9,006’ 9,012' 7,574' 7,580' 6' 10/14/22 Plugged LB 4D Lower 9,020' 9,030’ 7,587' 7,596' 10' 10/13/22 Plugged LB 5 Lower 9,078' 9,087’ 7,640' 7,648' 9' 10/13/22 Plugged LB 5A 9,091' 9,111’ 7,651' 7,670' 20' 10/11/22 Plugged UT 5A 9,703' 9,710' 8,208’ 8,214’ 7' 09/29/22 Plugged 4 5 3/8” Capillary String CAUTION: External sender. DO NOT open links or attachments from UNKNOWN senders. CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. From:AOGCC Permitting (CED sponsored) To:Brooks, James S (OGC) Subject:FW: CLU_05RD2 322-709 - WITHDRAWAL/CANCEL Date:Friday, December 15, 2023 9:43:11 AM Attachments:Sundry_322-709_123022.pdf FYI logged in 2022-403 Excel Log. Grace From: Donna Ambruz <dambruz@hilcorp.com> Sent: Friday, December 15, 2023 9:40 AM To: AOGCC Permitting (CED sponsored) <aogcc.permitting@alaska.gov> Cc: Chad Helgeson <chelgeson@hilcorp.com> Subject: CLU_05RD2 322-709 - WITHDRAWAL/CANCEL Please withdraw/cancel the above-referenced sundry. Thank you. Donna Ambruz Operations/Regulatory Tech KEN Asset Team Hilcorp Alaska, LLC 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 907.777.8305 - Direct dambruz@hilcorp.com From: Prysunka, Anne E (OGC) <anne.prysunka@alaska.gov> Sent: Friday, December 30, 2022 2:04 PM To: Abbie Barker <Abbie.Barker@hilcorp.com>; Carrie Janowski <Carrie.Janowski@hilcorp.com>; Cody Dinger <cdinger@hilcorp.com>; Darci Horner - (C) <dhorner@hilcorp.com>; Donna Ambruz <dambruz@hilcorp.com>; Jerimiah Galloway <Jerimiah.Galloway@hilcorp.com>; Joseph Lastufka <Joseph.Lastufka@hilcorp.com>; Josh Allely - (C) <josh.allely@hilcorp.com>; Juanita Lovett <jlovett@hilcorp.com>; Tom Fouts <tfouts@hilcorp.com> Subject: [EXTERNAL] MPU_S-205, CLU_05RD2 322-709 Anne Prysunka Executive Secretary| AOGCC Alaska Oil and Gas Conservation Commission Direct: (907) 793-1230 The information contained in this email message is confidential and may be legally privileged and is intended only for the use of theindividual or entity named above. If you are not an intended recipient or if you have received this message in error, you are herebynotified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, pleaseimmediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently deletethis message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. 1. Type of Request:Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: ___________________ 2. Operator Name:4. Current Well Class: 5. Permit to Drill Number: Exploratory Development 3. Address: Stratigraphic Service 6. API Number: 7. If perforating:8. Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Will planned perforations require a spacing exception?Yes No 9. Property Designation (Lease Number): 10. Field: Current Pools: 11. Total Depth MD (ft):Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: MPSP (psi): Plugs (MD): Junk (MD): 9,940'N/A Casing Collapse Conductor Surface 1,540psi Intermediate 6,620psi Intermediate 5,300psi Intermediate Lnr 4,790psi Production Lnr 7,500psi Packers and SSSV Type:Packers and SSSV MD (ft) and TVD (ft): 12. Attachments:Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations:OIL WINJ WDSPL Suspended 16. Verbal Approval:Date: GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Contact Email: Contact Phone: Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other: Post Initial Injection MIT Req'd? Yes No Spacing Exception Required? Yes No Subsequent Form Required: APPROVED BY Approved by: COMMISSIONER THE AOGCC Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: AOGCC USE ONLY Chad Helgeson, Operations Engineer chelgeson@hilcorp.com 907-777-8405 Noel Nocas, Operations Manager 907-564-5278 Tubing Grade:Tubing MD (ft):Perforation Depth TVD (ft):Tubing Size: 12.6# / L-80 6,229' December 30, 2022 SLZXP & ZXP Liner Top Pkrs; S-5 TRSSSV 6,214' MD/5,053'TVD; 6,433' MD/5,663' TVD; 141' MD/TVD See Attached Schematic See Attached Schematic 4-1/2" STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 FEE-Hilcorp (formerly ADL 060569), ADL 324602 222-092 50-133-20474-02-00 Cannery Loop Upper Tyonek GP, Beluga GP Same CO 231A Hilcorp Alaska, LLC 3800 Centerpoint Drive, Suite 1400 Anchorage, Alaska 99503 CLUL 05RD2 Length Size Proposed Pools: 142'142' TVD Burst PRESENT WELL CONDITION SUMMARY 8,424'8,710'7,309'~1,512 psi 8,710; 9,678' 142'20" MD 9,440psi 3,090psi 7,930psi 2,571' 1,200' 5,355' 2,970' 1,212' 6,527' Perforation Depth MD (ft): 252' 4-1/2"3,724' 7-5/8" 9-5/8"5,315' 13-3/8" 9-5/8" 2,970' 1,212' 6,890psi5,506'6,685' 8,430psi9,938'8,422' m n P s 66 t _ Form 10-403 Revised 10/2022 Approved application valid for 12 months from date of approval.Submit PDF to aogcc.permitting@alaska.gov 322-709 By Anne Prysunka at 9:22 am, Dec 19, 2022 Digitally signed by Noel Nocas (4361) DN: cn=Noel Nocas (4361), ou=Users Date: 2022.12.16 10:52:58 -09'00' Noel Nocas (4361) 10-404X BJM 12/30/22 CLU DLB 12/19/2022 -bjm GCW 12/30/22 Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2022.12.30 13:37:00 -09'00' RBDMS JSB 010323 Well Work Prognosis Well Name: CLU 5RD2 API Number: 50-133-20474-02-00 Current Status: Gas Producer Rig: Eline & Fox CTU Estimated Start Date: 12/30/22 Regulatory Contact: Donna Ambruz (8305) Permit to Drill Number: 222-092 First Call Engineer: Chad Helgeson (907) 777-8405 (O) (907) 229-4824 (M) Second Call Engineer: Jake Flora (907) 777-8442 (O) (720)-988-5375 (M) Maximum Expected BHP from perfs 531 psi @ 6,437’ TVD Based on XPT in CLU-14 (8/19/2019) Maximum Potential Surface Pressure: 1512 psi, based on Max buildup on 11/6/22, proposed perf zone pressure is 531 psi Brief Well Summary Cannery Loop 5RD2 is a sidetracked gas producer that was drilled and completed, September 2022. The wellbore is completed as a 4-1/2” mono-bore with tieback to surface, the well is online currently flowing at 1.2 mmscfd at 80 psi. Notes Regarding Wellbore Condition x SSSV at 141’ x Liner/seal assembly @ 6,214’ x CINGSA Pool bottom – 6,304’ MD (5,140’ TVD) Procedure: 1. Review all approved COAs 2. RU E-line, PT lubricator to 2000 psi High/250 psi Low 3. Run Perforate Middle Beluga sand with 60 deg phased hollow carrier perf guns Pool Sands Top (MD) Btm (MD) Top (TVD) Btm (TVD) FT Beluga MB 7A Lower ±7,737' ±7,749' ±6,437’ ±6,448’ ±12' Make correlation pass and send log in to Operations Engineer, Reservoir Engineer and the Geologist. a. Record initial and 5/10/15 minute tubing pressures after firing b. Above perfs will be shot in the Beluga Gas Pool governed by CO 231A E-line Procedure (Contingency) 1. If any zone produces sand and/or water or needs isolated: 2. MIRU E-Line and pressure control equipment. PT lubricator to 250 psi Low / 2,500 psi High. 3. RIH and set a Casing Patch or set a CIBP above the zone and dump 25’ of cement on top of the plug. 4. If necessary to cleanout or unload well, RU same coil equipment used in initial completion a. Test BOPs, 4000 psi High/ 250 psi Low b. Cleanout with N2 or foam c. Set 4-1/2” plug or patch Attachments: 1. Current Well Schematic 2. Proposed Well Schematic Updated by CJD 11-28-2022 SCHEMATIC Cannery Loop Unit CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 PBTD = 9,851’ / TVD = 8,343’ TD = 9,940’ / TVD = 8,424’ RKB to GL = 18.12’ Cingsa From 6071’ - 6295’ MD CASING & TUBING DETAIL Size Type Wt Grade Conn. ID Top Btm 20” Conductor 129 - Weld - Surf 142’ 13-3/8" Surf Csg 61.0 K-55 BTC 12.515” Surf 2,970’ 9-5/8” Intermediate Csg 53.5 L-80 BTC 8.535” Surf 1,212’ 9-5/8” Intermediate Csg 47 P-110 BTC 8.681” 1,212’ 6,527’ 7-5/8” Intermediate Lnr 29.7# L-80 Hyd 521 6.875” 6,433’ 6,685’ 4-1/2" Prod Lnr 12.6 L-80 DWC/C 3.958” 6,214’ 9,938’ 4-1/2” Tubing 12.6 L-80 DWC/C 3.958” Surf 6,229’ 2 20” 13-3/8” 16” hole 4-1/2” JEWELRY DETAIL No. Depth ID OD Item 1 141 3.813” 6.600” Baker S-5 TRSSSV 2 6,214’ 7.37” 7”x 9-5/8” SLZXP HRDE Liner top packer, w/ 7.37” PBR 3 6,433’ 3.958” 6.875” 7-5/8” ZXP Liner Top Packer 4 8,710’ 3.958” CIBP set 10/20/22 5 9,678’ - 3.958” CIBP w/ 26’ of cement 10/5/22, tagged 9,667’ CTM OPEN HOLE / CEMENT DETAIL 13-3/8” Fully cemented with 140bbls back to surface (CLU-05 in 1996) 9-5/8” 12-1/4” hole: Pumped from 9178’ MD. 850sxs lead (375bbls) and 1069 sxs (222bbls) tail (CLU-05 in 1996) 11/19/96 USIT shows 9-5/8” cemented up to at least 2800’ MD (stopped logging there) 7-5/8” 8-1/2” hole: Cemented with 102.7bbls 15.3ppg class G. had losses and got no cement back to surface. 9/24/20 SCMT shows good cement up to at least 6,525 MD (behind tubing above that) 4-1/2” 6-3/4” hole: Lead - 250 sx / 12.5 ppg / 90 bbls Tail - 185 sx / 15.3 ppg / 39 bbls TOC 6,700’ MD – CBL 9/27/22 4 9-5/8” 1 CLU-05RD (Abandoned) Window @ 6,666’ 6-3/4” hole 7-5/8” 3 Squeezed perfs 7/22/22 PERFORATION DETAIL Sands Top (MD) Btm (MD) Top (TVD) Btm (TVD) FT Date Status LB 7,880' 7,898' 6,565' 6,581' 18' 11/08/22 Open LB1 7,921' 7,927' 6,602' 6,607' 6' 11/08/22 Open LB1C Upper 7,984' 7,993' 6,658' 6,666' 9' 11/08/22 Open LB1G Upper 8,162' 8,177' 6,816' 6,830' 15' 11/08/22 Open LB1G Lower 8,186' 8,204' 6,838' 6,854' 18' 11/08/22 Open LB2 Lower 8,265' 8,282' 6,908' 6,923' 17' 11/08/22 Open LB2C Upper 8,382' 8,402' 7,013' 7,031' 20' 11/08/22 Open LB2C Lower 8,414' 8,424' 7,042' 7,051' 20' 11/07/22 Open LB2D Upper 8,438' 8,452' 7,064' 7,076' 14' 11/01/22 Open LB2E Lower 8,576' 8,593' 7,188' 7,204' 17' 11/01/22 Open LB Upper 8,597' 8,606' 7,207' 7,215' 9' 11/01/22 Open LB3A Upper 8,643' 8,648' 7,249' 7,253' 5' 11/01/22 Open LB1B Lower 7,952' 7,958' 6,629' 6,635' 6' 10/27/22 Open LB1B 7,969' 7,974' 6,644' 6,649' 5' 10/28/22 Open LB1F Upper 8,076' 8,082' 6,740' 6,745' 6' 10/27/22 Open LB1F Mid 8,094' 8,119' 6,756' 6,778' 26' 10/27/22 Open LB1F Lower 8,128' 8,140' 6,786' 6,797' 12' 10/27/22 Open LB2B 8,328' 8,348' 6,964' 6,982' 20' 10/27/22 Open LB3A Lower 8,668' 8,678’ 7,271' 7,280' 10’ 10/20/22 Open LB3C Upper 8,718' 8,730' 7,316' 7,327' 12' 10/17/22 Plugged LB 3C Lower 8,740' 8,747' 7,336' 7,342' 7' 10/17/22 Plugged LB 4 Upper 8,765' 8,783’ 7,358' 7,374' 28' 10/17/22 Plugged LB 4 Lower 8,806' 8,814' 7,395' 7,402' 8' 10/17/22 Plugged LB 4A 8,844' 8,856' 7,429' 7,440' 12' 10/17/22 Plugged LB4C Upper 8,919’ 8,939’ 7,496' 7,514' 20' 10/14/22 Plugged LB 4C Lower 8,955' 8,972' 7,528' 7,544' 17' 10/14/22 Plugged LB4D Mid 9,006’ 9,012' 7,574' 7,580' 6' 10/14/22 Plugged LB 4D Lower 9,020' 9,030’ 7,587' 7,596' 10' 10/13/22 Plugged LB 5 Lower 9,078' 9,087’ 7,640' 7,648' 9' 10/13/22 Plugged LB 5A 9,091' 9,111’ 7,651' 7,670' 20' 10/11/22 Plugged UT 5A 9,703' 9,710' 8,208’ 8,214’ 7' 09/29/22 Plugged 4 5 Updated by CAH 12-16-22 PROPOSED Cannery Loop Unit CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 PBTD = 9,851’ / TVD = 8,343’ TD = 9,940’ / TVD = 8,424’ RKB to GL = 18.12’ Cingsa From 6071’ - 6295’ MD CASING & TUBING DETAIL Size Type Wt Grade Conn. ID Top Btm 20” Conductor 129 - Weld - Surf 142’ 13-3/8" Surf Csg 61.0 K-55 BTC 12.515” Surf 2,970’ 9-5/8” Intermediate Csg 53.5 L-80 BTC 8.535” Surf 1,212’ 9-5/8” Intermediate Csg 47 P-110 BTC 8.681” 1,212’ 6,527’ 7-5/8” Intermediate Lnr 29.7# L-80 Hyd 521 6.875” 6,433’ 6,685’ 4-1/2" Prod Lnr 12.6 L-80 DWC/C 3.958” 6,214’ 9,938’ 4-1/2” Tubing 12.6 L-80 DWC/C 3.958” Surf 6,229’ 2 20” 13-3/8” 16” hole 4-1/2” JEWELRY DETAIL No. Depth ID OD Item 1 141 3.813” 6.600” Baker S-5 TRSSSV 2 6,214’ 7.37” 7”x 9-5/8” SLZXP HRDE Liner top packer, w/ 7.37” PBR 3 6,433’ 3.958” 6.875” 7-5/8” ZXP Liner Top Packer 4 8,710’ 3.958” CIBP set 10/20/22 5 9,678’ - 3.958” CIBP w/ 26’ of cement 10/5/22, tagged 9,667’ CTM OPEN HOLE / CEMENT DETAIL 13-3/8” Fully cemented with 140bbls back to surface (CLU-05 in 1996) 9-5/8” 12-1/4” hole: Pumped from 9178’ MD. 850sxs lead (375bbls) and 1069 sxs (222bbls) tail (CLU-05 in 1996) 11/19/96 USIT shows 9-5/8” cemented up to at least 2800’ MD (stopped logging there) 7-5/8” 8-1/2” hole: Cemented with 102.7bbls 15.3ppg class G. had losses and got no cement back to surface. 9/24/20 SCMT shows good cement up to at least 6,525 MD (behind tubing above that) 4-1/2” 6-3/4” hole: Lead - 250 sx / 12.5 ppg / 90 bbls Tail - 185 sx / 15.3 ppg / 39 bbls TOC 6,700’ MD – CBL 9/27/22 4 9-5/8” 1 CLU-05RD (Abandoned) Window @ 6,666’ 6-3/4” hole 7-5/8” 3 Squeezed perfs 7/22/22 PERFORATION DETAIL Sands Top (MD) Btm (MD) Top (TVD) Btm (TVD) FT Date Status MB -7A Lower ±7,737’ ±7,749’ ±6,437’ ±6,448’ ±12 Proposed TBD LB 7,880' 7,898' 6,565' 6,581' 18' 11/08/22 Open LB1 7,921' 7,927' 6,602' 6,607' 6' 11/08/22 Open LB1C Upper 7,984' 7,993' 6,658' 6,666' 9' 11/08/22 Open LB1G Upper 8,162' 8,177' 6,816' 6,830' 15' 11/08/22 Open LB1G Lower 8,186' 8,204' 6,838' 6,854' 18' 11/08/22 Open LB2 Lower 8,265' 8,282' 6,908' 6,923' 17' 11/08/22 Open LB2C Upper 8,382' 8,402' 7,013' 7,031' 20' 11/08/22 Open LB2C Lower 8,414' 8,424' 7,042' 7,051' 20' 11/07/22 Open LB2D Upper 8,438' 8,452' 7,064' 7,076' 14' 11/01/22 Open LB2E Lower 8,576' 8,593' 7,188' 7,204' 17' 11/01/22 Open LB Upper 8,597' 8,606' 7,207' 7,215' 9' 11/01/22 Open LB3A Upper 8,643' 8,648' 7,249' 7,253' 5' 11/01/22 Open LB1B Lower 7,952' 7,958' 6,629' 6,635' 6' 10/27/22 Open LB1B 7,969' 7,974' 6,644' 6,649' 5' 10/28/22 Open LB1F Upper 8,076' 8,082' 6,740' 6,745' 6' 10/27/22 Open LB1F Mid 8,094' 8,119' 6,756' 6,778' 26' 10/27/22 Open LB1F Lower 8,128' 8,140' 6,786' 6,797' 12' 10/27/22 Open LB2B 8,328' 8,348' 6,964' 6,982' 20' 10/27/22 Open LB3A Lower 8,668' 8,678’ 7,271' 7,280' 10’ 10/20/22 Open LB3C Upper 8,718' 8,730' 7,316' 7,327' 12' 10/17/22 Plugged LB 3C Lower 8,740' 8,747' 7,336' 7,342' 7' 10/17/22 Plugged LB 4 Upper 8,765' 8,783’ 7,358' 7,374' 28' 10/17/22 Plugged LB 4 Lower 8,806' 8,814' 7,395' 7,402' 8' 10/17/22 Plugged LB 4A 8,844' 8,856' 7,429' 7,440' 12' 10/17/22 Plugged LB4C Upper 8,919’ 8,939’ 7,496' 7,514' 20' 10/14/22 Plugged LB 4C Lower 8,955' 8,972' 7,528' 7,544' 17' 10/14/22 Plugged LB4D Mid 9,006’ 9,012' 7,574' 7,580' 6' 10/14/22 Plugged LB 4D Lower 9,020' 9,030’ 7,587' 7,596' 10' 10/13/22 Plugged LB 5 Lower 9,078' 9,087’ 7,640' 7,648' 9' 10/13/22 Plugged LB 5A 9,091' 9,111’ 7,651' 7,670' 20' 10/11/22 Plugged UT 5A 9,703' 9,710' 8,208’ 8,214’ 7' 09/29/22 Plugged 4 5 Kyle Wiseman Hilcorp Alaska, LLC Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: Kyle.Wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 12/02/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTAL T#20221202 Well API #PTD #Log Date Log Company Log Type AOGCC Eset# BRU 222-34 50283201860000 222039 11/22/2022 AK E-Line Perf BRU 233-23 50283201360100 222050 11/3/2022 AK E-Line GPT BRU 244-27 50283201850000 222038 11/23/2022 AK E-Line Perf GPT CLU 05RD2 50133204740200 222092 11/17/2022 AK E-Line Perf MPU K-34 50029227120000 196169 11/10/2022 AK E-Line Punch CLU 13 50133206460000 214171 11/12/2022 Halliburton SBHP END 3-25B 50029221250200 203021 11/24/2022 Halliburton PPROF PBU S-15 50029211130000 184071 11/24/2022 Halliburton RBT PBU Z-221 50029237040000 221095 11/17/2022 Halliburton IPROF PBU Z-221 50029237040000 221095 11/19/2022 Halliburton IPROF Please include current contact information if different from above. T37345 T37346 T37347 T37348 T37349 T37350 T37351 T37352 T37353 T37353 By Meredith Guhl at 12:25 pm, Dec 02, 2022 CLU 05RD2 50133204740200 222092 11/17/2022 AK E-Line Perf Meredith Guhl Digitally signed by Meredith Guhl Date: 2022.12.02 12:24:17 -09'00' 1a. Well Status:Oil SPLUG Other Abandoned Suspended 1b. Well Class: 20AAC 25.105 20AAC 25.110 Development Exploratory GINJ WINJ WDSPL No. of Completions: _1 Service Stratigraphic Test 2. Operator Name: 6. Date Comp., Susp., or 14. Permit to Drill Number / Sundry: Aband.: 3. Address: 7. Date Spudded: 15. API Number: 4a. Location of Well (Governmental Section): 8. Date TD Reached: 16. Well Name and Number: Surface: Top of Productive Interval: 9. Ref Elevations: KB: 17. Field / Pool(s): Cannery Loop Unit GL: 20.5' BF:N/A Total Depth: 10. Plug Back Depth MD/TVD: 18. Property Designation: 4b. Location of Well (State Base Plane Coordinates, NAD 27): 11. Total Depth MD/TVD: 19. DNR Approval Number: Surface: x- y- Zone- 4 TPI: x- y- Zone- 4 12. SSSV Depth MD/TVD: 20. Thickness of Permafrost MD/TVD: Total Depth: x- y- Zone- 4 5. Directional or Inclination Survey: Yes (attached) No 13. Water Depth, if Offshore: 21. Re-drill/Lateral Top Window MD/TVD: Submit electronic information per 20 AAC 25.050 N/A (ft MSL) 22. Logs Obtained: 23. BOTTOM 4-1/2" L-80 7,307' 24. Open to production or injection? Yes No 25. 26. Was hydraulic fracturing used during completion? Yes No DEPTH INTERVAL (MD) AMOUNT AND KIND OF MATERIAL USED 27. Date First Production: Method of Operation (Flowing, gas lift, etc.): Hours Tested: Production for Gas-MCF: Test Period Casing Press: Calculated Gas-MCF: Oil Gravity - API (corr): Press. 24-Hour Rate ACID, FRACTURE, CEMENT SQUEEZE, ETC. CASING, LINER AND CEMENTING RECORD List all logs run and, pursuant to AS 31.05.030 and 20 AAC 25.071, submit all electronic data within 90 days of completion, TUBING RECORD 6,229'4-1/2" SIZE DEPTH SET (MD) LTP @ 6,214' / 5,053' PACKER SET (MD/TVD) 6-3/4" L-250 sx / T-185 sx6,214' If Yes, list each interval open (MD/TVD of Top and Bottom; Perforation Size and Number; Date perf'd or liner run): 3800 Centerpoint Drive, Suite 1400, Anchorage, AK 99503 272695 2388620 50-133-20474-02-00September 9, 2022 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION WELL COMPLETION OR RECOMPLETION REPORT AND LOG Hilcorp Alaska, LLC WAG Gas 9/29/2022 222-092 / 322-562 AMOUNT PULLED 275882 276592 TOP SETTING DEPTH MD suspension, or abandonment; or within 90 days of acquisition of the log, whichever occurs first. Types of logs to be listed include, but are not limited to: mud log, spontaneous potential, gamma ray, caliper, resistivity, porosity, magnetic resonance, dipmeter, formation tester, temperature, cement evaluation, casing collar locator, jewelry, and perforation record. Acronyms may be used. Attach a separate page only if necessary. CLU-05RD2September 15, 2022171' FSL, 275' FEL, Sec 7, T5N, R10W, SM, AK 38.5' BOTTOMCASINGWT. PER FT.GRADE CEMENTING RECORD 2390810 SETTING DEPTH TVD 2391348 TOP HOLE SIZE LWD (GR, Res, Density Neutron), Mudlog, OH Wireline (SP/GR), CBL 9-27-22, Perf/Tie In logs Water-Bbl: PRODUCTION TEST 10/13/2022 Date of Test: Oil-Bbl: Flowing *** Please see attached schematic for perforation detail *** Gas-Oil Ratio: 5,053' Per 20 AAC 25.283 (i)(2) attach electronic information 12.6# 9,938' Upper Ty GP, Ty D GP, Beluga GP ADL 060569 / ADL 324602 LOCI 78-156 N/A 6,666' MD / 5,488' TVD 141' MD / 141' TVD 9,940' MD / 8,424' TVD 8,710' MD / 7,308' TVD 2429' FSL, 2416' FEL, Sec 8, T5N, R11W, SM, AK 2300' FNL, 1716' FEL, Sec 8, T5N, R11W, SM, AK Choke Size: Sr Res EngSr Pet GeoSr Pet Eng N/A N/A Oil-Bbl: Water-Bbl: 01787 75 11/23/2022 24 Flow Tubing 17 1258 N/A12580 WINJ SPLUGOther Abandoned Suspended Stratigraphic Test No No (attached) No Form 10-407 Revised 10/2022 Due within 30 days of Completion, Suspension, or Abandonment By James Brooks at 12:30 pm, Nov 29, 2022 Completed 9/29/2022 JSB RBDMS JSB 113022 GDSR-12/8/22 Conventional Core(s): Yes No Sidewall Cores: 30. MD TVD Top of Productive Interval L Beluga 7,880' 6,565' 6,738' 5,555' 7,038' 5,822' 7,762' 6,460' 7,858' 6,545' 7,917' 6,598' 8,594' 7,205' 8,749' 7,344' 9,035' 7,600' 9,195' 7,746' 9,351' 7,887' 9,634' 8,145' 31. List of Attachments: 32. I hereby certify that the foregoing is true and correct to the best of my knowledge. Contact Name: Cody Dinger Digital Signature with Date:Contact Email:cdinger@hilcorp.com Contact Phone: 907-777-8389 General: Item 1a: Item 1b: Item 4b: Item 9: Item 15: Item 19: Item 20: Item 22: Item 23: Item 24: Item 27: Item 28: Item 30: Item 31: MB 8 Formation Name at TD: If Yes, list formations and intervals cored (MD/TVD, From/To), and briefly summarize lithology and presence of oil, gas or water (submit separate pages if needed). Submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results per 20 AAC 25.071 no matter when acquired. Yes No Well tested? Yes No 28. CORE DATA If Yes, list intervals and formations tested, briefly summarizing test results for each. Attach separate pages if needed and submit detailed test info including reports and Excel or ASCII tables per 20 AAC 25.071. NAME Permafrost - Top Permafrost - Base 29. GEOLOGIC MARKERS and POOL BOUNDARIES: (list all encountered) FORMATION TESTS Review the reporting requirements of 20 AAC 25.071 and, pursuant to AS 31.05.030, submit all electronic data within 90 days of completion, suspension, or abandonment; or 90 days after log acquisition, whichever occurs first. Well Class - Service wells: Gas Injection, Water Injection, Water-Alternating-Gas Injection, Salt Water Disposal, Water Supply for Injection, Observation, or Other. Tyonek Lower Beluga UB 7 LB1 Report the Division of Oil & Gas / Division of Mining Land and Water: Plan of Operations (LO/Region YY-123), Land Use Permit (LAS 12345), and/or Easement (ADL 123456) number. The Kelly Bushing, Ground Level, and Base Flange elevations in feet above Mean Sea Level. Use same as reference for depth measurements given in other spaces on this form and in any attachments. The API number reported to AOGCC must be 14 digits (ex: 50-029-20123-00-00). This form and the required attachments provide a complete and concise record for each well drilled in Alaska. Submit a current well schematic diagram with each 10-407. Submit 10-407 and attachments in PDF format to aogcc.permitting@alaska.gov. All laboratory analytical reports from a well must be submitted to the AOGCC, no matter when the analyses are conducted per 20 AAC 25.071. Information to be attached includes, but is not limited to: summary of daily operations, wellbore schematic, directional or inclination survey, as-built, core analysis, paleontological report, production or well test results, per 20 AAC 25.070. Multiple completion is defined as a well producing from more than one pool with production from each pool completely segregated. Each segregated pool is a completion. LB 5 Mid Beluga Pursuant to 20 AAC 25.070, attach to this form: well schematic diagram, summary of daily well operations, directional or inclination survey, and other tests as required including, but not limited to: core analysis, paleontological report, production or well test results. Report measured depth and true vertical thickness of permafrost. Provide MD and TVD for the top and base of permafrost in Box 29. Attached supplemental records should show the details of any multiple stage cementing and the location of the cementing tool. If this well is completed for separate production from more than one interval (multiple completion), so state in item 1, and in item 23 show the producing intervals for only the interval reported in item 26. (Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval). Provide a listing of intervals cored and the corresponding formations, and a brief description in this box. Pursuant to 20 AAC 25.071, submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results, including, but not limited to: porosity, permeability, fluid saturation, fluid composition, fluid fluorescence, vitrinite reflectance, geochemical, or paleontology. Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water Injection, Gas Injection, Shut-in, or Other (explain). Provide a listing of intervals tested and the corresponding formation, and a brief summary in this box. Submit detailed test and analytical laboratory information required by 20 AAC 25.071. TPI (Top of Producing Interval). Authorized Name and INSTRUCTIONS T7 LB 3 LB 4 T1 T5 Wellbore Schematic, Drilling and Completion Reports, Definitive Directional Surveys, Csg and Cmt Report. Authorized Title: Drilling Manager No NoSidewall Cores: Yes No Form 10-407 Revised 10/2022 Submit in PDF format to aogcc.permitting@alaska.gov 11.29.2022 Digitally signed by Monty M Myers DN: cn=Monty M Myers, c=US, o=Hilcorp Alaska, LLC, ou=Technical Services - AK Drilling, email=mmyers@hilcorp.com Reason: I am approving this document Date: 2022.11.29 06:58:57 -09'00' Monty M Myers Updated by CJD 11-28-2022 SCHEMATIC Cannery Loop Unit CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 PBTD = 9,851’ / TVD = 8,343’ TD = 9,940’ / TVD = 8,424’ RKB to GL = 18.12’ Cingsa From 6071’ - 6295’ MD CASING & TUBING DETAIL Size Type Wt Grade Conn. ID Top Btm 20” Conductor 129 - Weld - Surf 142’ 13-3/8" Surf Csg 61.0 K-55 BTC 12.515” Surf 2,970’ 9-5/8” Intermediate Csg 53.5 L-80 BTC 8.535” Surf 1,212’ 9-5/8” Intermediate Csg 47 P-110 BTC 8.681” 1,212’ 6,527’ 7-5/8” Intermediate Lnr 29.7# L-80 Hyd 521 6.875” 6,433’ 6,685’ 4-1/2" Prod Lnr 12.6 L-80 DWC/C 3.958” 6,214’ 9,938’ 4-1/2” Tubing 12.6 L-80 DWC/C 3.958” Surf 6,229’ 2 20” 13-3/8” 16” hole 4-1/2” JEWELRY DETAIL No. Depth ID OD Item 1 141 3.813” 6.600” Baker S-5 TRSSSV 2 6,214’ 7.37” 7”x 9-5/8” SLZXP HRDE Liner top packer, w/ 7.37” PBR 3 6,433’ 3.958” 6.875” 7-5/8” ZXP Liner Top Packer 4 8,710’ 3.958” CIBP set 10/20/22 5 9,678’ - 3.958” CIBP w/ 26’ of cement 10/5/22, tagged 9,667’ CTM OPEN HOLE / CEMENT DETAIL 13-3/8” Fully cemented with 140bbls back to surface (CLU-05 in 1996) 9-5/8” 12-1/4” hole: Pumped from 9178’ MD. 850sxs lead (375bbls) and 1069 sxs (222bbls) tail (CLU-05 in 1996) 11/19/96 USIT shows 9-5/8” cemented up to at least 2800’ MD (stopped logging there) 7-5/8” 8-1/2” hole: Cemented with 102.7bbls 15.3ppg class G. had losses and got no cement back to surface. 9/24/20 SCMT shows good cement up to at least 6,525 MD (behind tubing above that) 4-1/2” 6-3/4” hole: Lead - 250 sx / 12.5 ppg / 90 bbls Tail - 185 sx / 15.3 ppg / 39 bbls TOC 6,700’ MD 4 9-5/8” 1 CLU-05RD (Abandoned) Window @ 6,666’ 6-3/4” hole 7-5/8” 3 Squeezed perfs 7/22/22 PERFORATION DETAIL Sands Top (MD) Btm (MD) Top (TVD) Btm (TVD) FT Date Status LB 7,880' 7,898' 6,565' 6,581' 18' 11/08/22 Open LB1 7,921' 7,927' 6,602' 6,607' 6' 11/08/22 Open LB1C Upper 7,984' 7,993' 6,658' 6,666' 9' 11/08/22 Open LB1G Upper 8,162' 8,177' 6,816' 6,830' 15' 11/08/22 Open LB1G Lower 8,186' 8,204' 6,838' 6,854' 18' 11/08/22 Open LB2 Lower 8,265' 8,282' 6,908' 6,923' 17' 11/08/22 Open LB2C Upper 8,382' 8,402' 7,013' 7,031' 20' 11/08/22 Open LB2C Lower 8,414' 8,424' 7,042' 7,051' 20' 11/07/22 Open LB2D Upper 8,438' 8,452' 7,064' 7,076' 14' 11/01/22 Open LB2E Lower 8,576' 8,593' 7,188' 7,204' 17' 11/01/22 Open LB Upper 8,597' 8,606' 7,207' 7,215' 9' 11/01/22 Open LB3A Upper 8,643' 8,648' 7,249' 7,253' 5' 11/01/22 Open LB1B Lower 7,952' 7,958' 6,629' 6,635' 6' 10/27/22 Open LB1B 7,969' 7,974' 6,644' 6,649' 5' 10/28/22 Open LB1F Upper 8,076' 8,082' 6,740' 6,745' 6' 10/27/22 Open LB1F Mid 8,094' 8,119' 6,756' 6,778' 26' 10/27/22 Open LB1F Lower 8,128' 8,140' 6,786' 6,797' 12' 10/27/22 Open LB2B 8,328' 8,348' 6,964' 6,982' 20' 10/27/22 Open LB3A Lower 8,668' 8,678’ 7,271' 7,280' 10’ 10/20/22 Open LB3C Upper 8,718' 8,730' 7,316' 7,327' 12' 10/17/22 Plugged LB 3C Lower 8,740' 8,747' 7,336' 7,342' 7' 10/17/22 Plugged LB 4 Upper 8,765' 8,783’ 7,358' 7,374' 28' 10/17/22 Plugged LB 4 Lower 8,806' 8,814' 7,395' 7,402' 8' 10/17/22 Plugged LB 4A 8,844' 8,856' 7,429' 7,440' 12' 10/17/22 Plugged LB4C Upper 8,919’ 8,939’ 7,496' 7,514' 20' 10/14/22 Plugged LB 4C Lower 8,955' 8,972' 7,528' 7,544' 17' 10/14/22 Plugged LB4D Mid 9,006’ 9,012' 7,574' 7,580' 6' 10/14/22 Plugged LB 4D Lower 9,020' 9,030’ 7,587' 7,596' 10' 10/13/22 Plugged LB 5 Lower 9,078' 9,087’ 7,640' 7,648' 9' 10/13/22 Plugged LB 5A 9,091' 9,111’ 7,651' 7,670' 20' 10/11/22 Plugged UT 5A 9,703' 9,710' 8,208’ 8,214’ 7' 09/29/22 Plugged 4 5 Activity Date Ops Summary 9/6/2022 Scope in derrick, Secure derrick for laying over, Lay over derrick, Secure derrick for shipping. Lay over Mud Gas Separator, Scope in doghouse, Lower doghouse into water tank, Complete rigging down all electrical, Pason, Hydraulics, Utility lines. Blow down water lines and remove. Crane/ Tail roll;Iron Roughneck, Choke house, Mud pits 1, 2 and 3. Accumulator/ Water tank/ Doghouse skid, Generator/ Air compressor skid, Mud pumps 1 and 2 skids, Mud pump jig, catwalk and BOPE stack.;Remove derrick from draworks skid and secure on trailer, move drilling line spool and secure on same trailer. Remove draworks skid and secure on trailer. Crane sub base onto trailer and secure. At 1300 hours mob equipment to Cannery Loop Pad #1. Load pony subs and HPU skid on trailer and secure same;At Cannery Loop Pad #1 Set pony subs. Set in sub base. Center sub base over hole. Set the drawworks and pin to sub. Crane in drill line spool. Crane in the derrick and pin to sub. Hook up hydraulics. Raise the windwalls on the board. R/U the IR HPU.;Set the water tank/ koomey house. Raise V-door. Raise and scope into position. Set pit/pump house jig. Set pit module#1. Craned in the iron roughneck. Raised the dog house. Craned in the choke house. Set pit module#2.;Raised derrick to half mast. Set pit module #2. Set pit module #3. Raised the roofs on the pit modules. Crane in the centrifuge, Set generator house, Set gas buster. Set TD HPU module.;Raised the vacuum degasser and connected lines. Set in pump#1 module. Set BOP stack off of trailer and hang on the sub bridge cranes. Set pump#2 module. Set the boiler house.;R/U jumper lines between pits and pumps. Connected electrical. Turn on lights around the rig. Connect hydraulic, fuel and water lines. R/U brake linkage and air to drillers console. Set the kelly hose/service loop and drill line on the rig floor.;Installed the dog knot on the drill line and anchored to drum. R/U lines in pit modules.;Laid felt, liner and matts for the catwalk. Spooled up the drilling line. R/U the Pason system. R/U electrical lines. R/U instrument lines to the Driller's console. Charged air lines. R/U choke house lines to the shakers. Spot in the third party shacks. Spot auxiliary fuel tank.;R/U utility lines. R/U high pressure mud lines. R/U hydraulic lines to the choke house. R/U boiler. R/U CCI shack. R/U TD HPU. Installed torque tube turnbuckles. RKB 17.88' GL 18.12' LD;Installed equalizers between mud tanks. 9/7/2022 Rig up transfer lines and dresser sleeves between pits, Dump lines to cuttings box, shipping blocks on shakers, Degasser in pits, Suction from pit 7 to mud pumps, Suction between MP1 and MP2, Accumulator lines. Rig up controls and function test iron roughneck. Rig up catwalk, Torque tube,;Remove centrifugal pumps from hopper #1, Clean and organize roughneck shack, Clean and organize choke house, Spot Gen 3 with crane and rig up. Scope up derrick and dog in pins, Rig up derrick board, Rig up MGS vent line and continue rigging up electrical lines. Tear down office trailers and crew;quarters at Pearl pad and move to Cannery Loop pad #1.;Tie off bridal lines in derrick. Adjust the torque tube . Inspect derrick. Rig up to pick up top drive. Pick up and rig up top drive to blocks. Lay down top drive cradle. Pick up and rig up torque bushing to top drive. Rig up kelly hose and service loop. Office trailers and crew quarter trailers;arrive from Pearl pad. Spot all equipment, rig up and connect communication lines. Crane new centrifuge, feed pump and control panel. Welder work on tabs for centrifuge and remove needed grating. Crane windwalls and install on pit modules. Continue rigging up in pits, installing water, air and;steam around rig. Continue installing new centrifuge, Remove dry hole tree from well and begin nippling up BOPE stack.;Open ram doors and inspect rams and cavities. washed out stack. Variable rams in the top and fixed rams in the bottom. Installed choke HCR. choke line and kill line. Chain stack. Installed the trip nipple. and the flow box. Installed the flow nipple.;Installed the fill-up line, flow line and bleeder Continued working on the centrifuge stand. Continued rigging up the pits. Continued hooking up service lines around the rig. Installed hopper and gun pumps#1 in pit module#1. Checked accumulator bottles and filled as required.;Worked on rig acceptance check list.;Dressed out rig floor bales/elevators, tongs, subs and mouse hole. Filled the mud tanks. Functioned all pumps, agitators, mud pumps, top drive, pressurized the accumulator and function tested. Filled the hole. Tested the rig service lines to 2500psi. R/U BOPE testing equipment.;Rig accepted at 06:00hrs 9/8/2022.;Hauled: 0 bbl Solids to KGF G&I Cumulative: 0 bbl Hauled: 0 bbl Fluid to KGF G&I Cumulative: 0 bbl Hauled: 0 bbl Cement to KGF G&I Cumulative: 0 bbl Lost: 0 bbl Fluid Down Hole Cumulative: 0 bbl Daily Metal: 0 lbs Cumulative: 0 lbs 18 n (LAT/LONG): evation (RKB): API #: Well Name: Field: County/State: CLU 005RD2 Cannery Loop Hilcorp Energy Company Composite Report , Alaska Contractor AFE #: AFE $: Job Name:221-00096 CLU-05RD2 Drilling Spud Date: 9/8/2022 P/U 4-1/2" test joint and install test plug and set in wellhead. R/U equipment for testing BOPE. Flood and purge all lines and equipment for Initial BOPE test. AOGCC Jim Regg waived witness of BOPE test yesterday at 14:07pm.;Attempted to get shell test with no success, Leak was detected through IA valve at 2 drops per second. Pulled test plug and replaced seal ring with new one and attempted shell test again with same results. The current wellhead has two guide pins 90° from IA casing ports. We removed the 4-1/2" test;joint, closed the blind rams and pressured up to 4000psi. to seal the test plug. It worked and leak was stopped that was previously observed at the IA valve. We bled off and placed the 4-1/2" test joint back into the test plug and was unable to get a shell test against the Annular Preventer. IA was;leaking as previously observed. We bled off and pulled the test plug and changed the seal ring again, rotated the configuration 180° and set in wellhead. Unscrewed the test joint, closed the blind rams and seated and tested to 4000psi. successfully with no leaks at the IA. We then made up the test;joint, closed the lower pipe rams and tested to 250/ 4000psi successfully with no more leaks at the IA. We then began the shell test process by flooding and purging all lines, closing the Annular Preventer and performed a successful 250/ 4000psi shell test. During all this time this morning;contacted wellhead supervisor and discussed the happenings in which they sent a transitional spool to location to place between the BOPE stack and the existing wellhead to use for testing with a conventional test plug if we were not successful.;Complete Initial BOPE test 250/ 4000psi for 5/ 5 minutes each. One FP on Annular Preventer high test due to air in system.;Rig down test equipment, blow down all lines. Make up and install 9" ID wear ring. Strap and Tally drill pipe on racks. Fix service loop cover on top drive.;M/U 6-3/4" Bit, Bit sub and crossover and RIH picking up 4-1/2" 16.60# S-135 CDS40 drill pipe F/ surface T/4954'.;Continued to P/U 4.5" DP and break-in recuts F/4954' to 6687' and tag TOC. Total 217joints P/U and L/D 1 joint.;POOH and rack back 4.5" DP. @ 2400';Hauled: 0 bbl Solids to KGF G&I Cumulative: 0 bbl Hauled: 0 bbl Fluid to KGF G&I Cumulative: 0 bbl Hauled: 0 bbl Cement to KGF G&I Cumulative: 0 bbl Lost: 0 bbl Fluid Down Hole Cumulative: 0 bbl Daily Metal: 0 lbs Cumulative: 0 lbs 9/9/2022 Continue POOH with 6-3/4" bit standing back drill pipe F/ 2400' T/ 65'. P/U and M/U 18 joints of 4-1/2" HWDP and RIH T/ 1015', POOH and stand back 9 stands of HWDP. P/U last stand of drill pipe high and break off, crossover, bit sub and bit.;PJSM, P/U and make up mill assembly with MWD tools obtain high side of whipstock tray at 310.6°. M/U Top Drive and shallow test MWD tools, Good. Break off TD from MWD tools and P/U whipstock and remove anchor shipping assembly, Set whipstock in hole on false rotary table and connect shear bolt as;per whipstock representative. P/U and confirm good connection and remove whipstock lifting assembly.;RIH with whipstock/ Mill assembly F/ Surface T/ 696' PUW 37K SOW 35K.;Service rig. Changed O-rings on top drive service loop line and IBOP actuator line.;Continue RIH with 7-5/8" Whipstock/ Mill assembly F/ 696' T/6205'.;Built mud for displacement. Circulated and tested MWD tools. Troubleshot and solved a detection issue with the MWD tools. P/U 120K S/O 95K.;Cont. RIH F/6205' T/6598'. Had 5K set down X2 at 6598'. Screwed in and oriented whipstock 30R and worked through tight spot with pumps on. Continued to wash to TOC F/6598' T/6688'. Set the whipstock with 8K down, bottom @ 6686'. Sheared the mills off with 35K down. P/U 126 K S/O 96K.;Empty pit 7 and prep for displacement.;Displaced well to 9.5ppg 6% KCL PHPA mud. 290GPM 790psi.;Milled window 60-100RPM 10,000-15000 TQ 275-300GPM 1050-1250psi. P/U 126 S/O 96K MWin 9.5ppg MW out 9.56ppg. Began building batch of 300bbls 9.5ppg 6% KCL PHPA mud. Cleaned and organized around the rig. TOW 6666' BOW 6677.5'.;Drill rathole below window 6678' to 6695' 300GPM 1200psi 80RPM 10-11K TQ. 9/10/2022 Complete rathole below window F/ 6695' T/ 6698' 300GPM 1200psi 80RPM 10-11K TQ, CBU while dressing window as per whipstock representative. Sweep came back 29 BBLs early. Dry drift window with no problems observed. 15 Lbs of metal recovered so far.;R/U testing equipment and purge all lines for Fit T/ 14# EMW. Pumped 82.8 gallons and observed leak off at 945 psi. Bled back 58.8 gallons. Send results to Engineer for AOGCC approval. 12.8ppg EMW approval.;While prepping to shim sub base string was pulled into VBRs with a tool joint in upper ram cavity with 43K overpull observed. Notifications were made and lower pipe rams were shut with a hose rigged up to IA for trip tank. Well is static. Open upper rams to ensure there is no debris and inspect.;Observed Turbo out on rig floor motor, Replace turbocharger on rig floor motor. Contact AOGCC for notification of events and plan forward to change rams and test UPRs 250/ 4000 psi when out of the hole.;PJSM, Monitor Well, Static POOH with milling assembly F/ 6645' to surface. L/D milling assy . Gauge the mills. Window mill 3/16" under gauge. Follow mill 1/16" under gauge, Gauge mill 1/16" under gauge.;Cleaned and cleared the rig floor.;Pulled the wear bushing. Set the test plug. Backed out the test joint. Closed the blind rams. Installed 4 1/2" fixed rams in the upper ram cavity. Shell tested the stack to 4000psi OK. Tested the upper rams and the low test failed.;Opened the ram doors and removed the 4 1/2" fixed rams and attempted to install a rental set of 2 7/8" X 4 1/2" VBR's. The doors would not close with the VBR's. We then reinstalled the 4 1/2" fixed rams but switched the ODS ram to DS and visa versa.;Tested the upper rams 250/4000psi 5min OK. Pulled the test plug and set the wear bushing. R/D test equipment. Cleaned and cleared the rig floor.;PJSM. P/U 6 3/4" bit, mud motor and MWD BHA#3 to 120'. Shallow test the MWD OK.;Continue to RIH w/BHA#3 120' to 5059' P/U 105K S/O 70K.;Hauled: 0 bbl Solids to KGF G&I Cumulative: 0 bbl Hauled: 520 bbl Fluid to KGF G&I Cumulative: 520 bbl Hauled: 0 bbl Cement to KGF G&I Cumulative: 0 bbl Lost: 0 bbl Fluid Down Hole Cumulative: 0 bbl Daily Metal: 15 lbs Cumulative: 15 lb 9/11/2022 Continue to RIH with BHA#3 Directional/ Motor with 6-3/4" PDC bit F/ 5059' T/ 6698' orient motor before passing through window and no problem easing through window P/U 145K S/O 95K.;Drill F/ 6698' md T/ 7095' md Sliding as needed to get away from parent wellbore. GPM 275, SPP 1660psi, Diff 250psi, RPM 60, TQ 10.5K, WOB 7K, Max Gas 100 units, P/U 155K, S/O 93K, ROT 118K, Obtain SPRs at 7095' md, 5869' tvd, MW=9.5ppg. MP1 46spm/ 426psi, MP2 47spm/ 426psi. Survey on Bottom.;Flow check well= Slight seepage. POOH F/ 7095' T/ 113'. P/U 159K, S/O 94K.;Stood back flex collars. Drained the motor and graded bit 1,1,WT, X,I,NO,BHA.;Cleaned and cleared the rig floor.;M/U BHA#4. Uploaded to the tools. Shallow pulse tested the tools. Loaded radioactive sources. M/U flex collars, HWDP and jars.;P/U 4.5" DP while RIH at 3400'.;At 7096' distance to well plan 24.8' , 14.87' high 19.83' right. rotating hrs 3.09 sliding hrs .63;Hauled: 8.5 bbl Solids to KGF G&I Cumulative: 8.5 bbl Hauled: 76.5 bbl Fluid to KGF G&I Cumulative: 596.5 bbl Hauled: 0 bbl Cement to KGF G&I Cumulative: 0 bbl Lost: 0 bbl Fluid Down Hole Cumulative: 0 bbl Daily Metal: 3 lbs Cumulative: 18 lbs 9/12/2022 Continue RIH with 6-3/4" triple combo BHA #4 picking up 4-1/2" 16.60# S-135 drill pipe F/ 3400' T/ 3644', Turn elevators to facing v door and continue RIH with drill pipe from derrick F/ 3644' T/ 6616' P/U 144K S/O 94K.;Establish circulation, Obtain new SPRs @ 6616' MD 5441' TVD, MP #1 46 SPM 511 PSI, MP #2 47 SPM 517 PSI shut down pump and pass through window without orientation with no set downs or problems and continue RIH F/ 6616' MD T/ 6803' MD with TM collar 5' below BOW MADD PASS T/ 7095' MD.;GPM 280, SPP 1530 PSI, RPM 50, FPH 180.;Tag bottom at 7095' MD, Pump Hi-Vis sweep and start drilling F/ 7095' MD T/ 7139' MD. GPM 274, SPP 1850psi, Diff 267psi, RPM 60, TQ 10.2K, WOB 5K, Max Gas 15 units, ECD 10.2 PPG, P/U 144K, S/O 96K, ROT 118K.;Continue drilling 6-3/4" Production hole F/ 7139' MD T/ 7477' MD. MW in 10.4 ppg Vis 51, MW out 10.25 ppg Vis 50, GPM 275, SPP 1870psi, Diff 160psi, RPM 70, TQ 10.8K, WOB 4K, Max Gas 186 units, ECD 10.8 PPG, P/U 154K, S/O 98K, ROT 123K.;Continued drilling 6-3/4" Production hole F/ 7477' MD to 7865' MW in 10.5 ppg Vis 57, MW out 10.5 ppg Vis 53, GPM 275, SPP 2070psi, Diff 260psi, RPM 60, TQ 10.9K, WOB 5K, Max Gas 144 units, ECD 11.2 PPG, P/U167 K, S/O 97K, ROT 124K.;Continued drilling 6-3/4" Production hole F/ 7865' MD to 8096' MW in 10.45 ppg Vis 55, MW out 10.5 ppg Vis 54, GPM 275, SPP 2050psi, Diff 250psi, RPM 60, TQ 11K, WOB 5K, Max Gas 150 units , ECD 11.2 PPG, P/U 167K, S/O 97K, ROT 124K.;CBU 275GPM, 1900psi, 60RPM, TQ 11K, ECD 11.23ppg B/U gas 225 units.;Flow check, slight seepage. POOH F/8096' to 7720'. Tight spots 20-25K over @ 7923', 7847', 7783', 7773'7759'. B/R 7782' -7720'.;At 8096' 24.90' from the plan 20.90' high 13.5' right Slide 1.45hrs Rotate 9.19hrs.;Hauled: 20 bbl Solids to KGF G&I Cumulative: 29 bbl Hauled: 60 bbl Fluid to KGF G&I Cumulative: 657 bbl Hauled: 0 bbl Cement to KGF G&I Cumulative: 0 bbl Lost: 10.3bbl Fluid Down Hole Cumulative: 30.9 bbl Daily Metal: 3 lbs Cumulative: 21 lbs 9/13/2022 Continue POOH F/ 7720' MD T/ 7047' with several 25K overpulls and wiping. Backream F/ 7344' MD T/ 7047' GPM 270, SPP 1990 psi, RPM 80, P/U 185K, S/O 97K.;Service crown, Blocks, Top Drive, Iron Roughneck, Pac Rim, Gear Box, Drive Line, Floor Motor, Brake Linkage and Draworks. Clean Rig Floor, Monitor Trip tank with no loss or gains.;RIH on elevators F/ 7047' and wash last stand down T/ 8096'.;Make connection and send 20 BBL Hi-Vis sweep and drill ahead F/ 8096' MD T/ 8220' MD, MW in 10.5 ppg Vis 56, MW in 10.5 ppg Vis 56, GPM 275, SPP 2275psi, Diff 330psi, RPM 60, TQ 11.7K, WOB 5K, Max Gas 154 units, ECD 11.1 PPG, P/U 185K, S/O 97K, ROT 126K.;Continue Drilling 6-3/4" Production Hole F/ 8220' MD T/ 8494' MD, MW in 10.55 ppg Vis 56, MW in 10.55 ppg Vis 59, GPM 275, SPP 2300psi, Diff 350psi, RPM 60, TQ 12.1K, WOB 5K, Max Gas 205 units, ECD 11.4 PPG, P/U 190K, S/O 101K, ROT 132K.;Continue Drilling 6-3/4" Production Hole F/ 8494' MD T/ 8785' MD, Pumped hi-vis sweep @ 8590' -Returned on time W20% increase MW in 10.6 ppg Vis 56, MW in 106 ppg Vis 59, GPM 275, SPP 2380psi, Diff 350psi, RPM 60, TQ 12.6K, WOB 5K, Max Gas 268 units, ECD 11.5 PPG, P/U 197K, S/O 102K, ROT 134K.;Continue Drilling 6-3/4" Production Hole F/ 8785' MD T/ 8860' MD, MW in 10.75ppg Vis 56, MW in 107 ppg Vis 59, GPM 275, SPP 2490psi, Diff 350psi, RPM 60, TQ 12.3K, WOB 5K, Max Gas 268 units, ECD 11.65 PPG, P/U 200K, S/O 103K, ROT 134K. 9/14/2022 Continue Drilling 6-3/4" Production Hole F/ 8860' MD T/ 9086' MD, MW in 10.85ppg Vis 66, MW 0ut 10.9ppg Vis 66, GPM 285, SPP 2775psi, Diff 350psi, RPM 80, TQ 11.8K, WOB 7K, Max Gas 27 units, ECD 11.8 PPG, P/U 199K, S/O 106K, ROT 138K;Continue Drilling 6-3/4" Production Hole F/ 9086' MD T/ 9209' MD, MW in 11.3ppg Vis 66, MW 0ut 11.1ppg Vis 65, GPM 285, SPP 2750psi, Diff 300psi, RPM 80, TQ 12.2K, WOB 6K, Max Gas 163 units, ECD 12.07 PPG, P/U 198K, S/O 108K, ROT 139K;SPRs @ 9209'MD, 7758'TVD, MP #! 46spm 704psi, MP #2 717psi, MW 11.3ppg Obtain Survey, Flowcheck= Static.;POOH on elevators F/ 9209' MD T/ 8090' MD, P/U 187K, S/O 102K @ 8100' MD.;Service Crown, Blocks, Top Drive, Iron Roughneck, Draworks, Brake Linkage and Driveshaft.;RIH with elevators F/ 8090' MD T/ 9209' MD, Washing last stand to bottom. P/U 205K, S/O 110K;Pump sweep and circulate and condition until MW In and Out are at 11.3ppg. GPM 260, SPP 2400, RPM 80, TQ 12.3K. Sweep returned on time with 10/15% increase in cuttings;Continue Drilling 6-3/4" Production Hole F/ 9209' MD T/ 9457' MD, MW in 11.3ppg Vis 66, MW 0ut 11.3ppg Vis 65, GPM 270, SPP 2600psi, Diff 230psi, RPM 80, TQ 12.3K, WOB 5K, Max Gas 163 units, ECD 12.24 PPG, P/U 200K, S/O 110K, ROT 140K;Continue Drilling 6-3/4" Production Hole F/ 9209' MD T/ 9703' MD, MW in 11.3ppg Vis 66, MW 0ut 11.3ppg Vis 65, GPM 270, SPP 2600psi, Diff 230psi, RPM 80, TQ 12.3K, WOB 5K, Max Gas 62 units, ECD 12.24 PPG, P/U 198K, S/O 110K, ROT 143K 9/15/2022 Drill 6-3/4" Production Hole F/ 9703' MD T/ 9940' MD, MW in 11.3ppg Vis 64, MW 0ut 11.35ppg Vis 65, GPM 270, SPP 2875psi, Diff 450psi, RPM 70, TQ 11.8K, WOB 12K, Max Gas 170 units, ECD 12.5 PPG, P/U 205K, S/O 110K, ROT 143K. Obtain SPRs MP #1 46spm 825psi, MP #2 47spm 833psi;Circulate Hi- Vis sweep, sweep back on time with 25% increase in cuttings. GPM 270, SPP 2650psi, RPM 70, TQ 12.1K;Flowcheck well Static, POOH F/ 9940' MD T/7065', P/U 150K, S/O 58K.;Ream F/ 7065' to 6797' 266gpm @ 2150 psi, 30-80 rpm @ 7.7K tq. Wash F/6797' to 6690' 266 gpm @ 1950psi. Shut down pumps and pulled bit thru window to 6610';Service rig and slip and cut 105' of drill line, perform weekly BOPE function test;POOH F/6610' to 737'. stand back HWDP and Non-mag. Remove sources and download MWD. L/D BHA. Bit grade 1-1 9/16/2022 Clean and Clear Rig Floor;PJSM, Lay out logging tools on catwalk, R/U sheaves, cable head, P/U Jar enhancer, E-Line jars, Gamma tool and RIH and work through tight spots and reach 7542' WLM and unable to get any deeper. POOH and R/D logging tools and equipment. Leave unit and equipment on location.;Monitor Well on trip tank during logging operations with no gains or losses.;PJSM, M/U 6-3/4" cleanout BHA #5, RIH with flex collars and HWDP/ Jars.;RIH with BHA #5 F/ 623' MD T/ 7464' MD. P/U 140K, S/O 95K, Fill pipe every 2000'. Attempt to work through tight spots without pumps.;Ream down from 7464' MD to 7555' and circulate bottoms up. 320 GPM, Spp1540, RPM 80, tq 8.7,;RIH F 7555' T 9866' MD working thru multiple tight spots with 10-20K drag. Fill pipe and Circ drill pipe volume @ 8950. Attempt to work thru tight spot at 9866' Kelly up and ream down to 9940' md. with 10' of fill on bottom. P/U 210K, S/O 105K, ROT 145K, 320 GPM @ 2000 ssp. rpm 75 , tq 12.3;Pump hi-vis/Nut plug sweep. P/U 210K, S/O 105K, ROT 145K, 320 GPM @ 2000 ssp. rpm 75 , tq 12.3. sweep returned on time with 25% increase in cuttings SPR MP1 46 SPM/564psi , MP2 47 SPM/ 560PSI Flow check well;POOH F/ 9940' to 6618' with no issues. Drop drift and cont to POOH to 5342' 9/17/2022 Continue POOH with 6-3/4" cleanout BHA #5 F/ 5342' T/ 623'.;L/D HWDP, Jars, Flex collars, 6-1/2" Stabilizer, Bit sub and 6-3/4" Bit.;Clean and Clear rig floor.;PJSM with all involved with wireline operations, Hang sheave in elevators, M/U SP logging tool string.;RIH with SP logging assembly F/ surface T/ 9240'. Confirm with Geologist depth is good and begin logging open hole. Log well F/ 9240' T/ 6678' Monitoring well on trip tank.;R/D and L/D E-Line logging tools and equipment. Bring 9-5/8" scraper and crossovers to rig floor.;P/U 9 5/8" scraper assembly and RIH to 6255' P/U 110K, S/O 65K;Work Scraper F/ 6200' to 6250' (packer setting depth) 5 times. Flow check well and drop drift;POOH F/ 6250' to surface and L/D BHA P/U 100K, S/O 60K;Clear rig floor, service rig.;R/U casing equipment. and lay out pipe on catwalk 9/18/2022 R/U Casing tongs, Elevators and slips for running 4-1/2" 12.6# L-80 DWC/ C-HT Liner. M/U correct crossover to floor valve.;Waiting on confirmation of LTP crossovers arriving in Anchorage before starting to RIH with 4-1/2" Liner, Otherwise we will RIH with 6-3/4" cleanout assembly BHA #5 again. Replace Roller/ Sprocket bearings on Iron Roughneck, Replace fan belts on floor motor, Inspect crown, Clean/ Organize throughout;Rig, Monitor well on trip tank with no gains or losses.;Continue waiting for confirmation of LTP crossovers arriving in Anchorage from Hotshot driver. General housekeeping and pressure washing around rig, Mobilize crossover subs and drill pipe pups to pipe skate for upcoming liner run. Monitor well on trip tank with no gains or losses.;Receive confirmation from Hotshot driver that they have loaded the crossover pups needed for the LTP and the Bullet seal assembly at 14:35pm.;PJSM, P/U and M/U shoe track with Baker-Lok and confirm floats are good. RIH with 4-1/2" 12.6# L-80 Range III DWC/ C-HT liner F/ 128' T/ 1689' Torque connections to 6150 ft/ lbs. Received call from Baker representative that was at Yellowjacket and the crossover is box x box. Will not work.;POOH L/D 4 1/2" liner F/1698' to 290'. Received call from Baker representative that needed X/O's were found;RIH with 4 1/2" liner F/ 290' T/ 3735' TQ connections to 6150ft/lbs, Change out handling equipment and M/U liner hanger assembly , Circ. liner volume and get parameters. Pumps on. P/U 50K, S/O 43K, pumps off P/U 55K, S/O 47K. 15 rpm @ 3.1K tq.;R/D casing equipment, Change out slips/elevators. RIH F/3735' T/4914' 9/19/2022 Continue RIH with 4-1/2" 12.6# L-80 DWC/ C-HT Liner with drill pipe F/ 4914' MD T/ 6645' MD filling pipe every 1500'. P/U 104K S/O 75K;CBU before passing through window. GPM 225, SPP 485psi, P/U 97K S/O 73K.;Continue RIH with 4-1/2" 12.6# L-80 DWC/ C-HT Liner with drill pipe F/ 6645' MD T/ 9940' MD filling pipe every 1500' and circulating open hole volume. Wash last stand to bottom. P/U 175K S/O 95K;P/U cement head, circulate and condition mud for cement job, R/U cementers, P/U cementing equipment. GPM 215, SPP 850 psi. P/U 175K S/O 95K.;PJSM, Cementing 4-1/2" Production Liner with all involved personnel, Pressure test lines T/ 650 psi Low, 4800 psi high. Good test. Mix and pump 30 BBLs 12ppg spacer @ 5 BPM, 600 psi. Pump 90 BBLs (250 SKS) 12.5ppg lead cement @ 4 BPM, 360 psi. Pump 39 BBLS (185 SKS) 15.3ppg tail cement @ 4BPM, 80psi;Clean surface lines with 12 BBLs water, Drop drill pipe wiper dart with 10 BBLs water, 125.1 BBLs of 11.3ppg mud @ 4 BPM, 420 psi, slow down to 3 BPM for the last 20 BBLs. Pressure before plug bump at 1040psi. Bump plug at 135.1 total ( 5 BBLs early) pressure up and set Hanger at 2600psi,;and bring pressure up to 4100 psi to release HRDE tool, Bleed off 1.5 BBL and floats held. CIP @ 18:05pm. Set down and set Packer and P/U string 3' and L/D Cement head. M/U Top Drive to 15' pup and pressure up to 500psi and pull running tool from Liner Top Packer;Circulate 2 CBU's, 275GPM, 520psi. Approx 30 bbls spacer and trace cement returned. Cement strung out thru circulation. Drop clean out balls and circ DP volume. Flow check well P/U 110K, S/O 85K;POOH F/ 6178' to surface and L/D running tool;Clean and clear floor, break down cement head, Flush and wash BOP's with black water.;P/U Polish mill BHA and TIH from surface T/ 3954' 9/20/2022 Continue RIH with Polish mill BHA and TIH f/ 3954' MD t/ 6219' -6229' MD Polish Liner top 150 gpm;Displace well t/ 8.4 ppg inhibited fluid, R/U and reverse circulate 5 bpm 415 bbls;POOH L/D DP sucking wiper balls through pipe and redoping and installing thread protectors;R/U and test casing to 2500 psi f/ 10 min on chart 4.3 bbls pumped 4.3 bbls returned;RIH w/ w/ remaining DP in derrick T/3400' P/U 70K, S/O 57K;POOH L/D DP f/3400' to surface.;Clear rig floor, service rig . Pull wear bushing. R/U casing tongs and handling equipment. Prep Tie-back completion;M/U seal assembly and TIH with 4 1/2" tie-back completion from surface T/ 4382' 9/21/2022 Continue RIH w/ 4.5'' Tie Back as per Detail f/ 4382' t/ 6118' RIH and space out, L/D 2 jts P/U Space 29.11' of out pups, M/U hanger and landing jt, Land on hanger RILDS, R/D TRS equipment Clear floor.;R/U and test Tubing t/ 4000 psi f/ 10 min Test IA t/ 2500 psi f/ 10 min good tests.;Flush Lines install TWC, Flush stack and drain, Open Ram doors and clean ram cavities, change uppers t/ 2 7/8x5 VBR's< Remove flow box and choke and kill lines, N/D BOP Stack.;Clean Wellhead and API groove, N/U tree and terminate control line through tree adaptor flange. N/U dry hole tree and test voids to 5000psi for 15min each. R/D top drive bails and saver sub.;Pressure test tree to 5000psi. Leaked around seal ring. tighten bolts and re-test- good test.;Pressure test tubing to 4000 psi for 30 min. 94.3 gal pumped, 105 gal returned.;Pressure test Annulus to 2500psi for 30 min. 145 gal pumped, 155 gal returned. R/D test equipment and Close/bleed off SSV.;R/D top drive and rig equipment. Prep Derick to scope down. Release rig @06:00 hrs. Activity Date Ops Summary 9/26/2022 Fox coil arrive at office, hold TBT and approve PTW. MIRU coil equipment. Spot supply and return rain for rent tanks.,Test BOPE to 250 psi low / 4000 psi high. Did not get a response from AOGCC about witness of BOPE test.,Mobilize manlift and Yellow jacket pump to location. Fill supply tank with 400 bbls of freshwater. SDFN 9/27/2022 Fox arrive on location and hold TBT, approve PTW. MU CTC and pull test to 30k. MU DFCV's, Disco, jars, motor and PT 3500 psi. MU 3.75" mill.,PT lubricator to 250/4000 psi. Open swab and RIH. Tag SSSV at 143'. Unable to get through with 3.75" mill. POOH. MU 3.65" flat bottom junk mill.,RIH with 3.65" junk mill. Run through SSSV without seeing any weight bobbles. Tag at 9802' ctmd. Online with pump at 1.3 bpm and 2800 psi. Mill through restriction easily. continue to RIH pumping and tag PBTD at 9854' ctmd.,Pump water at PBTD and circulate out drilling mud from liner. Chase mud to surface while POOH. Stop pumping at 500' and pull through SSSV without issues. Coil at surface, close swab.,Laydown milling BHA and lubricator. Set injector on back deck. Leave BOPs on well for E-line.,Yellow Jacket E-line MU lubricator and CBL toolstring. RIH and calibrate tool in free pipe. Tie into Liner hanger. Tag PBTD at 9795' (uncorrected), sticky while picking up off bottom. Log up to above liner hanger. GR stopped working, but CBL data is good. Estimated TOC = 6700' RIH to PBTD and able to get GR working, log up to above liner hanger with GR.,POOH with CBL toolstring. RDMO E-line. Secure well for the night. 9/28/2022 Fox coil arrive on location, hold TBT and approve PTW. Pick up injector and lubricator, MU roll on connector, DFCV's, stinger and 2.125" nozzle. Go to the well and PT lubricator to 250/4000 psi. Haul off Yellow Jacket pump and move in N2 pump and transport.,Open swab and RIH. Start pumping N2 at 1000 scfm at 7000'. RIH pumping N2 and tag at 9865' ctmd. Continue pumping chasing all fluid is out of well and recover 180 bbls of water. Pressure up tubing to 2500 psi with Nitrogen.,Shut in swab. Laydown nozzle BHA, lubricator and set down injector. ND coil BOPs, flowcross and install tree cap. Coil RDMO. 9/29/2022 Yellow Jacket E-line arrive and hold TBT and approve PTW. MU perforating toolstring and lubricator. Stab onto well and test 250 psi low / 4000 psi high.,RIH with 2-7/8" x 7' , 6 spf, HSC perf gun. Send correlation data to RE/GEO and confirm on depth. Perforate UT 5A from 9703 - 9710'. Initial pressure = 2542 psi. 5, 10,15 min = 2540 psi. All shots fired. Gun is wet with mud in bull plug.,E-line RDMO 10/2/2022 Fox N2 arrive and hold TBT and approve PTW. MIRU equipment and cool down N2 unit. Pressure Test treating lines to 4500 psi,Start pumping N2 at 1000 scfm. Pressure tubing to 4000 psi and shut down.,Fox N2 RDMO. 10/5/2022 AK Eline on location. PJSM & open PTW. Rig up Eline. Pick up BHA #1. PT Lubricator to 250/4000 psi, pass. 3500 SITP.,RIH w/ 17' x 1.69" weight bar. 5'x2" weight bar, 1.69" GPT, 2.75" Junk basket w/ 3.75" gauge ring. Sit down @ tubing hanger. POOH.,RIH w/ 17' x 1.69" weight bar. 5'x2" weight bar, 1.69" GPT, 2.75" Junk basket. Make it through the tubing hanger. POOH.,RIH w/ 17' x 1.69" weight bar. 5'x2" weight bar, 1.69" GPT, 2.75" Junk basket w/ 3.75" gauge ring. Sit down at TRSSSV. POOH.,RIH w/ 17' x 1.69" weight bar. 5'x2" weight bar, & 1.69" GPT tool. Tag TD @ 9803'. Find fluid level @ 8490'. POOH, hang up in the TRSSSV, bleed off tubing pressure to 2700 psi (5000 psi on the control line), POOH clean.,RIH w/ GR/CCL & 3.5" CIBP. (13.7' CCL to mid element). RIH and tie into CBL 9/27/22. Set 3.5" CIBP @ 9678' (9664.3' CCL stop depth). Tag plug to confirm set. POOH.,Mix & load 17 gallons cement. RIH w/ 1.69" CCL & 40' x 3.5" dump bailer. Tag plug @ 9678' and pick up 50', dump 17 gallons of cement (26') on CIBP. TOC @ 9652'. RDMO Eline. 10/9/2022 Fox coil on location. Open PTW & PJSM. Spot and rig up coil equipment & crane. Spot return tank and tie in.,Perform BOPE test to 250/4000 per sundry (AOGCC witness waived by Jim Regg). BOP test passed. Secure well and location. LDFN. 10/10/2022 Fox coil w/ N2 pump on location. Open PTW & PJSM. Rig up on well and PT lubricator to 250/4000 psi, pass. PT Nitrogen lines to 250/4000 psi, pass.,115 psi on the well. RIH w/ yellowjacket MHA & 2.88" nozzle. Tag CIBP w/ cement @ 9667' CTM. POOH 15' and come online w/ N2 @ 1000 scf/min. Start seeing fluid @ 65,000 scf. POOH @ 130 fpm. Bump up taking 27 bbls of returns. Trap 600 psi on the well. RDMO Coil unit and N2 pump. 10/11/2022 Arrive location w/ AK Eline. Open PTW & PJSM. Rig up on well & pick up BHA #1. PT lubricator to 250/4000 psi per sundry. Pass.,Wellhead pressure = 605 psi. RIH w/ 12' x 1.69" weight bar, 1.69" GPT w/ CCL. Tag cement @ 9637'. Fluid level @ 9430'. POOH.,Wellhead pressure = 615 psi. RIH w/ 3.125" GR/CCL, 2.75" shock sub, 20' x 2 7/8" Geo Razors, 6spf, 15gm. (CCL to top shot 9') Send log to Geo, on depth.,Pull on depth and perforate LB 5A Upper 9091' - 9111' MD. POOH. All shots fired - gun dry 0min - 617psi 5 min = 619psi 10 min = 619 psi 15 min = 619psi OOH pressure = 618 psi.,M/U and RIH w/ 12' x 1.69" weight bar, 1.69" GPT w/ CCL. Fluid level @ 9365'. Gamma worked intermittently when we got to bottom. Pulled GPT log from 9150-8700' POOH.,Lay down the lubricator. Secure well and SDFN n (LAT/LONG): evation (RKB): API #: Well Name: Field: County/State: CLU 005RD2 Cannery Loop Hilcorp Energy Company Composite Report , Alaska Contractor AFE #: AFE $: Job Name:221-00096 CLU-05RD2 Completion Spud Date: 10/12/2022 PJSM and PTW SITP 1025psi,P/U Lubricator. RIH w/ 17' x 1.69" weight bar, 1.69" GPT w/ CCL. Fluid level @ 9224ft'. Log from 9,620'-8600'. Send log to town, cooling observed over the perforated interval. POOH,M/U and RIH with Guns #2&3. w/ 3.125" GR/CCL, 2.75" shock sub, 9'&10' switch guns. 2 7/8" Geo Razors, 6spf, 15gm. Pull correlation log and send to town. On depth,Pull on depth and the shooting panel cannot connect to the gun switches. Troubleshoot with no luck POOH. Moisture in the teardrop connection preventing gun communication.,Lay down the lubricator. Secure well and SDFN. 10/13/2022 PJSM and PTW SITP - 1964 psi,PU lubricator and MU GPT tools - 7' weight bar, roller bogie, 10' weight bar, roller bogie, 1-11/16" GPT tool - OAL - 29'. RIH. Fluid level at 9120'. GPT tools appear to be erratic when in fluid. POOH. Send to town. Make 2' correction per Geo. Make 9086' equal 9088'. Resend log.,Arm and RIH with 9' and 10' 2-7/8" 6 spf HSC guns. Verified switches on surface and at 200'. Switches failed to communicate when toolstring was at 8000'. Tested and failed to communicate at 7000' and 6000'. Started to communicate normally at 5000'. Run back in hole. Tool communicating normally. Pull correlation pass from 9100'- 8550', send to town, make 1' shift per Geo.,Perforate the LB 5 Lower from 9078'-9087'. Pressure - 2175 psi, 2177 psi, 2179 psi, 2181 psi. Perforate the LB 4D Lower from 9020'-9030'. Pressure - 2188 psi, 2190 psi, 2192 psi, 2194 psi. POOH. All shots fired. Gun was dry.,MU GPT logging tools. Bleed down WHP from 2197 psi to 800 psi. Well is flowing at 300 mcf at 830 psi. Found fluid level at 9070', this is 60 below the top open perf. POOH. Install night cap. Lay down lubricator. SDFN. 10/14/2022 PJSM and PTW Start equipment. MU tool-string. SITP 745 psi.,Arm and RIH with 6' and 17' 2-7/8" HSC guns on a switch. Pull correlation log, send to town, on depth. Attempt to perforate the LB 4D Mid. Switch communicated like normal but would not transmit any current and would not fire. After discussing with town, decided to shoot upper gun. Perforate the LB 4C Lower from 8955'-8972'. POOH. Pressure data: 860 psi - no change after 15 min. All shots of upper gun fired, gun was damp.,Lower 6' gun did not fire. MU same 6' gun. Arm and RIH. Pull correlation log, send to town, on depth. Attempt to perforate the LB 4D Mid from 9006'- 9012'. No indication of fire. POOH. Gun did not fire. Tool was broken down at surface and wires had pulled out of the detonator. Brought well online at 1130. Flowing at 175 mcf and 900 psi.,Gun was re-wired. Arm and RIH 6' gun. Pull correlation log, send to town, on depth. Perforate the LB 4D Mid from 9006'-9012'. POOH. All shots fired. Gun was dry. Well was flowing at 308 mcf and 857 psi, no change after shooting.,Arm and RIH with 20' 2-7/8" HSC gun. Pull correlation log, send to town, on depth. Perforate the LB 4C Upper from 8919'-8939'. POOH. Well is flowing at 175 mcf and 812 psi, no change after shooting. All shots fired, gun was dry.,MU and RIH with GPT tools. Log with well flowing at 265 mcf and 720 psi FTP. Fluid level at 8652'. Cooling across perf intervals. Send log to town. POOH. Lay down toolstring and lubricator. Install night cap. SDFN. 10/17/2022 AK EL arrive on location. PTW and PJSM. Pick up lubricator. MU and run GPT tools. Fluid level detected at 7650', well is flowing at 215 mcf and 575 psi, top open perf is 8919'-8939'. POOH. GPT log sent to Geo/Engineer.,MU 12' and 8' 2-3/4" HSC guns. Arm and RIH. Pull correlation log, send to town, on depth. Perforate the LB 4A from 8844'-8856'. Wait 15 min. Pressure data: initial - 182 psi, 5 min - 178 psi, 10 min - 174 psi, 15 min - 170 psi. Perforate the LB 4 Lower from 8806'-8814'. Pressure data: initial - 168 psi, 5 min - 165 psi, 10 min - 163 psi, 15 min - 159 psi. POOH. All shots fired.,MU 18' 2-3/4" HSC gun. Arm and RIH. Pull correlation log, send to town, on depth. Perforate the LB 4 Upper from 8765'-8783'. POOH. All shots fired. Pressure data - 75 psi and 115 mcf - no change after 15 min.,MU 7' and 12' 2-3/4" HSC gun with a switch. Arm and RIH. Pull correlation log, send to town, on depth. Perforate the LB 3C Lower from 8740'-8747'. Pressure data - 115 mcf and 73 psi - no change after 15 min. Perforate the LB 3C Upper from 8718'-8730'. Pressure data - 115 mcf and 73 psi - no change after 15 min. POOH. All shots fired. Pop off well and drop soap sticks, install night cap, and cycle swab. SDFN. 10/18/2022 PTW and PJSM PU lubricator and make up GPT tools. RIH and log across production zones. Find fluid level at 6980'. Sent log to Eng/Geo. Install night cap and SDFN. EL unit off location, but left crane and other equipment on location.,Fox Energy nitrogen on location. PTW and PJSM. Rig up to tree wing test lines to 4500 psi, (good), open well Begin pressuring up on well to 4500 psi with nitrogen, at 1000 to 1200 scfm pumped total of 237.800 SCF PRESSURE 4472 at flow line gauge, out of nitrogen, shut well in pressure bleed from 4472 psi to 4200 psi in 30 minutes secure well and equipment for night monitor pressure 10/19/2022 Waiting on Nitrogen transport,Cooling down Nitrogen unit.,Pressure test lines to 4,500 psi, open well, SITP at 3,011 psi, Pressure up from 3,011 psi to 4,500 psi with 81,850 SCF, pumping at 1,200 SCFM,,Monitor well pressure for 1 hour pressure bleed from 4,500 psi to 3,975 psi,Pressure up with nitrogen f/ 3,975 to 4,500 psi with 34,519 SCF at 1,200 scfm,Pressure bleed f/ 4,500 psi to 4,030 psi,Pressure up with nitrogen f/ 4,030 psi to 4,500 with 29,087 SCF at 1,200 SCFM,Monitor pressure, pressure bleed 4,500 psi to 4,350 psi, pressure up with nitrogen f/ 4,350 to 4,500 with 11,500 SCF shut well in for night. 10/20/2022 IFO held PISM Fox Nitrogen pressured up on well to 4500 psi with 80,117 SCF pumping at 1200 scfm,AK Eline Pick up GPT, stab on, pressure test lubricator to 4132 RIH with GPT to 9166 ft. log up to 8100 ft, send log into town for verification found fluid level at 9064 ft. POOH lay down tool,Make up 3.71 Legacy Big Boy bridge plug, rated for 10,000 psi at 325* lot # 959C2, to 8722 ELM log correlation pass f/ 8722 ft ELM to 8400 ft ELM, send log for verification (on depth) set CIBP at 8710 ELM, pick up 20 ft. RIH tagging CIBP at 8710 ft. pooh bleeding nit pressure on well from 3640 psi to 1000 psi,OOH continue bleeding Nitrogen pressure off to 1000 psi, while making up perf gun, RIH with 2-7/8 HC perf gun loaded with 10 ft of shots 6 shots per ft. 60* phasing, RIH run correlation pass, send in for verification, spot gun on depth perforate the LB 3A lower sand from 8668 ft to 8678 ft, tbg pressure at 1056 psi, 5 minutes 1070 psi, 15 minutes 1078 psi, 15 minutes 1085 psi pooh lay down guns,,all shots fired, Gun dry, gun debris in bull plug, turn well over to production 10/21/2022 Get permits, and warm up equipment,Make up 5' x 2" wt. bar, 18" roller bogie (3.60 od), 7' x 1-11/16 wt. bar, 18" roller Boggie (3.60 od), 7' GPT , ccl, rope socket, Rih tagged CIBP AT 8710' elm, RUN PASS with GPT to 8200' ELM, send log in for verification, no fluid, across perforations at 8668 to 8678. bleed tbg pressure from 500 psi to 200 psi, monitor well flowing at 200 psi at 125k rate, run second pass from 8710 ft. to 8200 ft, no fluid,across prefs at 8668' to 8678 ' monitor well 1 hour, run third pass with GPT, from 8710 to 8200 ', sent log in for verification, no fluid across perforations at 8668 to 8678', received orders to pooh and rig down for the weekend.,Pooh with GPT lay out same, rig down E-line. turn well over to production 10/24/2022 AK Eline arrive on location. Open PTW & PJSM. Pick up BHA #1 and stab on the well. Open up to wellhead pressure 1937 psi.,SITP = 1937. RIH w/ 5' x 1.69" WB, 1.9'x 3.60" Roller Bogie, 7' x 1.69" WB, 1.9' x 3.60" Roller Bogie, 7.5" x 1.69" GPT w/ CCL (CCL to GPT = 7'). Tag plug @ 8710'. Find FL @ 7575'. Sit w/ GPT tool mid perf (8673') and record pressure/temperature for 15 minutes. Starting, SITP = 1951, BHP = 2766, Temp = 130.85. Ending, SITP = 1950, BHP = 2761, Temp = 130.68. POOH.,Rig down AK Eline and secure well. 10/25/2022 Rig up Fox N2 unit to the companion valve. PT lines to 250/4500 psi. Pass,SITP = 2265 psi. Come online w/ N2 @ 1200 scf/min. Build wellhead pressure to 4423 psi w/ 163,777 scf of N2. Did not see breakover. Last 50 psi pressure build up slowed. SI N2. Master valve left open to monitor flowline pressure. Swab valve shut. RDMO N2 unit. 10/27/2022 AK EL arrive on location. PTW and PJSM. Warm up equipment and snow removal. WHP is 4086 psi. PU GPT toolstring. RIH. No fluid above 8550'. POOH. Lay down GPT.,MU 20' 2-7/8" HSC gun. Arm and RIH. Pull correlation log, send to town, on depth. Bleed off WHP from 2700 psi down to 500 psi. Well would not maintain a flow rate above 500 psi, shut in choke. Perforate the LB 2B from 8328'-8348'. Crack choke, well is flowing at 175 mcf and 487 psi FTP. POOH. All shots fired. Gun was dry,,MU 12' 2-7/8" HSC gun, Arm and RIH. Pull correlation log, send to town, on depth. Perforate the LB 1F Lower from 8128'-8140'. POOH. WHP 350 psi and 160 mcf. Rate stayed steady at 160 mcf and FTP dropped to 342 psi after 15 min. Lay down guns, all shots fired. Gun was dry.,MU 25' 2-3/4" HSC gun, Arm and RIH. Pull correlation log, send to town, on depth. Perforate the LB 1F Mid from 8094'-8119'. POOH. Pressure data - initial 395 psi, 5 min - 402 psi, 10 min - 407 psi, 15 min - 412 psi. Flow rate stayed steady at 182 mcf. Lay down guns, all shots fired. Gun was dry.,MU 6' 2-7/8" HSC gun, Arm and RIH. Pull correlation log, send to town, on depth. Perforate the LB 1F Upper from 8076'-8082'. POOH. Pressure data - initial 175 psi, 5 min - 178 psi, 10 min - 181 psi, 15 min - 185 psi. Flow rate increased from 281 to 290 mcf over 15 min. Lay down guns, all shots fired. Gun was dry. Secure tree. Lay down lubricator. SDFN. 10/28/2022 AK E line crew arrive on location. PTW, JSA. FIre equipment. PIck up lubricator. Make up GPT tool. Well currently fowing 225 psi @ 518 MCFD. Stab on well. PT lubricator 250/4000 psi. RIH with GPT tool looking for fluid level. No defined level seen. Looks like comingled gas and fluid below 8128'. POOH to surface.,Make up 5'x 2 7/8" perf gun. RIH. Pull correlation log. Send log to town. On Depth. Perforate LB 1B sands from 7969"-7974' with Geo Dynamics 5'x 2 7/8" gun loaded 6 spf 0* phasing 15g RZR charges. Slight increase in pressure and rate. POOH to surface. Gun damp. All shots fired. Well flowing 219 psi @ 527 MCFD>,Make up 6' gun . RIH Log correlation. Sent to town. On depth. Perforate the LB 1B lower from 7952'-7958' with 6' x 2 7/8" gun loaded with 6 spf, 0* Phasing with 15g RZR charges. POOH to surface. Confirmed all shots fired. Gun damp,Make up GPT . RIH . Log OOH from 8430. No sign if definite fluid level. POOH to surface. Send GPT log to town. Rig down AK E-line. Continue flowing well. 11/1/2022 Travel from AK-E-Line shop to KGF office.,PJSM and permit.,Travel to Cannery Loop.,Spot equipment and rig up e-line. Prep Gun 19. Stab on well.,Pressure test surface equipment to 4000 PSI. Test good.,Run in hole w/ Gun 19 2-7/8" OD x 5' carrier gun to shoot LB 3A Upper sands at 8643' to 8648'.,Tie in LB 3A Upper sands at 8643' to 8648' - Tagged fill at 8677.6. Plug is set at 8710'.,Sent tie in log to town for approval.,Advised to make 2' correction. Correction made. Spot Gun 19 (2-7/8" x 5') for LB 3A Upper sands at 8643' to 8648' (CCL to to top shot 11.2' - CCL on depth at 8631.8). Fired gun. Good weight drop. Start pressure and 5 minute readings for 15 minutes unchanged at 82 PSI. POOH.,OOH. Lay down Gun 19. Pick up Gun 20.,Run in hole w/ Gun 20 2-7/8" OD x 9' carrier gun to shoot LB 3 Upper sands at 8597' to 8606'.,Tie in LB 3 Upper sands at 8597' to 8606',Sent tie in log to town for approval.,Spot Gun 20 (2-7/8" x 9') for LB 3 Upper sands at 8597' to 8606' (CCL to to top shot 10.4' - CCL on depth at 8586.6). Fired gun. Good weight drop. POOH. 5 Minute readings: Start 85/5 min 83/10 min 82/15 min78.,OOH. Lay down Gun 20. Pick up Gun 21.,Run in hole w/ Gun 21 2-7/8" OD x 17' carrier gun to shoot LB 2E Lower sands at 8576' to 8593'.,Tie in LB 2E Lower sands at 8576' to 8593',Sent tie in log to town for approval.,Spot Gun 21 (2-7/8" x 17') for LB 2E Lower sands at 8576' to 8593' (CCL to to top shot 11.3' - CCL on depth at 8564.7). Fired gun. Good weight drop. POOH. 5 Minute readings: Start 80/5 min 82/10 min 82/15 min 82,OOH. Lay down Gun 21. Pick up Gun 22.,Run in hole w/ Gun 22 2-7/8" OD x 14' carrier gun to shoot LB 2D Upper sands at 8438' to 8452'.,Tie in LB 2D Upper sands at 8438' to 8452',Advised to make 2' correction. Correction made. Spot Gun 22 (2-7/8" x 14') for LB 2D Upper sands at 8438' to 8452' (CCL to to top shot 11.3' - CCL on depth at 8426.7). Fired gun. Good weight drop. POOH. 5 Minute readings: Start 80/5 min 82/10 min 79/15 min 82,OOH. Lay down Gun 22. Lay down lubricator & secure well. SDFN. Will return tomorrow for more perforating runs.,Travel back to AK E-line shop. 11/7/2022 AK E-line arrive on location. Hold TBT and approve PTW. Start and warm up crane. Spot in E-line unit. MU wireline valves to tree. MU lubricator and pick up perf gun. Stab onto well and PT lubricator 250 psi low / 4000 psi high.,RIH with perf gun (2-7/8" x 10'). GR to top shot = 11.5. Well is flowing with pressure = 80 psi. Send correlation data to RE/GEO and add 1' to get on depth. Perf LB 2C Lower: 8414-8424'. All shots fired and bull plug on had a little water inside.,Laydown lubricator and secure well with night cap on wireline valves. SDFN. 11/8/2022 PJSM and PTW Well flowing ~932MCFD @ 79psi Warm up equipment,M/U gun gamma and 20ft gun, stab on well.,M/U and RIH w/ 20ft Geodynamic 2-7/8"OD gun, 15g, 6spf. (CCL to top shot 11.5ft) Pull correlation log and send to town. On depth,Pull on depth and shoot LB2C upper from 8,382-8,402ft. POOH, bull plug has a little water 0min - 82psi 5min - 81psi 10min - 77psi 15min - 72psi No change in flow rate,M/U and RIH w/ 17ft Geodynamic 2-7/8"OD gun, 15g, 6spf. (CCL to top shot 14.3ft) Pull correlation log and send to town. On depth,Pull on depth and shoot LB2 lower from 8,265-8,282ft. POOH, all shots fired, bull plug has a little water 0min - 81psi 5min - 81psi 10min - 81psi 15min - 79psi No change in flow rate,M/U and RIH w/ 18ft Geodynamic 2-7/8"OD gun, 15g, 6spf. (CCL to top shot 13.3ft) Pull correlation log and send to town. On depth,Pull on depth and shoot LB1G lower from 8,186-8,204ft. POOH, all shots fired, bull plug has a little water 0min - 85psi 5min - 85psi 10min - 82psi 15min - 82psi No change in flow rate,Gun Run #27 Gun Misfired, re-logged perf interval to see if perforations were visible on CCL. No perforations were seen, held a safety meeting to discuss the risks of bringing a misfired gun to the surface. Pulled the shooting panel key and completely powered down the E-line computers at 200ft from surface. Disarmed gun per procedure. Detonator resistors blew but did not set off the detonator. Replaced detonator,Re-run 15ft Geodynamic 2-3/4"OD gun, 15g, 6spf. (CCL to top shot 13.3ft) Pull correlation log . On depth,Pull on depth and shoot LB1G upper from 8,162-8,177ft. POOH, all shots fired, bull plug has a little water 0min - 83psi 5min - 80psi 10min -85 psi 15min - 81psi No noticeable change in flow rate,M/U and RIH w/ 9ft Geodynamic 2-7/8"OD gun, 15g, 6spf. (CCL to top shot 12.4ft) Pull correlation log and send to town. On depth,Pull on depth and shoot LB1C upper from 7,984-7,993ft. POOH, all shots fired, bull plug has a little water 11/17/2022 PJSM and PTW Well flowing ~961MCFD @ 77psi,Spot equipment. R/U AK E-line. M/U 18ft & 6ft switch guns. Stab lubricator on the well. Pressure test lubricator with MeOH/water blend to 250psi/4000psi - Test good,Open well and RIH w/ 6FT Geodynamics 2-3/4"OD 15g, 6spf (CCL to top shot 28.3ft) & 18FT Geodynamics 2-3/4"OD 15g, 6spf (CCL to top shot 9.2ft). Switch guns Pull the correlation log and send it to town. On depth.,Pull on depth and shoot LB1 from 7,921-7,927ft. FTP 0min - 79psi no change in 15min,Pull on depth and shoot LB from 7,880-7,898ft. POOH, all shots fired, bull plug has a little water FTP 0min - 79psi, no change in 15min,Secure well and hand over to production RDMO AK E-line Rate slowly increasing Final well conditions 1.3MMCFD @ 88psi           !"!#!  #$%&  #'  '(()*) % +,  , - &  , ./  , ,          ! 0, 0 ,  "#  "#!$   12&,%& &     '()#"  3, "#!$,*+!,- *  1  ,  '()#"  4 2  , . "# ,  1 , 5 , % + 16,  ,  /$0123   4 * /$01* +*+*4    5"6 %    7.!  77    0 0% 3 &,  &, 73, 4 23,  879-0 849- %#    5  &,  "#   """ """ $ ()) 8$"0# $0$ 8/#() $"#"02&7, "#" 8"9(:##)6"* #9#:6(60. 0   :;< =&  32 :.<  3 :;<  "#!$ 1&413 ;<<%$"$$ /=6=$"$$ 6#( 0(6# ## 8()#/$)/ %2,/ ,  &4, 3 "#!$ " ,  /  , 2= :./< : < 849- : <   :;< 879-0 : < .>2,8 8("/( #("""""""")"" =  : <  % 3   .4  :0 < . : < /=8=$"$$    (>%. ""%?=6@;<<% /)6" $ /#(6";  7A *,2B%.1 "="#=//8 (>%. ""%?=6@;<<% $ /#(6" 8 66"6";  7A *,2B%.1 "="#=//8 (>%.> C ""$%?@  C& A8 #$0"" 8 8("/( 1 "#!4 "=#=$"# (>%.-D!-%- 7 ""%?@D!E& F      - 78 888"" / /""86 %.-D!-%- 7141 "/="8=$"$$ 1 : < " :;< ? :;< 879-0 : < 849- : <  ./ : < ./ : < 1 4 23 :< 1 73 :< /   :<  :;9@<  .4 )"" """ """ )"" """ """F$"#" $ ()) 8$"0# $0$ 8/#() """ """ *2D*2 /)6" ")8 ()#6 /)(/ "8 ")6#/)/ $ ()) 8$0/ $0$ 8/8$6 "6) ( (>%.14 ()$6" $" ##6" ()$(8 ($( ($/(6()8 $ ()) 8$(/ $0$ 8/)0( "$# 6#0 (>%.14 6666" $" 6)$" 666(6 6(8 6806"#)6 $ ()) 8$#" $0$ 0""( 6/ 8(# (>%.14 #"86" $)" 6))" #"8$) 8 8886800) $ ()) 8$80( $0$ 0"$# ( /"" (>%.14 #8)6" 6" #"/" #8)0 )# /#$#$/80 $ ()) 8$/"0 $0$ 0"#"8 $ $0$ (>%.14 88"6" #)" #"6" 8#/)$ (## #8#8$($ $ ()) 8((// $0$ 0$/ )# $"8# (>%.14 0#(6" 0/" ##(" 0#$# $") $6#(0(8# $ ()) 86"6# $0$ 0$"$/ $(6 (0( (>%.14 )686" //" #)8" )66"( $0// (88)"##( $ ()) 86)"$ $0$ 0($# $$$ 68") (>%.14 /()6" (" #)$" /(668 (8)8 #"$)/#/8 $ ()) 8#88 $0$ 060"/ #$ 8$/( (>%.14  "(6" (/" ##/"  "$#$ 60/$ 8)"$/)80 $ ()) 880(# $0$ 086(" $)# )(8 (>%.14      % +,  , - &  , ./  , ,          ! 0, 0 ,  "#  "#!$   12&,%& &     '()#"  3, "#!$,*+!,- *  1  ,  '()#"  4 2  , . "# ,  1 : < " :;< ? :;< 879-0 : < 849- : <  ./ : < ./ : < 1 4 23 :< 1 73 :< /   :<  :;9@<  .4  $66" #0" #66"  #$ 8# )0#" "088$ $ ()) 8)"#8 $0$ 0)6"6 /) "8/" (>%.14  $06" 0/" #()"  $"6# 00$) "/$0 8#8# $ ()) 8/#/ $0$ )"8" $(0 ((00 (>%.14  $0/6" )/" #6"  $8$/) ))0/ $#"/ $$66) $ ()) 0"0$ $0$ )$$6 8$ #((6 (>%.14  (0$6" $#" #66"  (#"$# "0## ## (0# $ ()) 0$#(0 $0$ )6)#8 $)" )#66 (>%.14  68#6" $6" #6"  6(#/0 $)8 )"(/ (/060 $ ()) 06#)0 $0$ )0)$" $)" $$60 (>%.14  ##06" $#$" #6"  #/#/ # $6) 6)"/ $ ()) 08008 $0$ /"/0" $" $#/)( (>%.14  86)6" $0)" #6$"  8""$ 06)) $66(/ #8$#$ $ ()) 0/"/" $0$ /6("8 $)8 (""6$ (>%.14  06"6" (" #60"  8)$ $"0 $)/ 86$8$ $ ()) )86) $0$ /)"(8 (8" (6#8( (>%.14  )((6" ((6" #(/"  0#/00 $("6 ($6) 0$$0 $ ()) )6680 $0( "$$" $#$ (/#$6 (>%.14  /$86" (#6" #60"  )(8#" $8"0/ (86# 0/)"" $ ()) )066/ $0( "866# $$" 66000 (>%.14 $ "/6" ()6" ##""  /")8 $/$/( 6"/)" )0$(8 $ ()) /"#0# $0( "0 ($( #"(#0 (>%.14 $ 6" 6"(" #6""  /)$"" ($8) 6#0$) /6(#" $ ()) /()0 $0( #))( $) #8)) (>%.14 $ $"66" 6$" #(0" $ "#/) (8$/6 #"806$ "(6) $ ()) /0()/ $0( $")/0 /# 8$(( (>%.14 $ $/06" 6#8" #(/" $ /"( 6""// ##)0($ ")"#( $ ()/ ""/( $0( $880 (00 8)0#6 (>%.14 $ ()/6" 680" #(#" $ )$00 66"$0 8$$"$ 66$0 $ ()/ "6/0 $0( (#)) $6 0#()) (>%.14 $ 6)$6" 6)6" ##"" $ $6##6 6)"(6 880)/$ $"0"6 $ ()/ "))0 $0( (0$(( $) )$$6) (>%.14 $ #066" 6)6 ##6" $ ("88 #/8 0$6(/$ $8) $ ()/ $8(# $0( 6$/#0 "(( )/$( (>%.14 $ 88)6" 6)$" ##8" $ (8/6 ##/(0 0)$$($ (("86 $ ()/ 86// $0( 6))8 "$0 /8(# (>%.14 $ 08"6" 6)(" #6/" $ 6("6" #/)6/ )()8($ (//" $ ()/ $"("$ $0( #6#$/ "#)  "$//6 (>%.14 $ )#(6" 60)" ###" $ 6/$#0 8(0/8 )/#6$$ 6#6"0 $ ()/ $6(/ $0( 8"$)( "0$  "//"# (>%.14 $ /$(6" 6)(" ##(" $ #(/(8 880#( /()$)$ #"")8 $ ()/ $0"( $0( 868$6 "0#  #"0 (>%.14 ( "66" 68(0 ##)) $ 8/(( 08#8  ""/)#$ #)")( $ ()/ (00) $0( 0)0# 8)  $(006 (>%.1$4 ( ($6" 6)8 #8$) $ 8)") 0#()8  "8#($$ 86$#) $ ()/ (#6"" $0( 006/ //  ("66) (>%.1$4 ( $$#6" 6)6 #8/( $ 06$/8 0/$"0  $($)$ 0"668 $ ()/ (/"/ $0( )((#/ "#/  (0(00 (>%.1$4 ( (/6" 6))( ##"# $ )"# )(#$  )06$ 0888 $ ()/ 6$/6 $0( )/$0/ #0  666$" (>%.1$4 ( 66" 6)/$ #68 $ )8#8 )066  $()(/$ )$0 $ ()/ 68)$6 $0( /#"$" "(0  #(68 (>%.1$4 ( #"(6" 6)0( #6)) $ /$8) /6  $/6/($ ))08) $ ()/ #"0 $06 ""0#" "("  #)$8) (>%.1$4 ( #/06" 6)0) ##"$ $ /))8 /#$""  (#$0/$ /6/88 $ ()/ #68#/ $06 "88$ "$  8#(($ (>%.1$4 ( 8))6" 6)0# #6)/ ( "6)6 //$/  6"))$( ""/86 $ ()/ #)6)" $06 $$)/ "  0$0 (>%.1$4 ( 0)6" 6)8( #6#" ( "/#(  "(80  68#)(( "0"( $ ()/ 8$6"0 $06 )"88 "(6  0/#6 (>%.1$4 ( )066" 6)0 #60( ( 0"/#  "0$"  #$$00( ($6# $ ()/ 88(6 $06 $()(8 "$"  )8(6 (>%.1$4 ( /8#6" 6)8$ #68) ( $("#  #)  #0)#(( /$## $ ()/ 0") $06 $/6)0 "  /$/86 (>%.1$4 6 "#/6" 6)#8 #6#0 ( $/($(  #$6"  8(8"$( $#60( $ ()/ 06# $06 (#(( " $ """ (>%.1$4 6 $6" 6)#6 #68# ( ((6$0  0/(  80(/"( $/#00 $ ()/ 0808/ $06 (/#$ "" $ "68#0 (>%.1$4 6 $66" 60(" #60$ ( (/8#/  $/$  0("$(( (#)"/ $ ()/ )"8#" $06 66)#/ (( $ ##8 (>%.1$4 6 ("06" 68" #(6" ( 68"(0  $#)/(  0)#"$( 6$)0 $ ()/ )6#8 $06 #"66 8# $ )($( (>%.1$4 6 6"(6" 6688 #((# ( #$0)"  $//8/  )(/)8( 6)/(" $ ()/ ))6)8 $06 ##/0# #" $ $### (>%.1$4 6 6/(6" 6(6" #$)" ( #/$#  ((0$0  ))/)0( ##6" $ ()/ /$60 $06 8"60 68 $ (6 (>%.1$4 6 #)86" 6$$" #$0" ( 88"06  (0##  /6"0( 8$$$6 $ ()/ /#)06 $06 886/ $/ $ (00$/ (>%.1$4 6 8)"6" 6" #/" ( 0("/)  6(0  /)/8"( 8/$6) $ ()/ //#/) $06 086 (" $ 6(/08 (>%.1$4      % +,  , - &  , ./  , ,          ! 0, 0 ,  "#  "#!$   12&,%& &     '()#"  3, "#!$,*+!,- *  1  ,  '()#"  4 2  , . "# ,  1 : < " :;< ? :;< 879-0 : < 849- : <  ./ : < ./ : < 1 4 23 :< 1 73 :< /   :<  :;9@<  .4 6 00(6" (/)$ #$"8 ( )"06  6#")) $ "(06( 08($6 $ (/" "($$6 $06 0#/)) () $ #"""/ (>%.1$4 6 )8#6" ()#6 #$8( ( )0("#  6)8(/ $ ")(#( )(6## $ (/" "88)# $06 )"8#8 6# $ ##)$ (>%.1$4 6 /##6" (00( #$( ( /6()6  #$"($ $ $00( /"#(6 $ (/" "///( $06 )#$$ "/8 $ 8(0) (>%.1$4 # "#6" (8$" #$$) 6 "$"##  ###8/ $ 0$0/( /)$"# $ (/" (66$ $06 )/0# 8" $ 80#" (>%.1$4 # 6(6" (#$/ #$/ 6 "/#$$  #))/( $ $#"6 "#80$ $ (/" 88)6 $06 /6"(8 0 $ 0$#$( (>%.1$4 # $(86" ((/" #($ 6 000  8$/# $ $#8$$6 (($0 $ (/" //"8 $06 /)$$" 6/ $ 00)" (>%.1$4 # ($)6" (/0 #/) 6 $6)/)  8#$/) $ $/#666 $"6) $ (/" $$/(6 $0# "$$"" $( $ )$)" (>%.1$4 # 6/6" $/00 #$6$ 6 ($0")  8)8" $ (($((6 $))#) $ (/" $#0$6 $0# "#/6( $6( $ )060" (>%.1$4 # #(6" $)($ #(( 6 6"/$8  0"/$$ $ (8)886 (0"08 $ (/" $)6# $0# "/8$/ #/ $ /$"(( (>%.1$4 # 8"66" $8/" #(80 6 6)//"  0(6(8 $ 6"$#$6 6#6" $ (/" (")8# $0# ("8$ #) $ /8$#" (>%.1$4 # 8/86" $#0$ #(#/ 6 #0$(8  0#)#6 $ 6(#(#6 #(()8 $ (/" (($/ $0# 8(/ $) ( ""($) (>%.1$4 # 0))6" $6" #6)# 6 8##)(  0)0 $ 6880$6 80(( $ (/" (#6$ $0# /#0 /# ( "6/# (>%.1$4 # ))6" $("# #()( 6 06"  )"$) $ 6/8)/6 0"$8" $ (/" (0#$0 $0# $$8$) $ ( "0/"0 (>%.1$4 # /0#6" $6/ #(#$ 6 )$)"/  )$(/ $ #$##/6 0)/#/ $ (/" (/#) $0# $##() 88 ( 68/ (>%.1$4 8 "806" $""8 #)/ 6 /6"  )6(80 $ ###86 )0#8" $ (/" 6#"8 $0# $)0$ 8) ( 60( (>%.1$4 8 8$6" )0$ #)" # ""(0  )8(# $ #08(86 /8#$ $ (/" 6(6"0 $0# ("8)/ 6 ( 0))# (>%.1$4 8 $#66" 8)/ #"06 # "/("  ))"06 $ #/)(# "#$)" $ (/" 6#$( $0# ($/0 $"$ ( $"8/8 (>%.1$4 8 (6)6" #6" #(80 # )#/  )/80) $ 8)/6# 6("/ $ (/" 688)0 $0# (#" ) ( $(("/ (>%.1$4 8 66"6" (/8 ##$/ # $0"#/  /"(( $ 8(0/# $($"/ $ (/" 6)""8 $0# (8/(( 8( ( $#8(/ (>%.1$4 8 #$0"" $)/ ##(8 # (#6)$  /$00 $ 8#666# (8($ $ (/" 6/) $0# ()8") $6 ( $086) (>%.> C1(4 8 #8/$$ #"$ #6$ # (/#0/  /$088 $ 88$0## (#0$/ $ (/" 6/8/" $0# (/6#" #"/ ( $)888 (>%.> C1(4 8 8("/( ) #$06 # 6#6/6  /()# $ 808)0# 6866 $ (/" #"0( $0# 6")) #"# ( ("6$# (>%.> C1(4 8 888"" /8) #$06 # 6))  /6#"( $ 8)#/# 66/8 $ (/" #()( $0# 60/) 66) ( (#8 (>%.-D!-%- 7164 8 8)08 $") #(/) # #"0/#  /6/6$ $ 8/)$# 68/6# $ (/" #) $0# 6$(/) 8/$ ( ($$/0 (>%.-D!-%- 7164 8 06)66 $()$ #06 # #86#)  /8$8$ $ 0(# #$8") $ (/" #("/( $0# 66(#6 6)) ( (68(6 (>%.-D!-%- 7164 8 )"(/ $8) #/)# # 8$"0(  /08$0 $ 0((68# #)$$( $ (/" #66# $0# 688$ 6$( ( (0$(/ (>%.-D!-%- 7164 8 )0) $8/( 8$$( # 80#80  /)/#8 $ 0#06)# 8(00 $ (/" ##8/) $0# 6/"6" $$ ( (//#0 (>%.-D!-%- 7164 8 /((8( $)"/ 866) # 0("#" $ ""$(# $ 0)("# 8/$"" $ (/" #8/$) $0# #88 $#$ ( 6$08# (>%.-D!-%- 7164 8 //00 $/6$ 888( # 0)8$" $ "6// $ )")(# 0600" $ (/" #)() $0# #66$$ $8# ( 6#06) (>%.-D!-%- 7164 0 "$)# $/0 808( # )(# $ "$"/( $ )$6/$# 0068# $ (/" #)0"# $0# ##)6$ )# ( 60$( (>%.-D!-%- 7164 0 "#)#0 ("$0 806" # )(/#" $ "$80# $ )()/0# )""" $ (/" #/$#/ $0# #0$#0 )) ( 6)0"( (>%.-D!-%- 7164 0 (("8 ("$) 866$ # /"()( $ "6$"0 $ )0($6# )8#(( $ (/" 8"0$# $0# 8"0( $"$ ( #$(8$ (>%.-D!-%- 7164 0 /6(" $/#/ 8"/ # /#8/ $ "#8$# $ /""$/# /)6 $ (/" 8$"/$ $0# 8(66# (8( ( ##(08 (>%.-D!-%- 7164 0 $##/# $)6/ ##/$ 8 "") $ "0$"8 $ /$#8)# /0$( $ (/" 8(8$( $0# 88"( () ( #)(## (>%.-D!-%- 7164 0 (00# $0)$ #80 8 "8#(" $ ")/$0 $ /6/$"8 "$8)" $ (/" 8#$/) $0# 8)(/) (6$ ( 8$8/ (>%.-D!-%- 7164 0 (0/"/ $806 #"") 8 /)$ $ "0"" $ /0"8 ")($ $ (/" 80"(" $0# 0"8( $$ ( 86"0) (>%.-D!-%- 7164 0 66$" $06 6/) 8 0#/ $ $#$( $ //$6#8 (88/ $ (/" 8)) $0# 0$0/ "/$ ( 88))0 (>%.-D!-%- 7164 0 #"$## $)" 6)#( 8 $$/#0 $ 6(/ ( "()68 /"0 $ (/" 0"8() $0# 06/8# #" ( 8/0$" (>%.-D!-%- 7164 0 #86) $08# #"06 8 $)6"0 $ 8$## ( "(#0#8 $6##0 $ (/" 0$6#/ $0# 00/$ 00 ( 0$#/ (>%.-D!-%- 7164 0 8$8"" $)"# #"( 8 (()0( $ )"/ ( "#)"68 (""$( $ (/" 06$#$ $0# 0/6#8 "0$ ( 0#600 (>%.-D!-%- 7164      % +,  , - &  , ./  , ,          ! 0, 0 ,  "#  "#!$   12&,%& &     '()#"  3, "#!$,*+!,- *  1  ,  '()#"  4 2  , . "# ,  1 : < " :;< ? :;< 879-0 : < 849- : <  ./ : < ./ : < 1 4 23 :< 1 73 :< /   :<  :;9@<  .4 0 8))/8 $0( #$0( 8 (/66/ $ // ( ")"/(8 (##// $ (/" 08"$) $0# )00/ $6 ( 0)6"" (>%.-D!-%- 7164 0 0#"#6 $8(( #" 8 66/6# $ $8$6 ( "$)"8 6"/# $ (/" 008/) $0# )(//) // ( )00 (>%.-D!-%- 7164 0 )$"$ $8#8 #"(0 8 #"66/ $ $((#0 ( $6""8 68#// $ (/" 0/(/" $0# )8# "8# ( )(/( (>%.-D!-%- 7164 0 )0$0) $8)0 #""8 8 ##)00 $ $#"# ( 66//8 #$"$0 $ (/" )"/) $0# ))$)( "#8 ( )886 (>%.-D!-%- 7164 0 /(#/ $00 6/66 8 86(8 $ $8/(0 ( 888(8 #0#)8 $ (/" )$))) $0# /"6) "88 ( )/60$ (>%.-D!-%- 7164 0 //80( $0#8 6)#8 8 88/"$ $ $)0/( ( )0/08 8("#$ $ (/" )60"$ $0# /$8# "/ ( /$$/6 (>%.-D!-%- 7164 ) "#0)0 $0" 6)"( 8 0$((8 $ ("8#0 ( $")/"8 8)6)8 $ (/" )8#$8 $0# /600/ "/) ( /#")0 (>%.-D!-%- 7164 ) $6 $8)6 60" 8 00/00 $ ($#/" ( $(""68 06$0 $ (/" ))6) $0# /8/(" "0$ ( /0/(/ (>%.-D!-%- 7164 ) )$"6 $80 6/06 8 )(66 $ (66 ( $#"#88 0/#86 $ (/" /"// $0# //"8 /8 6 ""80( (>%.-D!-%- 7164 ) $6#/ $0(( #$) 8 )/"6" $ (8$(# ( $0$0"8 )#/" $ (/" //)" $08 "$8# 6) 6 "(#(/ (>%.-D!-%- 7164 ) ("06$ $808 #$86 8 /6#)$ $ (0/0/ ( $/6/)8 /"0($ $ (/" /(8) $08 "(#$8 (# 6 "8(8) (>%.-D!-%- 7164 ) (0"( $#6$ #(0$ 0 ""$/# $ (/8#8 ( (0(08 /866# $ (/" /#(6 $08 "#0/8 $$( 6 "/8# (>%.-D!-%- 7164 ) 6($$( $#" #( 0 "#)(" $ 6$$ ( (()(60 "/)" $ (/" /8)(" $08 "0/$( "80 6 000 (>%.-D!-%- 7164 ) 6/(0$ $#/ #$(/ 0 (/8 $ 6$0/( ( (#/60 "0#68 $ (/" /)(0 $08 ""($ "#$ 6 6(/" (>%.-D!-%- 7164 ) ##6/$ $#$) #8" 0 8/($ $ 666"" ( (0/0"0 (")$ $ (/" ///() $08 $) "#0 6 8//) (>%.-D!-%- 7164 ) 88(# $#8( #"0" 0 $$60/ $ 68"#8 ( 6""$80 )8$/ $ (/ "### $08 6$"8 ")# 6 /8(0 (>%.-D!-%- 7164 ) 80)"8 $#)# 6/8# 0 $)"(0 $ 6000( ( 6$")60 $6)0 $ (/ "($( $08 8$/8 ")$ 6 $$(6 (>%.-D!-%- 7164 ) 06"(( $8$) 6)# 0 ((8( $ 6/#8# ( 66#0 $/0) $ (/ "6/)( $08 )(/0 "8 6 $#"6( (>%.-D!-%- 7164 ) 0//6 $8/$ 60)6 0 ()/6 $ #($/ ( 68$$0 (#"86 $ (/ "80"/ $08 $"6"$ $" 6 $080/ (>%.-D!-%- 7164 ) )8$#$ $8/( 68$ 0 66#6 $ #($00 ( 6)$(0 6"8/ $ (/ ")80 $08 $$#(" 0 6 ("#$ (>%.-D!-%- 7164 ) /$#"6 $#/6 600$ 0 #"(/ $ ##00 ( #"$600 68$)/ $ (/ "600 $08 $6#// / 6 (($)/ (>%.-D!-%- 7164 ) /)8)" $#6# #/ 0 ##0"# $ #8/0 ( #$$)"0 #)## $ (/ $0) $08 $8888 $#8 6 (#/8" (>%.-D!-%- 7164 / "6)0" $6)$ #6"8 0 8("/ $ #)#( ( #6(8/0 #06#/ $ (/ (0(6 $08 $)0)6 $$$ 6 ()#)/ (>%.-D!-%- 7164 / "/" $#8 #()8 0 88/68 $ 8""#/ ( #86/60 8("/8 $ (/ #$(/ $08 ("/() "#8 6 6$8 (>%.-D!-%- 7164 / 0$#) $6)( ##$" 0 0$#(0 $ 8#0$ ( #)880 8)8)0 $ (/ 80" $08 ((")/ "8 6 6()$ (>%.-D!-%- 7164 / $(6( $6)/ ##(/ 0 0)() $ 8("6/ ( 8"06/0 06$)) $ (/ )60 $08 (#$#" "8 6 6866 (>%.-D!-%- 7164 / $/8($ $60" #6/0 0 )(080 $ 86#(6 ( 8$))60 0//0 $ (/ /#/" $08 (06( "6$ 6 6/"( (>%.-D!-%- 7164 / (#)$6 $6#$ #608 0 )/(/0 $ 88") ( 86//(0 )##60 $ (/ $"(( $08 (/##" "($ 6 ##/" (>%.-D!-%- 7164 / 6$""" $660 #6") 0 /#"0 $ 80#") ( 80"080 /80 $ (/ $$6)( $08 688 "68 6 #6#" (>%.-D!-%- 7164 / 6)"6$ $66 #6($ ) ""#0 $ 8)/0" ( 8/"(0 /8880 $ (/ $(/"8 $08 6(08 "/ 6 #886/ (>%.-D!-%- 7164 / #6"( $66( #66 ) "#/#6 $ 0"6( ( 0"8) "$"6 $ (/ $#(" $08 6#068 "( 6 #/0 (>%.-D!-%- 7164 / 8"6(" $68/ #66$ ) 0/ $ 0/0" ( 0($0) "0/6 $ (/ $8)$# $08 60/6 "66 6 80)6 (>%.-D!-%- 7164 / 886($ $668 #66( ) 0$6/ $ 0(6$( ( 0#("$) ((// $ (/ $)$() $08 6///) "() 6 86$0/ (>%.-D!-%- 7164 / 0$8)( $6(( #(6 ) $$/6$ $ 06/6( ( 00())) /"/$ $ (/ $/0) $08 #$6 "0 6 88)8" (>%.-D!-%- 7164 / 00/"( $666 #(## ) $08/8 $ 08$$8 ( 0/$") $()68 $ (/ ("/80 $08 #()0" "$6 6 8/"8 (>%.-D!-%- 7164 / )#( $6$) #$)) ) (6$86 $ 0)""8 ( )#"$) ("66 $ (/ ($0"$ $08 #8$)# "66 6 0/)/ (>%.-D!-%- 7164 / /""86 $6"( #$/0 ) ()0)$ $ 0/$$) ( )()) (6/($ $ (/ (()/$ $08 #0/$# "# 6 06"# (>%.-D!-%- 7164 / /6""" $6"( #$/0 ) 6$(00 $ )"/( ( )6(/)) ()#$0 $ (/ (6)(( $08 #/$$$ """ 6 0#8) !+G2,2,      % +,  , - &  , ./  , ,          ! 0, 0 ,  "#  "#!$   12&,%& &     '()#"  3, "#!$,*+!,- *  1  ,  '()#"  4 2  , . "# ,  ;@A ;@  @      Benjamin Hand Digitally signed by Benjamin Hand Date: 2022.09.16 11:47:07 -08'00'Chelsea Wright Digitally signed by Chelsea Wright Date: 2022.09.16 13:18:36 -08'00' TD Shoe Depth: PBTD: Jts. 1 2 3 87 Yes X No Yes X No Fluid Description: Liner hanger Info (Make/Model):Liner top Packer?:X Yes No Liner hanger test pressure:X Yes No Centralizer Placement: Preflush (Spacer) Type: Density (ppg) Volume pumped (BBLs) Lead Slurry Type:Sacks: Yield: Density (ppg) Volume pumped (BBLs) Mixing / Pumping Rate (bpm): Tail Slurry Type:Sacks: Yield: Density (ppg) Volume pumped (BBLs) Mixing / Pumping Rate (bpm): Post Flush (Spacer) Type: Density (ppg) Rate (bpm): Volume: Displacement: Type: Density (ppg) Rate (bpm): Volume (actual / calculated): FCP (psi): Pump used for disp: X Yes No Casing Rotated? Yes X No Reciprocated?X Yes No % Returns during job Cement returns to surface? Yes X No Spacer returns?X Yes No Vol to Surf: Cement In Place At: Date: Estimated TOC: Method Used To Determine TOC: Casing (Or Liner) Detail Shoe 5 Rotate Csg Recip Csg Ft. Min. PPG11.3 Shoe @ 9938 FC @ Top of Liner 6,2149,893.00 Floats Held 6% KCL Polymer Mud CASING RECORD County State Alaska Supv.Jay Murphy Hilcorp Energy Company CASING & CEMENTING REPORT Lease & Well No.CLU 005RD2 Date Run 19-Sep-22 Setting Depths Component Size Wt. Grade THD Make Length Bottom Top BTC Baker 1.42 9,938.00 9,936.58 Csg Wt. On Hook:55,000 Type Float Collar:Baker round nose No. Hrs to Run: 11.3 4 100 1040 FI R S T S T A G E 12Tune Primed 30 135.1/140.1 1600 0 Halliburton 15.3 39 Bump press CBL Bump Plug? 18:05 9/19/2022 6,700 9,938.009,940.00 CEMENTING REPORT Csg Wt. On Slips: 6%KCl/Polymer 12.5 90 Type of Shoe: Casing Crew: 7" x 9 5/8" SLZPX, HRDE w/7.37" PBR www.wellez.net WellEz Information Management LLC ver_04818br 4 Baker-Loc jt 4 1/2 12.6 L-80 BTC 41.41 9,936.58 Float Coller 5 BTC Baker 1.38 9,895.17 9,893.79 Baker-Loc jt 4 1/2 12.6 L-80 BTC 41.39 9,893.79 9,852.40 Landing Collar 5 BTC Baker 1.08 9,852.40 9,851.32 Baker-Loc jt 4 1/2 12.6 L-80 DWC 41.41 9,851.32 9,809.91 4 1/2" DWC casing 4 1/2 12.6 L-80 DWC 3,563.98 9,809.91 6,245.93 X/O's 7" 563 x 4 1/2" DWC 7 7.23 6,245.93 6,238.70 7" x 9 5/8" SLZXP/HRDE 8 5/8 Baker 24.48 6,238.70 6,214.22 l ll 250 2.02 l ll 185 1.18 4 Kyle Wiseman Hilcorp Alaska, LLC Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: Kyle.Wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 11/28/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTAL T#20221128-1 Well API #PTD #Log Date Log Company Log Type AOGCC Eset# CLU 13 50133206460000 214171 11/12/2022 Halliburton PERF CLU 05RD2 50133204740200 222092 11/11/2022 Halliburton PPROF KBU 22-06 50133205500000 205054 2/26/2022 Halliburton RMX KBU 22-06 50133205500000 205054 2/26/2022 Halliburton TMD3D KBU 33-06X 50133205290000 203183 2/28/2022 Halliburton RMX KBU 33-06X 50133205290000 203183 2/28/2022 Halliburton TMD3D KDU 4 50133201760000 169012 11/7/2022 Halliburton EPX KDU 4 50133201760000 169012 11/7/2022 Halliburton MFC24 KU 43-6RD 50133100910100 201231 11/8/2022 Halliburton EPX KU 43-6RD 50133100910100 201231 11/8/2022 Halliburton MFC24 Please include current contact information if different from above. By Meredith Guhl at 10:05 am, Nov 29, 2022 T37319 T37313 T37320 T37320 T37321 T37321 T37322 T37322 T37323 T37323 CLU 05RD2 50133204740200 222092 11/11/2022 Halliburton PPROF Meredith Guhl Digitally signed by Meredith Guhl Date: 2022.11.29 11:15:51 -09'00' Kyle Wiseman Hilcorp Alaska, LLC Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: Kyle.Wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 11/28/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTAL T#20221128 Well API #PTD #Log Date Log Company Log Type AOGCC Eset# SD-06 50133205820000 208160 9/12/2022 Yellowjacket PERF SRU 32A-33 50133101640100 191014 9/21/2022 Yellowjacket PERF KBU 42-06Y 50133206340000 214089 9/26/2022 Yellowjacket GPT-PERF CLU 05RD2 50133204740200 222092 9/29/2022 Yellowjacket PERF SCU 344-33 50133202930100 218054 10/8/2022 Yellowjacket PERF-GPT Please include current contact information if different from above. By Meredith Guhl at 9:48 am, Nov 29, 2022 T37313 T37314 T37315 T37316 T37317 CLU 05RD2 50133204740200 222092 9/29/2022 Yellowjacket PERF Meredith Guhl Digitally signed by Meredith Guhl Date: 2022.11.29 09:55:33 -09'00' Kyle Wiseman Hilcorp Alaska, LLC Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: Kyle.Wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 11/21/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTAL T#20221121 Well API #PTD #Log Date Log Company Log Type AOGCC Eset# CLU 05RD2 50133204740200 222092 10/18/2022 AK E-Line Perf_GPT MGS S MGS Unit 11 50733201040000 168032 10/11/2022 AK E-Line LDL SRU 241-33 50133206630000 217047 8/29/2022 AK E-Line TTBP_Perf SRU 32A-33 50133101640100 191014 9/23/2022 AK E-Line GPT SCU 344-33 50133202930100 218054 9/11/2022 AK E-Line Punch BCU 18RD 50133205840100 222033 9/10/2022 AK E-Line GPT BCU 18RD 50133205840100 222033 9/18/2022 AK E-Line Stim BRU 233-23 50283201360100 222050 11/1/2022 AK E-Line Perf BRU 233-23 50283201360100 222050 9/12/2022 AK E-Line CIBP Please include current contact information if different from above. T37280 T37281 T37282 T37283 T37284 T37285 T37285 T37286 T37286 By Meredith Guhl at 2:54 pm, Nov 21, 2022 CLU 05RD2 50133204740200 222092 10/18/2022 AK E-Line Perf_GPT Meredith Guhl Digitally signed by Meredith Guhl Date: 2022.11.21 14:55:38 -09'00' 1 Regg, James B (OGC) From:Ryan Thompson <Ryan.Thompson@hilcorp.com> Sent:Monday, October 10, 2022 7:22 PM To:Regg, James B (OGC); DOA AOGCC Prudhoe Bay; Brooks, Phoebe L (OGC) Subject:BOPE Test Report CLU 05RD2 Attachments:[EXTERNAL] Re: AOGCC Test Witness Notification Request: BOPE, CTU Fox Energy 8, CLU 05RD2; BOPE Test Report CLU 05RD2 10-9-2022.xlsx Please find the BOPE test report for CLU 05RD2.  Thank you,  Ryan Thompson  The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Cannery Loop Unit 5RD2 PTD 2220920 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:8 DATE:10/9/22 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2220920 Sundry #322-562 Operation:Drilling:Workover:X Explor.: Test:Initial:X Weekly:Bi-Weekly:Other: Rams:250/4000 Annular:NA Valves:250/4000 MASP:3939 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 0 NA Permit On Location P Hazard Sec.P Lower Kelly 0 NA Standing Order Posted P Misc.NA Ball Type 0 NA Test Fluid Other Inside BOP 0 NA FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 1 1.75"P Trip Tank NA NA Annular Preventer 0 NA NA Pit Level Indicators NA NA #1 Rams 1 1.75" B/S P Flow Indicator NA NA #2 Rams 1 1.75" P/S P Meth Gas Detector NA NA #3 Rams 0 NA NA H2S Gas Detector NA NA #4 Rams 0 NA NA MS Misc 0 NA #5 Rams 0 NA NA #6 Rams 0 NA NA ACCUMULATOR SYSTEM: Choke Ln. Valves 2 2"P Time/Pressure Test Result HCR Valves 0 NA NA System Pressure (psi)2980 P Kill Line Valves 2 2"P Pressure After Closure (psi)2600 P Check Valve 0 NA NA 200 psi Attained (sec)3 P BOP Misc 0 NA NA Full Pressure Attained (sec)8 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:P Quantity Test Result Nitgn. Bottles # & psi (Avg.):0 NA No. Valves 5 P ACC Misc 0 NA Manual Chokes 2 P Hydraulic Chokes 0 NA Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 0 NA #1 Rams 19 P Coiled Tubing Only:#2 Rams 16 P Inside Reel valves 1 P #3 Rams 0 NA #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:2.0 HCR Choke 0 NA Repair or replacement of equipment will be made within days. HCR Kill 0 NA Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 10/8/22 10:47 Waived By Test Start Date/Time:10/9/2022 10:00 (date)(time)Witness Test Finish Date/Time:10/9/2022 12:00 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Jim Regg Fox Test Fluid: Methanol. Bottle Precharge: 1400 psi. Landry Lynn Hilcorp Ryan Thompson CLU 05RD2 Test Pressure (psi): trais@foxenergyak.com ryan.thompson@hilcorp.com Form 10-424 (Revised 08/2022)2022-1009_BOP_Fox8_CLU-5RD2 Alaska LLC          jbr J. Regg; 11/18/2022 From:Regg, James B (OGC) To:AOGCC Records (CED sponsored) Subject:BOP - Fox 8 Service Coil Date:Friday, November 18, 2022 2:32:15 PM Attachments:2022-1009_BOP_Fox8_CLU-5RD2.pdf Cannery Loop Unit 5RD2 (PTD 2220920) Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 11/17/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTALT#20221117-1 Log Print Files and Log Data Files: Well API #PTD #Log Date Log Company Log Type AOGCC Eset# CLU 05RD2 50133204740200 222092 9/27/2022 Yellowjacket CBL CLU 10 50133205530000 205106 8/7/2022 Yellowjacket CBL-PLUG CLU 10RD 50133205530100 222113 9/30/2022 Yellowjacket CBL CLU 10RD 50133205530100 222113 10/16/2022 Halliburton RCBL CLU 13 50133206460000 214171 10/2/2022 Yellowjacket CBL Please include current contact information if different from above. T37265 T37266 T37267 T37267 T37268 By Meredith Guhl at 1:32 pm, Nov 17, 2022 CLU 05RD2 501 33204740200 222092 9 /27/2022 Ye llowjac ke t CBL Meredith Guhl Digitally signed by Meredith Guhl Date: 2022.11.17 13:32:28 -09'00' Kyle Wiseman Hilcorp Alaska, LLC Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: Kyle.Wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 11/8/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTAL T#20221108-1 Well API #PTD #Log Date Log Company Log Type AOGCC Eset# HVB-16A 502312004001 222070 8/13/2022 AK E-Line Perf HVB-16A 502312004001 222070 8/17/2022 AK E-Line GPT/Perf CLU 05RD2 501332047402 222092 10/5/2022 AK E-Line GPT/CIBP/Cement NCI B-03A 508832009501 222048 9/27/2022 AK E-Line Perf Please include current contact information if different from above. T37249 T37249 T37250 T37251 CLU 05RD2 501332047402 222092 10/5/2022 AK E-Line GPT/CIBP/Cement Kayla Junke Digitally signed by Kayla Junke Date: 2022.11.09 11:41:18 -09'00' David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 11/01/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL WELL: CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 FINAL OPENHOLE WIRELINE LOGS (09/17/202) x GR, SP (5”/100’ MD Color Log) x Data File (LAS) SFTP Transfer - Data Folders: Please include current contact information if different from above. PTD: 222-092 T37217 Kayla Junke Digitally signed by Kayla Junke Date: 2022.11.02 09:37:31 -08'00' David Douglas Hilcorp Alaska, LLC Sr. GeoTechnician 3800 CenterPoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Date: 10/05/2022 To: Alaska Oil & Gas Conservation Commission Petroleum Geology Assistant 333 W 7th Ave Ste 100 Anchorage, AK 99501 DATA TRANSMITTAL RECEIVED OCT 0 5 2022 WELL: CLu-05RD2 AOOCC PTD: 222-092 API: 50-133-20474-02-00 Washed and Dried Well Samples (TD: 09/15/2022) B Set (2 Boxes): WELL BOX SAMPLE INTERVAL (FEET i MD) CLU 05RD2 BOX 1 OF 2 6660' - 8430' MD CLU 05RD2 BOX 2 OF 2 8430' - 9940' MD (TD) Please include current contact information if different from above. Please acknowledge receipt by signing and returning one copy of this transmittal. Received 8 Date: David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 10/04/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL WELL: CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 FINAL LWD FORMATION EVALUATION LOGS (09/10/2022 to 09/16/2022) x ROP, PCG, ADR, ALD, CTN (2” & 5” MD/TVD Color Logs) x Final Definitive Directional Survey SFTP Transfer - Data Folders: Please include current contact information if different from above. PTD:222-092 T37101 Kayla Junke Digitally signed by Kayla Junke Date: 2022.10.05 10:09:13 -08'00' David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 10/04/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL CLU-05RD2 PTD: 222-092 API: 50-133-20474-02-00 MUDLOGS - EOW DRILLING REPORTS (09/10/2022 to 09/15/2022) 1. FINAL EOW REPORT 2. DAILY REPORTS 3. SHOW REPORTS 4. DIGITAL DATA (LAS) 5. MUDLOG PRINTS (2” and 5” MD and TVD COLOR PRINTS – TIFF AND PDF FORMATS) Formation Log LWD Combo Log Gas Ratio Log Drilling Dynamics Log SFTP Transfer - Data Folders: Please include current contact information if different from above. PTD:222-092 T37101 Kayla Junke Digitally signed by Kayla Junke Date: 2022.10.05 10:08:08 -08'00'  5HJJ-DPHV% 2*& )URP%UDG*DWKPDQ & %UDG*DWKPDQ#KLOFRUSFRP! 6HQW7KXUVGD\6HSWHPEHU$0 7R5HJJ-DPHV% 2*& '2$$2*&&3UXGKRH%D\%URRNV3KRHEH/ 2*& &F'RQQD$PEUX] 6XEMHFW%23(7HVW5HSRUWB)R[&78 $WWDFKPHQWV)R[&78[OV[>(;7(51$/@$2*&&,QVSHFWLRQ)RUP&RQILUPDWLRQ(PDLO 7KHLQIRUPDWLRQFRQWDLQHGLQWKLVHPDLOPHVVDJHLVFRQILGHQWLDODQGPD\EHOHJDOO\SULYLOHJHGDQGLVLQWHQGHGRQO\IRUWKHXVHRIWKHLQGLYLGXDORUHQWLW\QDPHG DERYH,I\RXDUHQRWDQLQWHQGHGUHFLSLHQWRULI\RXKDYHUHFHLYHGWKLVPHVVDJHLQHUURU\RXDUHKHUHE\QRWLILHGWKDWDQ\GLVVHPLQDWLRQGLVWULEXWLRQRUFRS\RIWKLV HPDLOLVVWULFWO\SURKLELWHG,I\RXKDYHUHFHLYHGWKLVHPDLOLQHUURUSOHDVHLPPHGLDWHO\QRWLI\XVE\UHWXUQHPDLORUWHOHSKRQHLIWKHVHQGHU VSKRQHQXPEHULVOLVWHG DERYHWKHQSURPSWO\DQGSHUPDQHQWO\GHOHWHWKLVPHVVDJH :KLOHDOOUHDVRQDEOHFDUHKDVEHHQWDNHQWRDYRLGWKHWUDQVPLVVLRQRIYLUXVHVLWLVWKHUHVSRQVLELOLW\RIWKHUHFLSLHQWWRHQVXUHWKDWWKHRQZDUGWUDQVPLVVLRQ RSHQLQJRUXVHRIWKLVPHVVDJHDQGDQ\DWWDFKPHQWVZLOOQRWDGYHUVHO\DIIHFWLWVV\VWHPVRUGDWD1RUHVSRQVLELOLW\LVDFFHSWHGE\WKHFRPSDQ\LQWKLVUHJDUGDQG WKHUHFLSLHQWVKRXOGFDUU\RXWVXFKYLUXVDQGRWKHUFKHFNVDVLWFRQVLGHUVDSSURSULDWH &$87,217KLVHPDLORULJLQDWHGIURPRXWVLGHWKH6WDWHRI$ODVNDPDLOV\VWHP'RQRWFOLFNOLQNVRURSHQ DWWDFKPHQWVXQOHVV\RXUHFRJQL]HWKHVHQGHUDQGNQRZWKHFRQWHQWLVVDIH &DQQHU\/RRS5' 37' STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* SSu bm it t o :jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner: Rig No.:8 DATE: 9/26/22 Rig Rep.: Rig Email: Operator: Operator Rep.: Op. Rep Email: Well Name:PTD #2220920 Sundry #322-562 Operation: Drilling: Workover: x Explor.: Test: Initial: x Weekly: Bi-Weekly: Other: Rams:250/4000 Annular:N/A Valves:250/4000 MASP:3939 MISC. INSPECTIONS: TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 0NA Permit On Location P Hazard Sec.NA Lower Kelly 0NA Standing Order Posted P Misc.NA Ball Type 0NA Test Fluid Water Inside BOP 0NA FSV Misc 0NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 1 1.75"P Trip Tank NA NA Annular Preventer 0NAPit Level Indicators NA NA #1 Rams 1 1.75" BS P Flow Indicator NA NA #2 Rams 1 1.75" PS P Meth Gas Detector NA NA #3 Rams 0NAH2S Gas Detector NA NA #4 Rams 0NAMS Misc 0NA #5 Rams 0NA #6 Rams 0NAACCUMULATOR SYSTEM: Choke Ln. Valves 2 2"P Time/Pressure Test Result HCR Valves 0NASystem Pressure (psi)3000 P Kill Line Valves 2 2"P Pressure After Closure (psi)2375 P Check Valve 0NA200 psi Attained (sec)6 P BOP Misc 0NAFull Pressure Attained (sec)15 P Blind Switch Covers: All stations YES CHOKE MANIFOLD:Bottle Precharge: 1400 P Quantity Test Result Nitgn. Bottles # & psi (Avg.): NA NA No. Valves 5P ACC Misc 0NA Manual Chokes 2P Hydraulic Chokes 0NA Control System Response Time:Time (sec) Test Result CH Misc 0NA Annular Preventer 0 NA #1 Rams 15 P Coiled Tubing Only:#2 Rams 14 P Inside Reel valves 1P #3 Rams 0 NA #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:2.5 HCR Choke 0 NA Repair or replacement of equipment will be made within days. HCR Kill 0 NA Remarks: AOGCC Inspection 24 hr Notice YES Date/Time 9/25/22 09:50 Waived By Test Start Date/Time:9/26/2022 11:00 (date) (time)Witness Test Finish Date/Time:9/26/2022 13:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Fox Accumulator system 4 bottles at 1400psi. Did not receive a response from AOGCC to witness/waive BOPE test Terence Rais Hilcorp Alaska Brad Gathman CLU 05RD2 Test Pressure (psi): Trais@FoxEnergyAK.com brad.gathman@hilcorp.com Form 10-424 (Revised 08/2022)2022-0926_BOP_Fox8_CLU-05RD2 9 9 9 9 9 9 9 9 9 9 9 9 -5HJJ From:McLellan, Bryan J (OGC) To:Chad Helgeson Subject:CLU-05RD2 (PTD 222-092) perf sundry Date:Friday, September 23, 2022 3:24:00 PM Chad, Hilcorp has approval to perform steps 1-10 in the procedure while the sundry application is being processed. FYI, the sundry number is 322-562. Conditions of approval: 1. CT BOP test to 4000 psi 2. Submit CBL to AOGCC for approval to proceed with perfs. Regards Bryan McLellan Senior Petroleum Engineer Alaska Oil & Gas Conservation Commission 333 W 7th Ave Anchorage, AK 99501 Bryan.mclellan@alaska.gov +1 (907) 250-9193 MEMORANDUM State of Alaska Alaska Oil and Gas Conservation Commission DATE:Tuesday, October 25, 2022 SUBJECT:Mechanical Integrity Tests TO: FROM:Sully Sullivan P.I. Supervisor Petroleum Inspector NON-CONFIDENTIAL Hilcorp Alaska, LLC 05RD2 CANNERY LOOP UNIT 05RD2 Jim Regg InspectorSrc: Reviewed By: P.I. Suprv Comm ________ JBR 10/25/2022 05RD2 50-133-20474-02-00 222-092-0 N SPT 5042 2220920 2500 0 340 340 345 0 220 220 220 INITAL P Sully Sullivan 9/22/2022 Initial MIT of IA to 2500 psi per PTD after new perfs 30 MinPretestInitial15 Min Well Name Type Test Notes: Interval P/F Well Permit Number: Type Inj TVD PTD Test psi API Well Number Inspector Name:CANNERY LOOP UNIT 05RD2 Inspection Date: Tubing OA Packer Depth 0 2700 2700 2700IA 45 Min 60 Min Rel Insp Num: Insp Num:mitSTS220930102444 BBL Pumped:3.5 BBL Returned:3.7 Tuesday, October 25, 2022 Page 1 of 1 9 9 9 9 9 *DV3URGXFHU MIT of IA James B. Regg Digitally signed by James B. Regg Date: 2022.10.26 10:56:58 -08'00' MEMORANDUM State of Alaska Alaska Oil and Gas Conservation Commission DATE:Tuesday, October 25, 2022 SUBJECT:Mechanical Integrity Tests TO: FROM:Sully Sullivan P.I. Supervisor Petroleum Inspector NON-CONFIDENTIAL Hilcorp Alaska, LLC 05RD2 CANNERY LOOP UNIT 05RD2 Jim Regg InspectorSrc: Reviewed By: P.I. Suprv Comm ________ JBR 10/25/2022 05RD2 50-133-20474-02-00 222-092-0 N SPT 5042 2220920 4000 0 4100 4100 4100 0 0 0 0 INITAL P Sully Sullivan 9/22/2022 Initial MIT of Tubing after new perfs 30 MinPretestInitial15 Min Well Name Type Test Notes: Interval P/F Well Permit Number: Type Inj TVD PTD Test psi API Well Number Inspector Name:CANNERY LOOP UNIT 05RD2 Inspection Date: Tubing OA Packer Depth 0 370 365 360IA 45 Min 60 Min Rel Insp Num: Insp Num:mitSTS220930100422 BBL Pumped:2.3 BBL Returned:2.5 Tuesday, October 25, 2022 Page 1 of 1 9 9 9 9 9 9 9 *DV3URGXFHU MIT of Tubing James B. Regg Digitally signed by James B. Regg Date: 2022.10.26 10:54:41 -08'00' From:Regg, James B (OGC) To:AOGCC Records (CED sponsored) Subject:FW: [EXTERNAL] RE: Incident on Rig 169 Date:Monday, September 12, 2022 2:01:44 PM Cannery Loop Unit 5RD2 (PTD 2220920) Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 From: Jay Murphy - (C) <Jay.Murphy@hilcorp.com> Sent: Monday, September 12, 2022 10:54 AM To: Regg, James B (OGC) <jim.regg@alaska.gov> Cc: McLellan, Bryan J (OGC) <bryan.mclellan@alaska.gov> Subject: RE: [EXTERNAL] RE: Incident on Rig 169 Jim, Saturday September 10, 2022 at 08:30 am we completed the 20’ of new formation below the window we milled and the whipstock representative completed dressing and dry drifting the window after we circulated a bottoms up we parked the string at 6645’ and rigged up our testing equipment and performed the LOT. I went to the office to pass on the results of the LOT to Mr. Mclaughlin. At about 10:15 am I was notified that the pipe had been pulled into the VBRs which were in the Upper pipe rams. Looking back on the Pason system the event took place at 10:00 am. We were concerned about any debris that may cause more damage in the Upper ram cavity. We connected the trip tank to the IA with a tee and closed the lower 4-1/2” fixed rams and opened up the upper pipe rams to inspect. The rams were damaged but there was no broken parts laying in the ram cavities. We buttoned up the upper ram doors and we observed that the turbocharger on the rig floor motor was burnt up so we replaced that too. It was 14:00 hours when we verified no pressure under the lower pipe rams and opened the well and POOH with the milling assembly. Thank You and Best Regards, Jay Murphy/ DSM Hilcorp Alaska, LLC HAK Rig 169 Office: 907-283-1369 Cell: 907-715-9211 Jay.Murphy@Hilcorp.com 7\SHRI5HTXHVW$EDQGRQ 3OXJ3HUIRUDWLRQV )UDFWXUH6WLPXODWH 5HSDLU:HOO 2SHUDWLRQVVKXWGRZQ 6XVSHQG 3HUIRUDWH 2WKHU6WLPXODWH 3XOO7XELQJ &KDQJH$SSURYHG3URJUDP 3OXJIRU5HGULOO 3HUIRUDWH1HZ3RRO 5HHQWHU6XVS:HOO $OWHU&DVLQJ 2WKHU,QLWLDO&RPSOHWLRQ1&RLO 2SHUDWRU1DPH&XUUHQW:HOO&ODVV 3HUPLWWR'ULOO1XPEHU ([SORUDWRU\ 'HYHORSPHQW $GGUHVV6WUDWLJUDSKLF 6HUYLFH $3,1XPEHU ,ISHUIRUDWLQJ:HOO1DPHDQG1XPEHU :KDW5HJXODWLRQRU&RQVHUYDWLRQ2UGHUJRYHUQVZHOOVSDFLQJLQWKLVSRRO" :LOOSODQQHGSHUIRUDWLRQVUHTXLUHDVSDFLQJH[FHSWLRQ"<HV 1R 3URSHUW\'HVLJQDWLRQ /HDVH1XPEHU )LHOG3RRO V   7RWDO'HSWK0' IW 7RWDO'HSWK79' IW  (IIHFWLYH'HSWK0' (IIHFWLYH'HSWK79' 0363 SVL  3OXJV 0'  -XQN 0'   1$ &DVLQJ &ROODSVH &RQGXFWRU 6XUIDFH SVL ,QWHUPHGLDWH SVL ,QWHUPHGLDWH SVL ,QWHUPHGLDWH/QU SVL 3URGXFWLRQ/QU SVL 3DFNHUVDQG66697\SH3DFNHUVDQG66690' IW DQG79' IW  $WWDFKPHQWV3URSRVDO6XPPDU\ :HOOERUHVFKHPDWLF :HOO&ODVVDIWHUSURSRVHGZRUN 'HWDLOHG2SHUDWLRQV3URJUDP %236NHWFK ([SORUDWRU\ 6WUDWLJUDSKLF 'HYHORSPHQW 6HUYLFH (VWLPDWHG'DWHIRU :HOO6WDWXVDIWHUSURSRVHGZRUN &RPPHQFLQJ2SHUDWLRQV2,/ :,1- :'63/6XVSHQGHG 9HUEDO$SSURYDO'DWH *$6 :$* *6725 63/8* $2*&&5HSUHVHQWDWLYH*,1-2S6KXWGRZQ $EDQGRQHG &RQWDFW1DPH&KDG+HOJHVRQ2SHUDWLRQV(QJLQHHU &RQWDFW(PDLOFKHOJHVRQ#KLOFRUSFRP &RQWDFW3KRQH  $XWKRUL]HG7LWOH &RQGLWLRQVRIDSSURYDO1RWLI\$2*&&VRWKDWDUHSUHVHQWDWLYHPD\ZLWQHVV 6XQGU\1XPEHU 3OXJ,QWHJULW\%237HVW 0HFKDQLFDO,QWHJULW\7HVW /RFDWLRQ&OHDUDQFH 2WKHU 3RVW,QLWLDO,QMHFWLRQ0,75HT G"<HV 1R 6SDFLQJ([FHSWLRQ5HTXLUHG"<HV 1R 6XEVHTXHQW)RUP5HTXLUHG $33529('%< $SSURYHGE\ &200,66,21(5 7+($2*&& 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ SVL 6HH$WWDFKHG6FKHPDWLF  6HH$WWDFKHG6FKHPDWLF  SVL       3HUIRUDWLRQ'HSWK0' IW           /HQJWK 6L]H / 79'%XUVW  SVL 0' SVL SVL      35(6(17:(//&21',7,216800$5< 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 $33/,&$7,21)25681'5<$33529$/6 $$& $'/$'/  &HQWHUSRLQW'U6XLWH$QFKRUDJH$. +LOFRUS$ODVND//& &DQQHU\/RRS8QLW8SSHU7\RQHN*3%HOXJD*3 &2$&/85' 7XELQJ*UDGH7XELQJ0' IW 3HUIRUDWLRQ'HSWK79' IW 7XELQJ6L]H 6HSWHPEHU  6/=;3 =;3/LQHU7RS3NUV6756669  0' 79' 0' 79' 0'79' ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEHGHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO $XWKRUL]HG1DPHDQG 'LJLWDO6LJQDWXUHZLWK'DWH $2*&&86(21/< 'DQ0DUORZH2SHUDWLRQV0DQDJHU    aSVL 1$     3  W     V    )RUP5HYLVHG$SSURYHGDSSOLFDWLRQLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDO By Anne Prysunka at 3:30 pm, Sep 21, 2022  'LJLWDOO\VLJQHGE\'DQ0DUORZH  '1FQ 'DQ0DUORZH   RX 8VHUV 'DWH  'DQ0DUORZH  6XEPLW &%/ WR $2*&& IRU DSSURYDO WR SURFHHG ZLWK SHUIV 6)' <HV IRU VWHSV   %U\DQ 0F/HOODQ  )HH+LOFRUS IRUPHUO\ &7 %23 WHVW WR  SVL 6)' )HH3ULYDWH ; '65%-0 -/&  Gregory Wilson Digitally signed by Gregory Wilson Date: 2022.09.27 08:27:57 -08'00' RBDMS JSB 100322     tĞůůtŽƌŬWƌŽŐŶŽƐŝƐ tĞůůEĂŵĞ͗>hϱZϮ W/EƵŵďĞƌ͗ϱϬͲϭϯϯͲϮϬϰϳϰͲϬϮͲϬϬ ƵƌƌĞŶƚ^ƚĂƚƵƐ͗'ĂƐWƌŽĚƵĐĞƌZŝŐ͗ůŝŶĞΘ&Ždždh ƐƚŝŵĂƚĞĚ^ƚĂƌƚĂƚĞ͗ϵͬϮϱͬϮϮ ZĞŐƵůĂƚŽƌLJŽŶƚĂĐƚ͗ŽŶŶĂŵďƌƵnj;ϴϯϬϱͿWĞƌŵŝƚƚŽƌŝůůEƵŵďĞƌ͗ϮϮϮͲϬϵϮ &ŝƌƐƚĂůůŶŐŝŶĞĞƌ͗ŚĂĚ,ĞůŐĞƐŽŶ;ϵϬϳͿϳϳϳͲϴϰϬϱ;KͿ;ϵϬϳͿϮϮϵͲϰϴϮϰ;DͿ ^ĞĐŽŶĚĂůůŶŐŝŶĞĞƌ͗^ĞĂŶDĐ>ĂƵŐŚůŝŶ;ϵϬϳͿϮϮϯͲϲϳϴϰ;DͿ DĂdžŝŵƵŵdžƉĞĐƚĞĚ,Wϰ͕ϳϲϬƉƐŝΛϴ͕ϮϬϴ͛dsĂƐĞĚŽŶϬ͘ϱϴƉƐŝͬĨƚŐƌĂĚŝĞŶƚ Maximum Potential Surface Pressure: 3,939 psi @ 8,208’ TVD Using 0.1 psi/ft gradient 20 AAC 25.280(b)(4) ƌŝĞĨtĞůů^ƵŵŵĂƌLJ ĂŶŶĞƌLJ>ŽŽƉϱZϮŝƐĂƐŝĚĞƚƌĂĐŬĞĚŐĂƐƉƌŽĚƵĐĞƌƚŚĂƚǁĂƐĚƌŝůůĞĚĂŶĚĐŽŵƉůĞƚĞĚƚŚŝƐǁĞĞŬ͕^ĞƉƚĞŵďĞƌ ϮϬϮϮ͘dŚĞǁĞůůďŽƌĞŝƐĐŽŵƉůĞƚĞĚĂƐĂϰͲϭͬϮ͟ŵŽŶŽͲďŽƌĞǁŝƚŚƚŝĞďĂĐŬƚŽƐƵƌĨĂĐĞ͕ƚŚĞƚƵďŝŶŐǁŝůůďĞ ƚĞƐƚĞĚƚŽϰϬϬϬƉƐŝĂŶĚĐĂƐŝŶŐƚŽϮϱϬϬƉƐŝ͘  dŚĞƌĞŝƐŽŶĞƐŵĂůůhƉƉĞƌdLJŽŶĞŬƐĂŶĚ;ϳĨƚͿƚŚĂƚǁŝůůďĞƚĞƐƚĞĚŝŶƚŚĞǁĞůůƉƌŝŽƌƚŽƉĞƌĨŽƌĂƚŝŶŐƚŚĞůŽǁĞƌ ĞůƵŐĂƐĂŶĚƐ͕ƚŚĞŵĂŝŶƚĂƌŐĞƚŽĨƚŚĞĚƌŝůůǁĞůů͘/ĨƚŚĞhƉƉĞƌdLJŽŶĞŬƐĂŶĚŝƐĐŽŵŵĞƌĐŝĂů͕ĂŶĂƉƉůŝĐĂƚŝŽŶ ǁŝůůďĞƐƵďŵŝƚƚĞĚĨŽƌĐŽŵŵŝŶŐůŝŶŐƚŚĞƵƉƉĞƌdLJŽŶĞŬĂŶĚ>ŽǁĞƌĞůƵŐĂWŽŽůƐ͘/ĨƚŚĞhƉƉĞƌdLJŽŶĞŬƐĂŶĚ ŝƐĚĞĞŵĞĚŶŽŶͲĐŽŵŵĞƌĐŝĂů͕ƚŚĞƐĂŶĚǁŝůůďĞƉůƵŐŐĞĚďĂĐŬ͕ĂŶĚƚŚĞĞůƵŐĂƉŽŽůǁŝůůďĞƉĞƌĨŽƌĂƚĞĚ͘  EŽƚĞƐZĞŐĂƌĚŝŶŐtĞůůďŽƌĞŽŶĚŝƚŝŽŶ xϰͲϭͬϮ͟ŵŽŶŽďŽƌĞĐŽŵƉůĞƚŝŽŶ;ůĂŶĚĞĚϵͬϮϭͬϮϮͿ x^^^sĂƚϭϰϭ͛ x>ŝŶĞƌͬƐĞĂůĂƐƐĞŵďůLJΛϲ͕Ϯϭϰ͛ x>ŝŶĞƌĨŝůůĞĚǁŝƚŚϭϭ͘ϯƉƉŐĚƌŝůůŝŶŐŵƵĚ xdƵďŝŶŐĨŝůůĞĚǁŝƚŚϴ͘ϰƉƉŐǁĂƚĞƌ x/E'^WŽŽůďŽƚƚŽŵʹϲ͕ϯϬϰ͛D;ϱ͕ϭϰϬ͛dsͿ  WƌŽĐĞĚƵƌĞ͗ ϭ͘ZĞǀŝĞǁĂůůĂƉƉƌŽǀĞĚKƐ Ϯ͘D/Zh&ŽdžŽŝůĞĚdƵďŝŶŐhŶŝƚ͕WdKWƚŽϰ͕ϬϬϬƉƐŝ,ŝŐŚͬϮϱϬƉƐŝ>Žǁ ϯ͘WƌŽǀŝĚĞK'ϮϰŚƌƐŶŽƚŝĐĞŽĨKWƚĞƐƚ ϰ͘WhŵŽƚŽƌΘŵŝůů͕Z/,ĂŶĚŵŝůůĨƌŽŵƚĂŐĚĞƉƚŚ;ĞdžƉĞĐƚƐŽŵĞĐĞŵĞŶƚƐƚƌŝŶŐĞƌƐĨƌŽŵďƵŵƉŝŶŐƉůƵŐ ϱďďůƐĞĂƌůLJͿƚŽWdŽĨϵ͕ϴϱϭ͛ŽƌƚŝůůƐƚŽƉƉĞĚƉƌŽŐƌĞƐƐĂƚůĞĂƐƚďĞůŽǁϵ͕ϳϱϬ͛ ϱ͘ŝƌĐŽƵƚϭϭ͘ϯƉƉŐŵƵĚƚŽϴ͘ϰƉƉŐǁĂƚĞƌ͘ ϲ͘D/ZhͲůŝŶĞ͕WdůƵďƌŝĐĂƚŽƌƚŽϮϱϬϬƉƐŝ,ŝŐŚͬϮϱϬƉƐŝ>Žǁ;ŶŽŽƉĞ ŶƉĞƌĨƐͿ ϳ͘Z/,ĂŶĚůŽŐ> ϴ͘ZůŝŶĞ ϵ͘dZ/,ǁŝƚŚũĞƚŶŽnjnjůĞ͕ƵŶůŽĂĚĨůƵŝĚĨƌŽŵƚŚĞǁĞůůďŽƌĞǁŝƚŚŶŝƚ ƌŽŐĞŶ͕ůĞĂǀĞEϮƉƌĞƐƐƵƌĞŽŶǁĞůů ƚŽĚĞƐŝƌĞĚƵŶĚĞƌďĂůĂŶĐĞĨƌŽŵƚŚĞZĞƐĞƌǀŽŝƌŶŐŝŶĞĞƌ;ĞdžƉĞĐƚϮϱϬϬͲϯϬϬϬƉƐŝͿ ϭϬ͘ZDKĐŽŝůƚƵďŝŶŐ ϭϭ͘ZhͲůŝŶĞ͕WdůƵďƌŝĐĂƚŽƌƚŽϰϬϬϬƉƐŝ,ŝŐŚͬϮϱϬƉƐŝ>Žǁ ϭϮ͘WĞƌĨŽƌĂƚĞhƉƉĞƌdLJŽŶĞŬƐĂŶĚǁŝƚŚϲϬĚĞŐƉŚĂƐĞĚŚŽůůŽǁĐĂƌƌŝĞƌƉĞƌĨŐƵŶƐ WŽŽů^ĂŶĚƐdŽƉ;DͿƚŵ;DͿdŽƉ;dsͿƚŵ;dsͿ&d hƉƉĞƌdLJŽŶĞŬhdϱцϵ͕ϳϬϯΖцϵ͕ϳϭϬΖцϴ͕ϮϬϴ͛цϴ͕Ϯϭϰ͛цϳΖ  DĂŬĞĐŽƌƌĞůĂƚŝŽŶƉĂƐƐĂŶĚƐĞŶĚůŽŐŝŶƚŽKƉĞƌĂƚŝŽŶƐŶŐŝŶĞĞƌ͕ZĞƐĞƌǀŽŝƌŶŐŝŶĞĞƌĂŶĚƚŚĞ'ĞŽůŽŐŝƐƚ͘ D 5HFRUGLQLWLDODQGPLQXWHWXELQJSUHVVXUHVDIWHUILULQJ 0,77 DQG 0,7,$ GRQH ZLWK WKH ULJ EMP ƚŚĞƚƵďŝŶŐǁŝůůďĞ ƚĞƐƚĞĚƚŽϰϬϬϬƉƐŝĂŶĚĐĂƐŝŶŐƚŽϮϱϬϬƉƐŝ͘ 6XEPLW &%/ WR $2*&& IRU DSSURYDO WR SURFHHG ZLWK SHUIV  EMP     tĞůůtŽƌŬWƌŽŐŶŽƐŝƐ ď͘ďŽǀĞƉĞƌĨƐǁŝůůďĞƐŚŽƚŝŶƚŚĞhƉƉĞƌdLJŽŶĞŬ'ĂƐWŽŽůŐŽǀĞƌŶĞĚďLJKϮϯϭ͘  ϭϯ͘ZͲ>ŝŶĞhŶŝƚĂŶĚƚƵƌŶǁĞůůŽǀĞƌƚŽƉƌŽĚƵĐƚŝŽŶ ϭϰ͘KƉĞƌĂƚŝŽŶƐƚŽĨůŽǁǁĞůůĂŶĚƚĞƐƚ͕  /ĨĐŽŵŵĞƌĐŝĂůƌĂƚĞƐĂƌĞĂĐŚŝĞǀĞĚĂŶĂƉƉůŝĐĂƚŝŽŶĨŽƌĐŽŵŵŝŶŐůŝŶŐǁŝůůďĞƐƵďŵŝƚƚĞĚƚŽK'ĨŽƌ ƌĞǀŝĞǁ͘  ϭϱ͘dĞƐƚ^s^ĂƐƉĞƌϮϬϮϱ͘Ϯϲϱ͘ ĂͿEŽƚŝĨLJK'ϮϰŚƌƐŝŶĂĚǀĂŶĐĞŽĨƚĞƐƚŝŶŐ^s^  /ĨŽŵŵĞƌĐŝĂůƌĂƚĞƐĂƌĞŶŽƚĂĐŚŝĞǀĞĚďLJƚŚĞhƉƉĞƌdLJŽŶĞŬƐĂŶĚ ϭϲ͘D/ZhůŝŶĞĂŶĚEϮƉƵŵƉƚƌƵĐŬ ϭϳ͘WƌĞƐƐƵƌĞƚĞƐƚĞƋƵŝƉŵĞŶƚƚŽϰ͕ϬϬϬƉƐŝ,ŝŐŚͬϮϱϬƉƐŝ>Žǁ ϭϴ͘ůŝŶĞƌƵŶWdƚŽĨŝŶĚĨůƵŝĚůĞǀĞů ϭϵ͘ZhEϮĂŶĚƉƵƐŚĨůƵŝĚďĞůŽǁϵ͕ϭϱϬ͛;ǀĞƌŝĨLJĨůƵŝĚĚĞƉƚŚǁŝƚŚWdͿ ϮϬ͘WhϰͲϭͬϮ͟/W͕Z/,ĂŶĚƐĞƚĂƚΕϵ͕ϲϳϴ͛;ǁŝƚŚŝŶϱϬĨƚŽĨƚŚĞƚŽƉƉĞƌĨŝŶdLJŽŶĞŬƐĂŶĚƐͿ Ϯϭ͘ƵŵƉďĂŝůϮϱĨƚŽĨĐĞŵĞŶƚŽŶƚŽƉŽĨƉůƵŐ;ĞƐƚdŽΕϵ͕ϲϱϯ͛DͿ ϮϮ͘WĞƌĨŽƌĂƚĞĞůƵŐĂ'ĂƐƐĂŶĚƐǁŝƚŚϲϬĚĞŐƉŚĂƐĞĚŚŽůůŽǁĐĂƌƌŝĞƌƉĞƌĨŐƵŶƐ WŽŽů^ĂŶĚƐdŽƉ;DͿƚŵ;DͿdŽƉ;dsͿƚŵ;dsͿ&d ĞůƵŐĂ>ϱͲ>цϳ͕ϴϴϬΖцϵ͕ϭϭϭΖцϲ͕ϱϲϱ͛цϳ͕ϲϳϬ͛цϭ͕ϮϯϭΖ  DĂŬĞĐŽƌƌĞůĂƚŝŽŶƉĂƐƐĂŶĚƐĞŶĚůŽŐŝŶƚŽKƉĞƌĂƚŝŽŶƐŶŐŝŶĞĞƌ͕ZĞƐĞƌǀŽŝƌŶŐŝŶĞĞƌĂŶĚƚŚĞ'ĞŽůŽŐŝƐƚ͘ D 5HFRUGLQLWLDODQGPLQXWHWXELQJSUHVVXUHVDIWHUILULQJ ď͘ďŽǀĞƉĞƌĨƐǁŝůůďĞƐŚŽƚŝŶƚŚĞĞůƵŐĂ'ĂƐWŽŽůŐŽǀĞƌŶĞĚďLJKϮϯϭ Đ͘ƐƚŝŵĂƚĞĚϰϴϯĨƚŽĨĂĐƚƵĂůƉĞƌĨƐǁŝůůďĞƐŚŽƚŽǀĞƌƚŚŝƐϭ͕ϮϯϭĨƚŝŶƚĞƌǀĂůŝŶƚŚĞ>ŽǁĞƌ ĞůƵŐĂ^ĂŶĚƐ Ϯϯ͘/Ĩ^s^ǁĂƐŶŽƚƚĞƐƚĞĚĚƵƌŝŶŐhƉƉĞƌdLJŽŶĞŬ'ĂƐƚĞƐƚ͕dĞƐƚ^s^ĂƐƉĞƌϮϬϮϱ͘Ϯϲϱ͘ Ă͘EŽƚŝĨLJK'ϮϰŚƌƐŝŶĂĚǀĂŶĐĞŽĨƚĞƐƚŝŶŐ^s^  ͲůŝŶĞWƌŽĐĞĚƵƌĞ;ŽŶƚŝŶŐĞŶĐLJͿ  ϭ͘/ĨĂŶLJnjŽŶĞƉƌŽĚƵĐĞƐƐĂŶĚĂŶĚͬŽƌǁĂƚĞƌŽƌŶĞĞĚƐŝƐŽůĂƚĞĚ͗ Ϯ͘D/ZhͲ>ŝŶĞĂŶĚƉƌĞƐƐƵƌĞĐŽŶƚƌŽůĞƋƵŝƉŵĞŶƚ͘WdůƵďƌŝĐĂƚŽƌƚŽϮϱϬƉƐŝ>ŽǁͬϮ͕ϱϬϬƉƐŝ,ŝŐŚ͘ ϯ͘Z/,ĂŶĚƐĞƚĂĂƐŝŶŐWĂƚĐŚŽƌƐĞƚĂ/WĂďŽǀĞƚŚĞnjŽŶĞĂŶĚĚƵŵ ƉϮϱ͛ŽĨĐĞŵĞŶƚŽŶƚŽƉŽĨ ƚŚĞƉůƵŐ͘ ϰ͘/ĨŶĞĐĞƐƐĂƌLJƚŽĐůĞĂŶŽƵƚŽƌƵŶůŽĂĚǁĞůů͕ZhƐĂŵĞĐŽŝůĞƋƵŝƉŵĞŶƚƵƐĞĚŝŶŝŶŝƚŝĂůĐŽŵƉůĞƚŝŽŶ Ă͘dĞƐƚKWƐ͕ϰϬϬϬƉƐŝ,ŝŐŚͬϮϱϬƉƐŝ>Žǁ ď͘ůĞĂŶŽƵƚǁŝƚŚEϮŽƌĨŽĂŵ Đ͘^ĞƚϰͲϭͬϮ͟ƉůƵŐŽƌƉĂƚĐŚ  ƚƚĂĐŚŵĞŶƚƐ͗ ϭ͘WƌŽƉŽƐĞĚtĞůů^ĐŚĞŵĂƚŝĐ Ϯ͘ŽŝůdƵďŝŶŐKWŝĂŐƌĂŵ ϯ͘^ƚĂŶĚĂƌĚEŝƚƌŽŐĞŶKƉĞƌĂƚŝŽŶƐ    hƉĚĂƚĞĚďLJ,ϬϵͲϮϭͲϮϬϮϮ WƌŽƉŽƐĞĚ ĂŶŶĞƌLJ>ŽŽƉhŶŝƚ >hͲϬϱZϮ Wd͗ϮϮϮͲϬϵϮ W/͗ϱϬͲϭϯϯͲϮϬϰϳϰͲϬϮͲϬϬ Wdсϵ͕ϴϱϭ͛ͬdsсϴ͕ϯϰϯ͛ dсϵ͕ϵϰϬ͛ͬdsсϴ͕ϰϮϰ͛ Z<ƚŽ'>сϭϴ͘ϭϮ͛ &LQJVD )URP¶ ¶0'                                                                     WZ&KZd/KEd/> ^ĂŶĚƐdŽƉ;DͿƚŵ;DͿdŽƉ;dsͿƚŵ;dsͿ&dĂƚĞ^ƚĂƚƵƐ >ϱͲ>цϳ͕ϴϴϬΖцϵ͕ϭϭϭΖцϲ͕ϱϲϱ͛цϳ͕ϲϳϬ͛цϭ͕ϮϯϭΖdWƌŽƉŽƐĞĚ hdϱцϵ͕ϳϬϯΖцϵ͕ϳϭϬΖцϴ͕ϮϬϴ͛цϴ͕Ϯϭϰ͛цϳΖdWƌŽƉŽƐĞĚ ^/E'Θdh/E'd/> ^ŝnjĞdLJƉĞtƚ'ƌĂĚĞŽŶŶ͘/dŽƉƚŵ ϮϬ͟ŽŶĚƵĐƚŽƌϭϮϵͲtĞůĚͲ^ƵƌĨϭϰϮ͛ ϭϯͲϯͬϴΗ^ƵƌĨƐŐϲϭ͘Ϭ<ͲϱϱdϭϮ͘ϱϭϱ͟^ƵƌĨϮ͕ϵϳϬ͛ ϵͲϱͬϴ͟/ŶƚĞƌŵĞĚŝĂƚĞƐŐϱϯ͘ϱ>ͲϴϬdϴ͘ϱϯϱ͟^ƵƌĨϭ͕ϮϭϮ͛ ϵͲϱͬϴ͟/ŶƚĞƌŵĞĚŝĂƚĞƐŐϰϳWͲϭϭϬdϴ͘ϲϴϭ͟ϭ͕ϮϭϮ͛ϲ͕ϱϮϳ͛ ϳͲϱͬϴ͟/ŶƚĞƌŵĞĚŝĂƚĞ>ŶƌϮϵ͘ϳη>ͲϴϬ,LJĚϱϮϭϲ͘ϴϳϱ͟ϲ͕ϰϯϯ͛ϲ͕ϲϴϱ͛ ϰͲϭͬϮΗWƌŽĚ>ŶƌϭϮ͘ϲ>ͲϴϬtͬϯ͘ϵϱϴ͟ϲ͕Ϯϭϰ͛ϵ͕ϵϯϴ͛ ϰͲϭͬϮ͟dƵďŝŶŐϭϮ͘ϲ>ͲϴϬtͬϯ͘ϵϱϴ͟^ƵƌĨϲ͕Ϯϭϰ͛   Ϯ ϮϬ͟  ϭϯͲϯͬϴ͟ ϭϲ͟ ŚŽůĞ ϰͲϭͬϮ͟ :t>Zzd/> EŽ͘ĞƉƚŚ/K/ƚĞŵ ϭϭϰϭϯ͘ϴϭϯ͟´ĂŬĞƌ^ͲϱdZ^^^s Ϯϲ͕Ϯϭϰ͛ϳ͘ϯϳ͟ϳ͟džϵͲϱͬϴ͟^>yW,Z>ŝŶĞƌƚŽƉƉĂĐŬĞƌ͕ǁͬϳ͘ϯϳ͟ WZ ϯϲ͕ϰϯϯ͛ϯ͘ϵϱϴ͟ϲ͘ϴϳϱ͟ϳͲϱͬϴ͟yW>ŝŶĞƌdŽƉWĂĐŬĞƌ   KWE,K>ͬDEdd/> ϭϯͲϯͬϴ͟&ƵůůLJĐĞŵĞŶƚĞĚǁŝƚŚϭϰϬďďůƐďĂĐŬƚŽƐƵƌĨĂĐĞ;>hͲϬϱŝŶϭϵϵϲͿ ϵͲϱͬϴ͟ ϭϮͲϭͬϰ͟ŚŽůĞ͗WƵŵƉĞĚĨƌŽŵϵϭϳϴ͛D͘ϴϱϬƐdžƐůĞĂĚ;ϯϳϱďďůƐͿĂŶĚϭϬϲϵƐdžƐ ;ϮϮϮďďůƐͿƚĂŝů;>hͲϬϱŝŶϭϵϵϲͿϭϭͬϭϵͬϵϲh^/dƐŚŽǁƐϵͲϱͬϴ͟ĐĞŵĞŶƚĞĚƵƉƚŽĂƚ ůĞĂƐƚϮϴϬϬ͛D;ƐƚŽƉƉĞĚůŽŐŐŝŶŐƚŚĞƌĞͿ ϳͲϱͬϴ͟ ϴͲϭͬϮ͟ŚŽůĞ͗ĞŵĞŶƚĞĚǁŝƚŚϭϬϮ͘ϳďďůƐϭϱ͘ϯƉƉŐĐůĂƐƐ'͘ŚĂĚůŽƐƐĞƐĂŶĚŐŽƚŶŽ ĐĞŵĞŶƚďĂĐŬƚŽƐƵƌĨĂĐĞ͘ϵͬϮϰͬϮϬ^DdƐŚŽǁƐŐŽŽĚĐĞŵĞŶƚƵƉƚŽĂƚůĞĂƐƚϲ͕ϱϮϱ D;ďĞŚŝŶĚƚƵďŝŶŐĂďŽǀĞƚŚĂƚͿ ϰͲϭͬϮ͟WůĂŶŶĞĚ͘dKΛϲ͕ϰϲϱ͛;ϱϬйĞdžĐĞƐƐͿʹdǁŝƚŚ>  ϰ ϵͲϱͬϴ͟ ϭ >hͲϬϱZ ;ďĂŶĚŽŶĞĚͿ tŝŶĚŽǁΛ ϲ͕ϲϲϲ͛ ϲͲϯͬϰ͟ ŚŽůĞ ϳͲϱͬϴ͟ ϯ  ^ƋƵĞĞnjĞĚƉĞƌĨƐ ϳͬϮϮͬϮϮ     ^dEZt>>WZKhZ E/dZK'EKWZd/KE^ ϭϮͬϬϴͬϮϬϭϱ &/E>ǀϭ WĂŐĞϭŽĨϭ ϭ͘Ϳ D/ZhEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚĂŶĚ>ŝƋƵŝĚEŝƚƌŽŐĞŶdƌĂŶƐƉŽƌƚ͘ Ϯ͘Ϳ EŽƚŝĨLJWĂĚKƉĞƌĂƚŽƌŽĨƵƉĐŽŵŝŶŐEŝƚƌŽŐĞŶŽƉĞƌĂƚŝŽŶƐ͘ ϯ͘Ϳ WĞƌĨŽƌŵWƌĞͲ:Žď^ĂĨĞƚLJDĞĞƚŝŶŐ͘ZĞǀŝĞǁEŝƚƌŽŐĞŶǀĞŶĚŽƌƐƚĂŶĚĂƌĚŽƉĞƌĂƚŝŶŐƉƌŽĐĞĚƵƌĞƐĂŶĚ ĂƉƉƌŽƉƌŝĂƚĞ^ĂĨĞƚLJĂƚĂ^ŚĞĞƚƐ;ĨŽƌŵĞƌůLJD^^Ϳ͘ ϰ͘Ϳ ŽĐƵŵĞŶƚ ŚĂnjĂƌĚƐ ĂŶĚ ŵŝƚŝŐĂƚŝŽŶ ŵĞĂƐƵƌĞƐ ĂŶĚ ĐŽŶĨŝƌŵ ĨůŽǁ ƉĂƚŚƐ͘ /ŶĐůƵĚĞ ƌĞǀŝĞǁ ŽŶ ĂƐƉŚLJdžŝĂƚŝŽŶĐĂƵƐĞĚ ďLJ ŶŝƚƌŽŐĞŶĚŝƐƉůĂĐŝŶŐŽdžLJŐĞŶ͘DŝƚŝŐĂƚŝŽŶŵĞĂƐƵƌĞƐŝŶĐůƵĚĞĂƉƉƌŽƉƌŝĂƚĞ ƌŽƵƚŝŶŐŽĨĨůŽǁůŝŶĞƐ͕ĂĚĞƋƵĂƚĞǀĞŶƚŝŶŐĂŶĚĂƚŵŽƐƉŚĞƌŝĐŵŽŶŝƚŽƌŝŶŐ͘ ϱ͘Ϳ ^ƉŽƚWƵŵƉŝŶŐhŶŝƚĂŶĚdƌĂŶƐƉŽƌƚ͘ŽŶĨŝƌŵůŝƋƵŝĚEϮǀŽůƵŵĞƐŝŶƚƌĂŶƐƉŽƌƚ͘ ϲ͘Ϳ ZŝŐƵƉůŝŶĞƐĨƌŽŵƚŚĞEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚƚŽƚŚĞǁĞůůĂŶĚƌĞƚƵƌŶƐƚĂŶŬ͘^ĞĐƵƌĞůŝŶĞƐǁŝƚŚǁŚŝƉ ĐŚĞĐŬƐ͘ ϳ͘Ϳ WůĂĐĞ ƐŝŐŶƐ ĂŶĚ ƉůĂĐĂƌĚƐ ǁĂƌŶŝŶŐ ŽĨ ŚŝŐŚ ƉƌĞƐƐƵƌĞ ĂŶĚ ŶŝƚƌŽŐĞŶ ŽƉĞƌĂƚŝŽŶƐ Ăƚ ĂƌĞĂƐ ǁŚĞƌĞ EŝƚƌŽŐĞŶŵĂLJĂĐĐƵŵƵůĂƚĞŽƌďĞƌĞůĞĂƐĞĚ͘ ϴ͘Ϳ WůĂĐĞƉƌĞƐƐƵƌĞŐĂƵŐĞƐĚŽǁŶƐƚƌĞĂŵŽĨůŝƋƵŝĚĂŶĚŶŝƚƌŽŐĞŶƉƵŵƉƐƚŽĂĚĞƋƵĂƚĞůLJŵĞĂƐƵƌĞƚƵďŝŶŐ ĂŶĚĐĂƐŝŶŐƉƌĞƐƐƵƌĞƐ͘ ϵ͘Ϳ WůĂĐĞƉƌĞƐƐƵƌĞŐĂƵŐĞƐƵƉƐƚƌĞĂŵĂŶĚĚŽǁŶƐƚƌĞĂŵŽĨĂŶLJĐŚĞĐŬǀĂůǀĞƐ͘ ϭϬ͘Ϳ tĞůůƐŝƚĞDĂŶĂŐĞƌƐŚĂůůǁĂůŬĚŽǁŶǀĂůǀĞĂůŝŐŶŵĞŶƚƐĂŶĚĞŶƐƵƌĞǀĂůǀĞƉŽƐŝƚŝŽŶŝƐĐŽƌƌĞĐƚ͘ ϭϭ͘Ϳ ŶƐƵƌĞƉŽƌƚĂďůĞϰͲŐĂƐĚĞƚĞĐƚŝŽŶĞƋƵŝƉŵĞŶƚŝƐŽŶƐŝƚĞ͕ĐĂůŝďƌĂƚĞĚ͕ĂŶĚďƵŵƉƚĞƐƚĞĚƉƌŽƉĞƌůLJƚŽ ĚĞƚĞĐƚ>>ͬ,Ϯ^ͬKϮͬKϮůĞǀĞůƐ͘ŶƐƵƌĞEŝƚƌŽŐĞŶǀĞŶĚŽƌŚĂƐĂǁŽƌŬŝŶŐĂŶĚĐĂůŝďƌĂƚĞĚĚĞƚĞĐƚŽƌĂƐ ǁĞůůƚŚĂƚŵĞĂƐƵƌĞƐKϮůĞǀĞůƐ͘ ϭϮ͘Ϳ WƌĞƐƐƵƌĞƚĞƐƚůŝŶĞƐƵƉƐƚƌĞĂŵŽĨǁĞůůƚŽĂƉƉƌŽǀĞĚƐƵŶĚƌLJƉƌĞƐƐƵƌĞŽƌDW^W;DĂdžŝŵƵŵWŽƚĞŶƚŝĂů ^ƵƌĨĂĐĞWƌĞƐƐƵƌĞͿ͕ǁŚŝĐŚĞǀĞƌŝƐŚŝŐŚĞƌ͘dĞƐƚůŝŶĞƐĚŽǁŶƐƚƌĞĂŵŽĨǁĞůů;ĨƌŽŵǁĞůůƚŽƌĞƚƵƌŶƐƚĂŶŬͿ ƚŽϭ͕ϱϬϬƉƐŝ͘WĞƌĨŽƌŵǀŝƐƵĂůŝŶƐƉĞĐƚŝŽŶĨŽƌĂŶLJůĞĂŬƐ͘ ϭϯ͘Ϳ ůĞĞĚŽĨĨƚĞƐƚƉƌĞƐƐƵƌĞĂŶĚƉƌĞƉĂƌĞĨŽƌƉƵŵƉŝŶŐŶŝƚƌŽŐĞŶ͘ ϭϰ͘Ϳ WƵŵƉŶŝƚƌŽŐĞŶĂƚĚĞƐŝƌĞĚƌĂƚĞ͕ŵŽŶŝƚŽƌŝŶŐƌĂƚĞ;^&DͿĂŶĚƉƌĞƐƐƵƌĞ;W^/Ϳ͘ůůŶŝƚƌŽŐĞŶƌĞƚƵƌŶƐ ĂƌĞƚŽďĞƌŽƵƚĞĚƚŽƚŚĞƌĞƚƵƌŶƐƚĂŶŬ͘ ϭϱ͘Ϳ tŚĞŶĨŝŶĂůŶŝƚƌŽŐĞŶǀŽůƵŵĞŚĂƐďĞĞŶĂĐŚŝĞǀĞĚ͕ŝƐŽůĂƚĞǁĞůůĨƌŽŵEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚĂŶĚ ďůĞĞĚĚŽǁŶůŝŶĞƐďĞƚǁĞĞŶǁĞůůĂŶĚEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚ͘ ϭϲ͘Ϳ KŶĐĞLJŽƵŚĂǀĞĐŽŶĨŝƌŵĞĚůŝŶĞƐĂƌĞďůĞĚĚŽǁŶ͕ŶŽƚƌĂƉƉĞĚƉƌĞƐƐƵƌĞĞdžŝƐƚƐ͕ĂŶĚŶŽŶŝƚƌŽŐĞŶŚĂƐ ĂĐĐƵŵƵůĂƚĞĚďĞŐŝŶƌŝŐĚŽǁŶŽĨůŝŶĞƐĨƌŽŵƚŚĞEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚ͘ ϭϳ͘Ϳ &ŝŶĂůŝnjĞũŽďůŽŐĂŶĚĚŝƐĐƵƐƐŽƉĞƌĂƚŝŽŶƐǁŝƚŚtĞůůƐŝƚĞDĂŶĂŐĞƌ͘ŽĐƵŵĞŶƚĂŶLJůĞƐƐŽŶƐůĞĂƌŶĞĚ ĂŶĚĐŽŶĨŝƌŵĨŝŶĂůƌĂƚĞƐͬƉƌĞƐƐƵƌĞͬǀŽůƵŵĞƐŽĨƚŚĞũŽďĂŶĚƌĞŵĂŝŶŝŶŐŶŝƚƌŽŐĞŶŝŶƚŚĞƚƌĂŶƐƉŽƌƚ͘ ϭϴ͘Ϳ ZDKEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚĂŶĚ>ŝƋƵŝĚEŝƚƌŽŐĞŶdƌĂŶƐƉŽƌƚ͘ CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. CAUTION: External sender. DO NOT open links or attachments from UNKNOWN senders. From: Regg, James B (OGC) <jim.regg@alaska.gov> Sent: Monday, September 12, 2022 10:32 AM To: Jay Murphy - (C) <Jay.Murphy@hilcorp.com> Cc: McLellan, Bryan J (OGC) <bryan.mclellan@alaska.gov> Subject: [EXTERNAL] RE: Incident on Rig 169 When I read the initial note (9/10) is sounds like the incident happened, the rig proceeded with milling ops then pulled to replace rams. Doesn’t make sense. I am confused about the sequence of events and would appreciate a summary timeline. Thank you. Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 From: Jay Murphy - (C) <Jay.Murphy@hilcorp.com> Sent: Sunday, September 11, 2022 5:48 AM To: Regg, James B (OGC) <jim.regg@alaska.gov> Subject: FW: Incident on Rig 169 Jim, After going through all of the statements and discussing with the crew the plan was to level the sub base. The driller was the only one on the floor and he removed the sign from the brake handle of the BOPE being closed and screwed into the testing assembly with the top drive. He pulled to release the slips and kept pulling until the incident happened. When we got out of the hole we installed the 4- 1/2” Fixed rams, which did not test to begin with, Then we tried the VBRs that we had gotten from Yellowjacket and they would not test. We then re-inserted the 4-1/2” fixed rams again as they had new elements and did perform a successful 300/ 4000 psi. pressure test and would be happy to send you the chart if needed.. Thank You and Best Regards, Jay Murphy/ DSM Hilcorp Alaska, LLC HAK Rig 169 Office: 907-283-1369 Cell: 907-715-9211 Jay.Murphy@Hilcorp.com From: Jay Murphy - (C) Sent: Saturday, September 10, 2022 11:14 AM To: jim.regg@alaska.gov Subject: Incident on Rig 169 Jim, At 10:00am our driller pulled into the upper pipe rams and pulled 40K over into the VBRs. I have made notifications and wanted to keep you in the loop. We had just finished our LOT and I was in the office informing the Engineer of the results when I was notified. The crew shimmed the sub. Then the driller pulled into the UPRs. We completed milling the window and 20’ of new formation. Right now we have the lower 4-1/2” fixed rams closed and are opening the upper ram doors to ensure that there is no debris in the configuration. We will be POOH F/ 6645’ with our milling assembly and laying it down and we will replace the rams and retest the upper pipe rams 250/ 4000psi. Thank You and Best Regards, Jay Murphy/ DSM Hilcorp Alaska, LLC HAK Rig 169 Office: 907-283-1369 Cell: 907-715-9211 Jay.Murphy@Hilcorp.com The information contained in this email message is confidential and may be legally privileged and is intended only for the use of theindividual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. Alaska Oil and Gas Conservation Commission 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov 0RQW\0\HUV 'ULOOLQJ0DQDJHU +LOFRUS$ODVND//& &HQWHUSRLQW'ULYH6XLWH $QFKRUDJH$.  5H &DQQHU\/RRS8QLW8SSHU7\RQHN*37\RQHN' *3%HOXJD*3$-63% +LOFRUS$ODVND//& 3HUPLWWR'ULOO1XPEHU 6XUIDFH/RFDWLRQ¶)6/¶)(/6HF715:60$. %RWWRPKROH/RFDWLRQ¶)1/¶)(/6HF715:60$. 'HDU0U0\HUV (QFORVHGLVWKHDSSURYHGDSSOLFDWLRQIRUWKHSHUPLWWRGULOOWKHDERYHUHIHUHQFHGZHOO 3HU6WDWXWH$6 G  % DQG5HJXODWLRQ$$&FRPSRVLWHFXUYHVIRUDOOZHOO ORJVUXQPXVWEHVXEPLWWHGWRWKH$2*&&ZLWKLQGD\VDIWHUFRPSOHWLRQVXVSHQVLRQRU DEDQGRQPHQWRIWKLVZHOORUZLWKLQGD\VRIDFTXLVLWLRQRIWKHGDWDZKLFKHYHURFFXUVILUVW 7KLV SHUPLW WR GULOO GRHV QRW H[HPSW \RX IURP REWDLQLQJ DGGLWLRQDO SHUPLWV RU DQ DSSURYDO UHTXLUHGE\ODZIURPRWKHUJRYHUQPHQWDODJHQFLHVDQGGRHVQRWDXWKRUL]HFRQGXFWLQJGULOOLQJ RSHUDWLRQV XQWLO DOO RWKHU UHTXLUHG SHUPLWV DQG DSSURYDOV KDYHEHHQ LVVXHG  ,Q DGGLWLRQ WKH $2*&&UHVHUYHVWKHULJKWWRZLWKGUDZWKHSHUPLWLQWKHHYHQWLWZDVHUURQHRXVO\LVVXHG 2SHUDWLRQVPXVWEHFRQGXFWHGLQDFFRUGDQFHZLWK$6DQG7LWOH&KDSWHURIWKH $ODVND$GPLQLVWUDWLYH&RGHXQOHVVWKH$2*&&VSHFLILFDOO\DXWKRUL]HVDYDULDQFH)DLOXUHWR FRPSO\ ZLWK DQ DSSOLFDEOH SURYLVLRQ RI $6  7LWOH  &KDSWHU  RI WKH $ODVND $GPLQLVWUDWLYH&RGHRU DQ$2*&&RUGHU RU WKH WHUPV DQG FRQGLWLRQV RI WKLV SHUPLW PD\ UHVXOWLQWKHUHYRFDWLRQRUVXVSHQVLRQRIWKHSHUPLW 6LQFHUHO\ -HVVLH/&KPLHORZVNL &RPPLVVLRQHU '$7('WKLVBBBGD\RI$XJXVW Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2022.08.04 09:04:00 -08'00' 11 SFD 8/582022 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. From:Davies, Stephen F (OGC) To:Carlisle, Samantha J (OGC); Guhl, Meredith D (OGC) Subject:FW: [EXTERNAL] RE: CLU 05 RD2 (PTD 222-092) - Landownership Question Date:Tuesday, August 2, 2022 6:34:02 PM Sam, Meredith: Please file the email below with the CLU 5RD2 Permit to Drill application. Thanks and be well, Steve CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Steve Davies at 907-793-1224 or steve.davies@alaska.gov. From: Cody Terrell <cterrell@hilcorp.com> Sent: Thursday, July 21, 2022 8:53 PM To: Davies, Stephen F (OGC) <steve.davies@alaska.gov> Cc: Boyer, David L (OGC) <david.boyer2@alaska.gov> Subject: Re: [EXTERNAL] RE: CLU 05 RD2 (PTD 222-092) - Landownership Question Steve, This is correct. Hilcorp has 100% of the subsurface leased and 100% working interest owned by Hilcorp. Regards, Cody T. Terrell Landman Hilcorp Alaska,LLC Cell: 713-870-4532 Office: 907-777-8432 From: Davies, Stephen F (OGC) <steve.davies@alaska.gov> Sent: Wednesday, July 20, 2022 7:35:40 AM To: Cody Terrell <cterrell@hilcorp.com> Cc: Boyer, David L (OGC) <david.boyer2@alaska.gov> Subject: [EXTERNAL] RE: CLU 05 RD2 (PTD 222-092) - Landownership Question Cody, From the records I have access to, here is what I’ve found regarding CLU 5 RD2: Surface location in Hilcorp fee lease (formerly ADL 060569); wellbore passes thru private fee lease in which Hilcorp owns 100% working interest; top productive interval and TD lie in ADL 324602. Is this an accurate statement? Thanks for your help and stay safe, Steve Davies AOGCC CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Steve Davies at 907-793-1224 or steve.davies@alaska.gov. From: Davies, Stephen F (OGC) Sent: Tuesday, July 19, 2022 8:33 AM To: Cody Terrell (cterrell@hilcorp.com) <cterrell@hilcorp.com> Cc: Boyer, David L (OGC) <david.boyer2@alaska.gov> Subject: CLU 05 RD2 (PTD 222-092) - Landownership Question Hi Cody, Landownership in the CLU area is quite complex, so could you please clarify landownership along the CLU 5RD2 well path for me? As I understand it, the surface location lies in the southeast portion of Section 7 , which is a former state lease (ADL 60659) now owned 100% by Hilcorp, and the portion of the well that will lie beneath the Kenai River lies within current state lease ADL 324602 that is also owned by Hilcorp. Who is the landowner for the onshore portion of the SW1/4SW1/4 of Section 8 that is crossed by CLU 05RD2 (the portion labeled as CWC Fisheries Inc)? If this is private land, is this leased by Hilcorp? Thanks for your help and stay safe, Steve Davies AOGCC CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Steve Davies at 907-793-1224 or steve.davies@alaska.gov. The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and anyattachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. D7\SHRI:RUNE3URSRVHG:HOO&ODVV ([SORUDWRU\*DV 6HUYLFH:$* 6HUYLFH'LVS F6SHFLI\LIZHOOLVSURSRVHGIRU 'ULOO /DWHUDO 6WUDWLJUDSKLF7HVW 'HYHORSPHQW2LO 6HUYLFH:LQM 6LQJOH=RQH &RDOEHG*DV *DV+\GUDWHV 5HGULOO 5HHQWU\ ([SORUDWRU\2LO 'HYHORSPHQW*DV 6HUYLFH6XSSO\ 0XOWLSOH=RQH *HRWKHUPDO 6KDOH*DV 2SHUDWRU1DPH%RQG %ODQNHW 6LQJOH:HOO :HOO1DPHDQG1XPEHU %RQG1R $GGUHVV3URSRVHG'HSWK )LHOG3RRO V  0'  79'  D/RFDWLRQRI:HOO *RYHUQPHQWDO6HFWLRQ 3URSHUW\'HVLJQDWLRQ 6XUIDFH 7RSRI3URGXFWLYH+RUL]RQ'15$SSURYDO1XPEHU $SSUR[LPDWH6SXG'DWH 7RWDO'HSWK $FUHVLQ3URSHUW\ 'LVWDQFHWR1HDUHVW3URSHUW\ E/RFDWLRQRI:HOO 6WDWH%DVH3ODQH&RRUGLQDWHV1$' .%(OHYDWLRQDERYH06/ IW   'LVWDQFHWR1HDUHVW:HOO2SHQ 6XUIDFH[\ =RQH  WR6DPH3RRO  WR&/8 'HYLDWHGZHOOV.LFNRIIGHSWK  IHHW 0D[LPXP3RWHQWLDO3UHVVXUHVLQSVLJ VHH$$& 0D[LPXP+ROH$QJOH  GHJUHHV 'RZQKROH 6XUIDFH +ROH &DVLQJ :HLJKW *UDGH &RXSOLQJ /HQJWK 0' 79' 0' 79'    / ':&&      7LHEDFN   / ':&&  6XUI 6XUI   35(6(17:(//&21',7,216800$5< 7REHFRPSOHWHGIRU5HGULOODQG5H(QWU\2SHUDWLRQV -XQN PHDVXUHG  79'      +\GUDXOLF)UDFWXUHSODQQHG"<HV 1R $WWDFKPHQWV3URSHUW\3ODW %236NHWFK 'ULOOLQJ3URJUDP 7LPHY'HSWK3ORW 6KDOORZ+D]DUG$QDO\VLV 'LYHUWHU6NHWFK 6HDEHG5HSRUW 'ULOOLQJ)OXLG3URJUDP $$&UHTXLUHPHQWV &RQWDFW1DPH &RQWDFW(PDLO &RQWDFW3KRQH 'DWH 3HUPLWWR'ULOO $3,1XPEHU 3HUPLW$SSURYDO 1XPEHU'DWH &RQGLWLRQVRIDSSURYDO ,IER[LVFKHFNHGZHOOPD\QRWEHXVHGWRH[SORUHIRUWHVWRUSURGXFHFRDOEHGPHWKDQHJDVK\GUDWHVRUJDVFRQWDLQHGLQVKDOHV 6DPSOHVUHT G<HV1R 0XGORJUHT G<HV1R +6PHDVXUHV<HV1R 'LUHFWLRQDOVY\UHT G<HV1R 6SDFLQJH[FHSWLRQUHT G<HV1R ,QFOLQDWLRQRQO\VY\UHT G<HV1R 3RVWLQLWLDOLQMHFWLRQ0,7UHT G<HV1R $33529('%< $SSURYHGE\ &200,66,21(5 7+(&200,66,21 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ &/85' &DQQHU\/RRS8QLW &HPHQW4XDQWLW\FIRUVDFNV &RPPLVVLRQ8VH2QO\ 6HHFRYHUOHWWHUIRURWKHU UHTXLUHPHQWV   IW    7RWDO'HSWK0' IW 7RWDO'HSWK79' IW   67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 3(50,772'5,// $$&   )1/ )(/6HF715:60$.  )1/ )(/6HF715:60$. /2&, &HQWHUSRLQW'ULYH6XLWH$QFKRUDJH$. +LOFRUS$ODVND//&  )6/ )(/6HF715:60$.$'/$'/  &DVLQJ3URJUDP7RS6HWWLQJ'HSWK%RWWRP6SHFLILFDWLRQV  */%)(OHYDWLRQDERYH06/ IW  &HPHQW9ROXPH 0'6L]H 3OXJV PHDVXUHG  LQFOXGLQJVWDJHGDWD IW 7LHEDFN$VV\ (IIHFW'HSWK0' IW (IIHFW'HSWK79' IW  /HQJWK&DVLQJ &RQGXFWRU6WUXFWXUDO  $XWKRUL]HG7LWOH $XWKRUL]HG6LJQDWXUH  $XWKRUL]HG1DPH 'ULOOLQJ0DQDJHU 0RQW\0\HUV ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEH GHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO 6XUIDFH 3HUIRUDWLRQ'HSWK79' IW 3HUIRUDWLRQ'HSWK0' IW   IW IW /LQHU /LQHU    ,QWHUPHGLDWH   'ULYHQ   IW    8SSHU7\RQHN*37\RQHN'*3 %HOXJD*3   WRQHDUHVWXQLWERXQGDU\ 6HDQ0FODXJKOLQ VHDQPFODXJKOLQ#KLOFRUSFRP V1 \S / 5 6 RV1 V1R V1 R 'V V V  '   R  VS *    6 6  6 V1RV1R 6 * ( V1R V )RUP5HYLVHG7KLVSHUPLWLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDOSHU$$& J  7.14.2022 By Samantha Carlisle at 8:45 am, Jul 15, 2022 'LJLWDOO\VLJQHGE\0RQW\00\HUV '1FQ 0RQW\00\HUVF 86 R +LOFRUS$ODVND//&RX 7HFKQLFDO 6HUYLFHV$.'ULOOLQJ HPDLO PP\HUV#KLOFRUSFRP 5HDVRQ,DPDSSURYLQJWKLVGRFXPHQW 'DWH  0RQW\0 0\HUV '65   6)'   )6/ )(/6)' 5HSRUW ),7/27 UHVXOWV WR $2*&& ZLWKLQ  KUV RI SHUIRUPLQJ WHVW DQG REWDLQ DSSURYDO EHIRUH GULOOLQJ DKHDG 0D[ 7' ZLOO EH GHWHUPLQHG EDVHG RQ /27 UHVXOWV %-0  6)' %23 WHVW WR  SVL $QQXODU WHVW WR  SVL 3URYLGH  KUV QRWLFH IRU $2*&& RSSRUXQLW\ WR ZLWQHVV 0,7,$ WR  SVL GWV   Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2022.08.04 09:04:15 -08'00' 11 SFD 8/5/2022                  &/85' 'ULOOLQJ3URJUDP'UDIW   &DQQHU\/RRS8QLW          5HY$ -XO\        &RQWHQWV :HOO6XPPDU\ 0DQDJHPHQWRI&KDQJH,QIRUPDWLRQ 7XEXODU3URJUDP 'ULOO3LSH,QIRUPDWLRQ ,QWHUQDO5HSRUWLQJ5HTXLUHPHQWV &XUUHQW:HOOERUH6FKHPDWLF 3UH6LGHWUDFN6FKHPDWLF 3URSRVHG:HOOERUH6FKHPDWLF 'ULOOLQJ&RPSOHWLRQ6XPPDU\ 0DQGDWRU\5HJXODWRU\&RPSOLDQFH1RWLILFDWLRQV 58DQG3UHSDUDWRU\:RUN %2318DQG7HVW 6HW:KLSVWRFN 'ULOO´+ROH6HFWLRQ 5XQ´3URGXFWLRQ/LQHU &HPHQW´3URGXFWLRQ/LQHU ´7LHEDFN5XQ 5'02 'ULOOLQJ%23(6FKHPDWLF :HOOKHDG6FKHPDWLF $QWLFLSDWHG'ULOOLQJ+D]DUGV +LOFRUS5LJ/D\RXW ),7/273URFHGXUH &KRNH0DQLIROG6FKHPDWLF &DVLQJ'HVLJQ,QIRUPDWLRQ ´+ROH6HFWLRQ0$63 6SLGHU3ORW *RYHUQPHQWDO6HFWLRQV  ¶5DGLXVIRU6669 'LUHFWLRQDO3URJUDP ZS $WWDFKHG     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A  :HOO6XPPDU\   :HOO&/85' 'ULOOLQJ5LJ5LJ 3DG 2OG:HOO'HVLJQDWLRQ&DQQHU\/RRS3DG&/85' 37'  3ODQQHG&RPSOHWLRQ7\SH´0RQRERUH 7DUJHW5HVHUYRLU V %HOXJDDQG7\RQHN*DV6DQGV .LFNRISRLQW¶0'¶79' 3ODQQHG:HOO7'0'79'¶0'¶79' 3%7'0'¶0' ¶VKRH  6XUIDFH/RFDWLRQ *RYHUQPHQWDO  )6/ )(/6HF715:60$. 6XUIDFH/RFDWLRQ 1$' ; <  6XUIDFH/RFDWLRQ 1$'  7RSRI3URGXFWLYH+RUL]RQ *RYHUQPHQWDO  )1/ )(/6HF715:60$. 73+/RFDWLRQ 1$' ; <  73+/RFDWLRQ 1$'  %+/ *RYHUQPHQWDO  )1/ )(/6HF715:60$. %+/ 1$' ; <  %+/ 1$'  $)(1XPEHU $)('D\V $)($PRXQW 0D[LPXP$QWLFLSDWHG3UHVVXUH 6XUIDFH SVL 0D[LPXP$QWLFLSDWHG3UHVVXUH 'RZQKROH5HVHUYRLU SVL :RUN6WULQJ´6&'6 5.%¶ *URXQG(OHYDWLRQ¶ %23(TXLSPHQW´0$QQXODU%23 ´0'RXEOH5DP ´06LQJOH5DP ; <6)'  )6/ )(/6)' 11 SFD 8/5/2022    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 0DQDJHPHQWRI&KDQJH,QIRUPDWLRQ     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 7XEXODU3URJUDP  +ROH 6HFWLRQ 2' LQ  ,' LQ 'ULIW LQ  &RQQ 2' LQ  :W IW  *UDGH&RQQ%XUVW SVL  &ROODSVH SVL  7HQVLRQ NOEV  ´´´´´/':&&+7   0LQLPXPRI¶RYHUODSUHTXLUHGEHWZHHQFDVLQJVWULQJV  'ULOO3LSH,QIRUPDWLRQ  +ROH 6HFWLRQ 2' LQ  ,' LQ 7-,' LQ  7-2' LQ  :W IW  *UDGH&RQQ%XUVW SVL  &ROODSVH SVL  7HQVLRQ NOEV  $OO´´´6&'6N         3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A ,QWHUQDO5HSRUWLQJ5HTXLUHPHQWV  )LOORXWGDLO\GULOOLQJUHSRUWDQGFRVWUHSRUWRQ:HOOH] x5HSRUWFRYHUVRSHUDWLRQVIURPDPWRDP x&OLFNRQRQHRIWKHWDEVDWWKHWRSWRVDYHGDWDHQWHUHG,IFOLFNLQJRQRQHRIWKHWDEVWRWKHOHIWRI WKHGDWDHQWU\DUHD±WKLVZLOOQRWVDYHWKHGDWDHQWHUHGDQGZLOOQDYLJDWHWRDQRWKHUGDWDHQWU\ WDE x(QVXUHWLPHHQWU\DGGVXSWRKRXUVWRWDO x7U\WRFDSWXUHDQ\RXWRIVFRSHZRUNDV1377KLVKHOSVODWHUZLWKHQGRIZHOOUHSRUWV $IWHUQRRQ8SGDWHV x6XEPLWDVKRUWRSHUDWLRQVXSGDWHHDFKZRUNGD\WRPP\HUV#KLOFRUSFRP VHDQPFODXJKOLQ#KLOFRUSFRPDQGFGLQJHU#KLOFRUSFRP ,QWUDQHW+RPH3DJH0RUQLQJ8SGDWH x6XEPLWDVKRUWRSHUDWLRQVXSGDWHHDFKPRUQLQJE\DPRQWKHFRPSDQ\LQWUDQHWKRPHSDJH2Q ZHHNHQGDQGKROLGD\VHQVXUHWRKDYHWKLVXSGDWHLQEHIRUHDP(DFKULJZLOOEHDVVLJQHGD XVHUQDPHWRORJLQZLWK (+6,QFLGHQW5HSRUWLQJ x1RWLI\(+6ILHOGFRRUGLQDWRU 7KLVFRXOGEHRQHRI  LQGLYLGXDOVDVWKH\URWDWHDURXQG.QRZZKR\RXU(+6ILHOG FRRUGLQDWRULVDWDOOWLPHVGRQ¶WZDLWXQWLODQHPHUJHQF\WRKDYHWRFDOODURXQGDQGILJXUH LWRXW D-RKQ&RVWRQ2  &   E-DFRE1RUGZDOO2  &   6SLOOV.HHJDQ)OHPLQJ2& x1RWLI\'UOJ0DQDJHU 0RQW\00\HUV2& x6XEPLW+LOFRUS,QFLGHQWUHSRUWWRFRQWDFWVDERYHZLWKLQKUV &DVLQJ7DOO\ x6HQGILQDO³$V5XQ´&DVLQJWDOO\WRVHDQPFODXJKOLQ#KLOFRUSFRPDQGFGLQJHU#KLOFRUSFRP &DVLQJDQG&PWUHSRUW x6HQGFDVLQJDQGFHPHQWUHSRUWIRUHDFKVWULQJRIFDVLQJWRVHDQPFODXJKOLQ#KLOFRUSFRPDQG FGLQJHU#KLOFRUSFRP             3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A &XUUHQW:HOOERUH6FKHPDWLF      3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 3UH6LGHWUDFN6FKHPDWLF     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 3URSRVHG:HOOERUH6FKHPDWLF      3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 'ULOOLQJ&RPSOHWLRQ6XPPDU\  &/85'LVDVLGHWUDFNGHYHORSPHQWZHOOWREHGULOOHGIURP&DQQHU\/RRS3DG7KLVZHOOZLOOEH WDUJHWLQJ%HOXJDDQG7\RQHNVDQGVIRUJDVSURGXFWLRQ  7KHEDVHSODQLVDGLUHFWLRQDOZHOOERUHVLGHWUDFNLQJIURPWKHSDUHQWZHOODWa¶0'0D[LPXPKROH DQJOHZLOOEHƒDQG7'RIWKHZHOOZLOOEHa¶0'¶79''ULOOLQJRSHUDWLRQVDUHH[SHFWHG WRFRPPHQFHDSSUR[LPDWHO\$XJXVW7KH+LOFRUS5LJZLOOEHXVHGWRGHFRPSOHWHDQGSOXJWKH SDUHQWZHOO5LJZLOOWKHQGULOOUXQOLQHUFHPHQWDQGFRPSOHWH  $OOZDVWH PXGJHQHUDWHGGXULQJGULOOLQJDQGFRPSOHWLRQRSHUDWLRQVZLOOEHKDXOHGWRWKH.HQDL*DV)LHOG * ,IDFLOLW\IRUGLVSRVDOEHQHILFLDOUHXVHGHSHQGLQJRQWHVWUHVXOWV  6XQGU\¶VZLOOEHVXEPLWWHGWRFRYHUSUHULJSOXJJLQJDQGSRVWULJZRUN  *HQHUDO3UH5LJRSHUDWLRQV &DVLQJWHVWWRSVL 3XOO´WXELQJ 3OXJRSHQSHUIRUDWLRQV 7HVWFDVLQJWRSVL  *HQHUDOVHTXHQFHRI5LJRSHUDWLRQV 02%+LOFRUS5LJWRZHOOVLWH 1'WUHH18 WHVW´[0%23WRSVL 38DQG5,+ZLWKZKLSVWRFNZLQGRZPLOOLQJDVV\2ULHQWDQGVHWDWa¶0' 0LOO´ZLQGRZDQG¶RIQHZIRUPDWLRQ'LVSODFHWRGULOOLQJPXGDQGSHUIRUP),7 'ULOO´KROHVHFWLRQWR¶0'3HUIRUP:LSHUWULS 5XQDQGFPW´OLQHU 5XQ´WLHEDFN 1'%2318GU\KROHWUHH5'02        0DQGDWRU\5HJXODWRU\&RPSOLDQFH1RWLILFDWLRQV  5HJXODWRU\&RPSOLDQFH 3DJH9HUVLRQ-XO\ CLU-05RD2 Drilling Procedure Rev A (QVXUHWKDWRXUGULOOLQJDQGFRPSOHWLRQRSHUDWLRQVFRPSO\ZLWKWKHEHORZ$2*&&,IDGGLWLRQDOFODULW\ RUJXLGDQFHLVUHTXLUHGRQKRZWRFRPSO\ZLWKDVSHFLILFUHJXODWLRQGRQRWKHVLWDWHWRFRQWDFWWKH $QFKRUDJH'ULOOLQJ7HDP x %23VVKDOOEHWHVWHGDW  ZHHNLQWHUYDOV(QVXUHWRSURYLGH$2*&&KUVQRWLFHSULRUWRWHVWLQJ %23( x 7KH%23HTXLSPHQWIRUWKH3URGXFWLRQVHFWLRQZLOOEHWHVWHGWRSVLIRUPLQ DQQXODUWR UDWHG:3SVLRQDOOWHVWV Confirm that these test pressures match those specified on the PTD/APD. o 7KHKLJKHVWUHVHUYRLUSUHVVXUHH[SHFWHGLVSVLLQWKH7\RQHNVDQGDW7' o 0$63ZLOOEHJRYHUQHGE\IUDFWXUHSUHVVXUHDWWKHVKRH7KH)3LQRIIVHWZHOOVUDQJHEHWZHHQ $/27ZRXOGHTXDWHWRSVL0$63ZLWKDIXOOFROXPQRIJDVWRWKH VKRH x 5HTXLUHG5DWHG:RUNLQJ3UHVVXUHWKH%23(DQGZHOOKHDGPXVWPHHWRUH[FHHGSVL x If the BOP is used to shut in on the well in a well control situation, we must test all BOP components utilized for well control prior to the next trip into the wellbore. This pressure test will be charted same as the 14 day BOP test. x $OO$2*&&UHJXODWLRQVZLWKLQ$$&³3ULPDU\ZHOOFRQWUROIRUGULOOLQJGULOOLQJIOXLG SURJUDPDQGGULOOLQJIOXLGV\VWHP´ x $OO$2*&&UHJXODWLRQVZLWKLQ$$&³6HFRQGDU\ZHOOFRQWUROIRUSULPDU\GULOOLQJDQG FRPSOHWLRQEORZRXWSUHYHQWLRQHTXLSPHQWDQGGLYHUWHUUHTXLUHPHQWV´ x (QVXUH$2*&&DSSURYHGGULOOLQJSHUPLWVDUHSRVWHGRQWKHULJIORRUDQGLQ&R0DQRIILFH 6XPPDU\RI%23(TXLSPHQWDQG7HVW5HTXLUHPHQWV +ROH6HFWLRQ(TXLSPHQW 7HVW3UHVVXUH SVL  ´ x ´[0$QQXODU%23 x ´[0'RXEOH5DP o %OLQGUDPLQEWPFDYLW\ x 0XGFURVV x ´[06LQJOH5DP x ´0&KRNH/LQH x ´[0.LOOOLQH x ´[´0&KRNHPDQLIROG x 6WDQGSLSHIORRUYDOYHVHWF ,QLWLDO7HVW $QQXODUSVL  6XEVHTXHQW7HVWV  $QQXODUSVL  x 3ULPDU\FORVLQJXQLW&RQWURO7HFKQRORJLHVDFFXPXODWRUXQLWVWDWLRQJDOORQ [JDO ERWWOHV  x 3ULPDU\FORVLQJK\GUDXOLFSUHVVXUHLVSURYLGHGE\DQHOHFWULFDOO\GULYHQWULSOH[SXPS(PHUJHQF\ SUHVVXUHLVSURYLGHGE\ERWWOHGQLWURJHQ 0$63ZLOOEHJRYHUQHGE\IUDFWXUHSUHVVXUHDWWKHVKRH7KH)3LQRIIVHWZHOOVUDQJHEHWZHHQ  KLJKHVWUHVHUYRLUSUHVVXUHH[SHFWHGLVSVLLQWKH7\RQHNVDQGDW7'JSSS\  SVL  EMP    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 5HTXLUHG$2*&&1RWLILFDWLRQV x:HOOFRQWUROHYHQW %23VXWLOL]HGWRVKXWLQWKHZHOOWRFRQWUROLQIOX[RIIRUPDWLRQIOXLGV  xKRXUVQRWLFHSULRUWRIXOO%23(WHVWV x$Q\RWKHUQRWLILFDWLRQVUHTXLUHGLQ$3' Additional requirements may be stipulated on APD and Sundry.  5HJXODWRU\&RQWDFW,QIRUPDWLRQ  $2*&& -LP5HJJ$2*&&,QVSHFWRU 2 (PDLOMLPUHJJ#DODVNDJRY %U\DQ0F/HOODQ3HWUROHXP(QJLQHHU 2 (PDLOEU\DQPFOHOODQ#DODVNDJRY 0HOYLQ5L[VH3HWUROHXP(QJLQHHU 2 (PDLOPHOYLQUL[VH#DODVNDJRY 3ULPDU\&RQWDFWIRU2SSRUWXQLW\WRZLWQHVV$2*&&,QVSHFWRUV#DODVNDJRY 7HVW,QVSHFWLRQQRWLILFDWLRQVWDQGDUGL]DWLRQIRUPDWKWWSGRDDODVNDJRYRJFIRUPV7HVW:LWQHVV1RWLIKWPO 1RWLILFDWLRQ(PHUJHQF\3KRQH 'XULQJQRUPDO%XVLQHVV+RXUV  1RWLILFDWLRQ(PHUJHQF\3KRQH 2XWVLGHQRUPDO%XVLQHVV+RXUV   58DQG3UHSDUDWRU\:RUN  /HYHOSDGDQGHQVXUHHQRXJKURRPIRUOD\RXWRIULJIRRWSULQWDQG58  /D\RXW+HUFXOLWHRQSDGWRH[WHQGEH\RQGIRRWSULQWRIULJ  58+LOFRUS5LJVSRWVHUYLFHFRPSDQ\VKDFNVVSRW 58FRPSDQ\PDQ WRROSXVKHU RIILFHV  $IWHUULJHTXLSPHQWKDVEHHQVSRWWHG58KDQGLEHUPFRQWDLQPHQWV\VWHPDURXQGIRRWSULQWRI ULJ  0L[PXGIRU´KROHVHFWLRQ  9HULI\´OLQHUVLQVWDOOHGLQPXGSXPSV x++)PXGSXPSVDUHUDWHGDWSVL  JSP  DWVWURNHV ZLWK´OLQHUV  %2318DQG7HVW  18´[0%23WR´0ZHOOKHDGDVIROORZV x7:& ´+ WREHUXQDVSDUWRIWKHSUHSZRUN    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A  x%23FRQILJXUDWLRQIURP7RSGRZQ´[0DQQXODU%23´[0GRXEOHUDP´[0 PXGFURVV´[0VLQJOHUDP x'RXEOHUDPVKRXOGEHGUHVVHGZLWK[´9%5VLQWRSFDYLW\EOLQGUDPLQEWPFDYLW\ x6LQJOHUDPVKRXOGEHGUHVVHGZLWK[´9%5V x18EHOOQLSSOHLQVWDOOIORZOLQH x,QVWDOO  PDQXDOYDOYHV   +&5YDOYHRQNLOOVLGHRIPXGFURVV x,QVWDOO  PDQXDOYDOYHRQFKRNHVLGHRIPXGFURVV,QVWDOODQ+&5RXWVLGHRIWKHPDQXDO YDOYH  7HVW%23( x7HVW%23WRSVLIRUPLQ7HVWDQQXODUWRSVLIRUPLQ x(QVXUHWROHDYH³$´VHFWLRQVLGHRXWOHWYDOYHVRSHQGXULQJ%23WHVWLQJVRSUHVVXUHGRHVQRW EXLOGXSEHQHDWKWKH7:&&RQILUPWKHFRUUHFWYDOYHVDUHRSHQHG x7HVW$QQXODURQ´WHVWMRLQW SVL  x7HVW9%5VRQ´ SVL  x(QVXUHJDVPRQLWRUVDUHFDOLEUDWHGDQGWHVWHGLQFRQMXQFWLRQZ%23(  5'%23WHVWDVV\  3XOO7:&  &RQWLQXHPL[LQJPXGIRU´KROHVHFWLRQ  5DFNEDFNDVPXFK´'3LQGHUULFNDVSRVVLEOHWREHXVHGZKLOHGULOOLQJWKHKROHVHFWLRQ   6HW:KLSVWRFN  6HWZHDUEXVKLQJ  0DNHXSPLOOVRQDMRLQWRI+:'3  5,+ VHWLQVOLSV  0DNHXSIORDWVXELQVWDOOIORDW0DNHXSGLUHFWLRQDOWRROVIRUZKLSVWRFNRULHQWDWLRQ  5,+VWDQGVDQGVKDOORZWHVW0:'WRROV322+OHDYLQJDVVHPEO\KDQJLQJLQWKHHOHYDWRUVDQG VWDQGEDFNRQIORRU     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A %ULQJ:KLSVWRFNWRULJIORRURQWKHSLSHVNDWH'RQRWVODPLQWRERWWRPRI:KLSVWRFNZLWKSLSH VNDWH  3LFNXS:KLSVWRFNSHU:,6UHSXVLQJWKH:KLSVWRFNKDQGOLQJV\VWHPXVLQJDLUKRLVW$OORZDVV\WR KDQJZKLOH5HSLQVSHFWVDQGUHPRYHVVKHDUVFUHZVDVQHHGHGDQGDQ\VDIHW\VFUHZV  Note: Confirm number of remaining shear screws with Rep before proceeding to make up mills to whipstock. Note: Confirm proper mill shear bolt with Rep before installing. 5XQWKH:KLSVWRFNLQWKHKROHLQVWDOOVDIHW\FODPSDVSHU5HSDQGLQVWDOOKROHFRYHUZUDS  5HOHDVHSLFNXSV\VWHPDWWKLVSRLQW0DNHXSPLOOV  :LWKWKHWRSGULYHSLFNWKHDVVHPEO\DQGSRVLWLRQWKHVWDUWLQJPLOOWRDOLJQZLWKWKHKROHLQWKHVOLGH 7KH5HSZLOOLQVWUXFWWKHGULOOHUZKHQWKHVORWLVOLQHGXSWKHVKHDUEROWWKHQFDQEHPDGHXSE\WKH 5HS  7KHDVVHPEO\FDQQRZEHSLFNHGXSWRHQVXUHWKDWWKHVKHDUEROWLVWLJKW  ,IQRWGRQH\HWVFULEHWRROVWRRULHQW0:'HTXLSPHQWWRZKLSVWRFNWUD\  5HPRYHWKHKDQGOLQJV\VWHP  6ORZO\UXQLQWKHKROHDVSHU5HS5XQH[WUHPHO\VORZWKURXJKWKH%23 ZHDUEXVKLQJ  5XQLQKROHDWòWRPLQXWHVSHUVWDQG  )LOOHYHU\VWDQGVRUDVQHHGHGGRQRWURWDWHRUZRUNWKHVWULQJXQQHFHVVDULO\  &DOOIRU5HS±VWDQGVEHIRUHJHWWLQJWRERWWRP  2ULHQWZKLSVWRFNaƒULJKWRIKLJKVLGHDWOHDVW¶DERYH72&  :LWKWKHERWWRPRIWKH:KLSVWRFN±¶DERYHWKH&,%3PHDVXUHDQGUHFRUG38DQG62 ZHLJKWV  2ULHQW:KLSVWRFNWRGHVLUHGGLUHFWLRQE\WXUQLQJ'3LQóURXQGLQFUHPHQWV38DQG62RQ'3WR ZRUNDOOWRUTXHRXW2ULHQWWKHZKLSVWRFNƒ5RIKLJKVLGH  2QFHZKLSVWRFNLVLQGHVLUHGRULHQWDWLRQVODFNRIIDQGWDJ72&WRVHW%RWWRP7ULS$QFKRU  6HWGRZQ.RQDQFKRUWRWULS38.PD[LPXPRYHUSXOOWRYHULI\DQFKRULVVHW7KHZLQGRZ PLOOFDQWKHQEHVKHDUHGRIIE\VODFNLQJRIIZHLJKWRQWKH:KLSVWRFNVKHDUEROW 3DJH9HUVLRQ-XO\ CLU-05RD2 Drilling Procedure Rev A  38¶DERYHWRSRI:KLSVWRFN  'LVSODFHWRSSJ.&O3+3$GULOOLQJIOXLG  5HFRUG3862ZHLJKWVDQGIUHHURWDWLRQ6ODFNRIIWRWRSRIZKLSVWRFNDQGZLWKOLJKWZHLJKWDQG ORZWRUTXH0LOOZLQGRZ8WLOL]HGLWFKPDJQHWVRQWKHVXUIDFHWRFDWFKPHWDOFXWWLQJV  ,QVWDOOFDWFKWUD\VLQVKDNHUXQGHUIORZFKXWHWRKHOSFDWFKLURQ  .HHSLURQLQVHSDUDWHEEOV5HFRUGZHLJKWRILURQUHFRYHUHGRQGLWFKPDJQHWV 'ULOODSSUR[¶UDWKROHWRDFFRPPRGDWHWKHGULOOLQJDVVHPEO\5HDPZLQGRZDVQHHGHGWRDVVXUH WKHUHLVOLWWOHRUQRGUDJ$IWHUUHDPLQJVKXWRIISXPSVDQGURWDU\ LIKROHFRQGLWLRQVDOORZ DQGSDVV WKURXJKZLQGRZFKHFNLQJIRUGUDJ  &%8DQGFRQGLWLRQPXGIRU/27  &RQGXFW/27 x ,IWKHNLFN]RQHLVDW¶79'DQG/27RISSJJLYHVDQEEO.79 x $VVXPLQJWKHNLFN]RQHLVDW7'DQ/27RISSJ(0:JLYHVD%%/.LFN7ROHUDQFH YROXPHZLWK SSJPXGZHLJKW x ,IDSSJ/27LVDFKLHYHGWKHZHOOFDQEHGULOOHGWRD79'RI¶ x $IWHUWKH/27VHQGUHVXOWVWRWKH'ULOOLQJ(QJLQHHU7KHUHVXOWZLOOLQIRUPZKDWGHSWKWKHZHOO ZLOOEHGULOOWR  322+DQG/'PLOOLQJDVVHPEO\ x 2QFHRXWRIWKHKROHLQVSHFWPLOOJDXJHDQGUHFRUG x )ORZFKHFNZHOOIRUPLQXWHVWRFRQILUPQRIORZ x %HIRUHSXOOLQJRIIERWWRP x %HIRUHSXOOLQJWKH%+$WKURXJKWKH%23(  )OXVKWKHVWDFNOLQHVWRUHPRYHPHWDOGHEULVWKDWPD\KDYHVHWWOHGRXWLQWKHVHDUHDV(QVXUH%23 HTXLSPHQWLVRSHUDEOH UHVXOWZLOOLQIRUPZKDWGHSWKWKHZHOO ZLOOEHGULOOWR'HSWK ZLOO EH GHWHUPLQHG XVLQJ PLQLPXP RI  EEO NLFN WROHUDQFH DVVXPLQJ NLFN LQWHQVLW\ RI  SSJ RYHU SURJQRVHG SRUH SUHVVXUHV  EMP DVVXPHV  SSJ 0:  SSJ NLFN EMP  SSJ 0:  SSJ SRUH SUHV UHVXOWV LQ  EEO .7  EMP    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 'ULOO´+ROH6HFWLRQ  'ULIWDQGFDOLSHUDOOFRPSRQHQWVEHIRUH089LVXDOO\YHULI\QRGHEULVLQVLGHFRPSRQHQWVWKDW FDQQRWEHGULIWHG  7,+DQGFRQGXFWVKDOORZKROHWHVWRI0:'WRFRQILUPDOO/:'IXQFWLRQLQJSURSHUO\  (QVXUH7)RIIVHWLVPHDVXUHGDFFXUDWHO\DQGHQWHUHGFRUUHFWO\LQWRWKH0:'VRIWZDUH  +DYH''UXQK\GUDXOLFVFDOFXODWLRQVRQVLWHWRHQVXUHRSWLPXPQR]]OHVL]LQJ  :RUNVWULQJZLOOEH´6&'6(QVXUHWRKDYHHQRXJK´'3LQGHUULFNWRGULOO WKHHQWLUHRSHQKROHVHFWLRQZLWKRXWKDYLQJWRSLFNXSSLSHIURPWKHSLSHVKHG  ´KROHVHFWLRQPXGSURJUDPVXPPDU\  :HLJKWLQJPDWHULDOWREHXVHGIRUWKHKROHVHFWLRQZLOOEHEDULWHVDOWDQGFDOFLXPFDUERQDWH $GGLWLRQDOFDOFLXPFDUERQDWHZLOOEHRQORFDWLRQWRZHLJKWXSWKHDFWLYHV\VWHP  SSJDERYH KLJKHVWDQWLFLSDWHG0:  3DVRQ397ZLOOEHXVHGWKURXJKRXWWKHGULOOLQJDQGFRPSOHWLRQSKDVH5HPRWHPRQLWRULQJ VWDWLRQVZLOOEHDYDLODEOHDWWKHGULOOHU¶VFRQVROH&R0DQRIILFH7RROSXVKHURIILFHDQGPXG ORJJHUVRIILFH   System Type: SSJ.&/3+3$IUHVKZDWHUEDVHGGULOOLQJIOXLG  Properties: 79'0XG :HLJKW9LVFRVLW\3ODVWLF 9LVFRVLW\<LHOG3RLQWS++3+7 .23¶±” ¶±¶±” ¶7'±” System Formulation: .&/(=0XG'3 3URGXFW&RQFHQWUDWLRQ :DWHU .&O &DXVWLF %$5$=$1' (=08''3 '(;75,'/7 3$&/ EEO SSE .FKORULGHV  SSE S+  SSE DVUHTXLUHG<3  SSE LQLWLDOO\SSE  SSE SSE    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A %$5$&$5% %$52,' $/'$&,'(* %$5$&25 %$5$6&$9' SSE SSERIHDFK  DVUHTXLUHGIRUD±SSJ SSE SSE SSE PDLQWDLQSHUGLOXWLRQUDWH   7,+Z´GLUHFWLRQDODVV\WR72&6KDOORZWHVW0:'DQG/:'RQWULSLQ1RWHGHSWK 72&WDJJHGRQ$0UHSRUW  'ULOO´KROHVHFWLRQWR¶0'¶79' x3XPSVZHHSVDQGPDLQWDLQPXGUKHRORJ\WRHQVXUHHIIHFWLYHKROHFOHDQLQJ x3XPSDWJSP(QVXUHVKDNHUVFUHHQVDUHVHWXSWRKDQGOHWKLVIORZUDWH x.HHSVZDEDQGVXUJHSUHVVXUHVORZZKHQWULSSLQJ x0DNHZLSHUWULSVHYHU\¶XQOHVVKROHFRQGLWLRQVGLFWDWHRWKHUZLVH x2QWKHWKLUGZLSHUWULS RUDVKROHFRQGLWLRQGLFWDWH WULSEDFNWRWKHZLQGRZ x(QVXUHVKDOHVKDNHUVDUHIXQFWLRQLQJSURSHUO\&KHFNIRUKROHVLQVFUHHQVRQFRQQHFWLRQV x$GMXVW0:DVQHFHVVDU\WRPDLQWDLQKROHVWDELOLW\.HHS+7+3IOXLGORVV x7DNH0:'VXUYH\VHYHU\¶GULOOHG6XUYH\VFDQEHWDNHQPRUHIUHTXHQWO\LIGHHPHG QHFHVVDU\  $W7'SXPSVZHHSV&%8DQGSXOODZLSHUWULSEDFNWRWKHZLQGRZ  72+ZLWKWKHGULOOLQJDVV\VWDQGLQJEDFNGULOOSLSH  /'%+$ 5XQ´3URGXFWLRQ/LQHU  58´FDVLQJUXQQLQJHTXLSPHQW x(QVXUH´':&&+7[&'6FURVVRYHURQULJIORRUDQG08WR)269 x58ILOOXSOLQHWRILOOOLQHUZKLOHUXQQLQJ x(QVXUHDOOOLQHUKDVEHHQGULIWHGSULRUWRUXQQLQJ x%HVXUHWRFRXQWWKHWRWDORIMRLQWVEHIRUHUXQQLQJ x.HHSKROHFRYHUHGZKLOH58FDVLQJWRROV x5HFRUG2'¶V,'¶VOHQJWKV61¶VRIDOOFRPSRQHQWVZYHQGRU PRGHOLQIR  38VKRHMRLQWYLVXDOO\YHULI\QRGHEULVLQVLGHMRLQW  &RQWLQXH08 WKUHDGORFNLQJVKRHWUDFNDVV\FRQVLVWLQJRI x  6KRHMRLQWZVKRHEXFNHGRQ WKUHDGORFNHG FRXSOLQJDOVRWKUHDGORFNHG  x  -RLQWZLWKIORDWFROODUEXFNHGRQSLQHQG WKUHDGORFNHG FRXSOLQJDOVRWKUHDGORFNHG  x  -RLQWZLWK%DNHUODQGLQJFROODUEXFNHGRQSLQHQG WKUHDGORFNHG    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A x6ROLGERG\FHQWUDOL]HUVZLOOEHSUHLQVWDOOHGRQVKRHMRLQWDQ)&MRLQW x/HDYHFHQWUDOL]HUVIUHHIORDWLQJVRWKDWWKH\FDQVOLGHXSDQGGRZQWKHMRLQW x(QVXUHSURSHURSHUDWLRQRIIORDWVKRHDQGIORDWFROODU x8WLOL]HDFROODUFODPSXQWLOZHLJKWLVVXIILFLHQWWRNHHSVOLSVVHWSURSHUO\  &RQWLQXHUXQQLQJ´SURGXFWLRQOLQHU x)LOOOLQHUZKLOHUXQQLQJXVLQJILOOXSOLQHRQULJIORRU x8VH³$3,0RGLILHG´WKUHDGFRPSRXQG'RSHSLQHQGRQO\ZSDLQWEUXVK x,QVWDOOFHQWUDOL]HUVRQHYHU\MRLQW&ODPVKHOOFHQWUDOL]HUVUHTXLUHGGXHWRXSVHWOLQHU x/HDYHWKHFHQWUDOL]HUVIUHHIORDWLQJ  5XQLQKROHZ´OLQHUWRWKH´ZLQGRZ  )LOOWKHOLQHUZLWKILOOXSOLQHDQGEUHDNFLUFXODWLRQHYHU\IHHWWRWKHVKRHRUDVWKHKROH GLFWDWHV  2EWDLQVODFNRIIZHLJKW38ZHLJKWURWDWLQJZHLJKWDQGWRUTXHRIWKHOLQHU  &LUFXODWH;ERWWRPVXSDWVKRHHDVHOLQHUWKUXVKRH  &RQWLQXHWR5,+ZOLQHUQRIDVWHUWKDQMWPLQXWH:DWFKGLVSODFHPHQWFDUHIXOO\DQGDYRLG VXUJLQJWKHKROH6ORZGRZQUXQQLQJVSHHGLIQHFHVVDU\  6HWOLQHUVORZO\LQDQGRXWRIVOLSV  38´;´%DNHUOLQHUKDQJHU/73DVVHPEO\5,+VWDQGDQGFLUFXODWHRQHOLQHU YROXPHWRFOHDUVWULQJ2EWDLQVODFNRIIZHLJKW38ZHLJKWURWDWLQJZHLJKWDQGWRUTXH SDUDPHWHUVRIWKHOLQHU  &RQWLQXHUXQQLQJLQKROHDWVORZVSHHGVWRDYRLGVXUJLQJZHOO7DUJHWIWPLQDQGDGMXVW VORZHUDVKROHFRQGLWLRQVGLFWDWH  6ZHGJHXSDQGZDVKODVWVWDQGWRERWWRP38¶RIIERWWRP1RWHVODFNRIIDQGSLFNXS ZHLJKWV  6WDJHSXPSUDWHVXSVORZO\WRFLUFXODWLQJUDWH&LUFDQGFRQGLWLRQPXGZLWKOLQHURQERWWRP &LUFXODWH;ERWWRPVXSRUXQWLOSUHVVXUHVVWDELOL]HDQGPXGSURSHUWLHVDUHFRUUHFWDQGWKH VKDNHUVDUHFOHDQ5HGXFHWKHORZHQGUKHRORJ\RIWKHGULOOLQJIOXLGE\DGGLQJZDWHUDQG WKLQQHUV  5RWDWHDQGUHFLSURFDWHVWULQJLIKROHFRQGLWLRQVDOORZ&LUFXQWLOKROHDQGPXGLVLQJRRG FRQGLWLRQIRUFHPHQWLQJ    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A &HPHQW´3URGXFWLRQ/LQHU +ROGDSUHMREVDIHW\PHHWLQJRYHUWKHXSFRPLQJFPWRSHUDWLRQV0DNHURRPLQSLWVIRUYROXPH JDLQHGGXULQJFHPHQWMRE(QVXUHDGHTXDWHFHPHQWGLVSODFHPHQWYROXPHDYDLODEOHDVZHOO (QVXUHPXG ZDWHUFDQEHGHOLYHUHGWRWKHFPWXQLWDWDFFHSWDEOHUDWHV x3XPSEEOVRIIUHVKZDWHUWKURXJKDOORI+DOOLEXUWRQ¶VHTXLSPHQWWDNLQJUHWXUQVWR FXWWLQJVELQSULRUWRSXPSLQJDQ\IOXLGGRZQKROH x3ODQWRWRKDQGOHFPWUHWXUQVDWVXUIDFHUHJDUGOHVVRIKRZXQOLNHO\LWLVWKDWWKLVVKRXOG RFFXU x:KLFKSXPSZLOOEHXWLOL]HGIRUGLVSODFHPHQWDQGKRZIOXLGZLOOEHIHGWRGLVSODFHPHQW SXPS x3RVLWLRQVDQGH[SHFWDWLRQVRISHUVRQQHOLQYROYHGZLWKWKHFPWRSHUDWLRQ x'RFXPHQWHIILFLHQF\RIDOOSRVVLEOHGLVSODFHPHQWSXPSVSULRUWRFHPHQWMRE  $WWHPSWWRURWDWHDQGUHFLSURFDWHWKHOLQHUGXULQJFPWRSHUDWLRQVXQWLOKROHJHWVVWLFN\  3XPSEEOVVSDFHU  7HVWVXUIDFHFPWOLQHVWRSVL  3XPSUHPDLQLQJVSDFHU  0L[DQGSXPSOHDGDQGWDLOFHPHQWSHUEHORZUHFLSH(QVXUHFHPHQWLVSXPSHGDWGHVLJQHG ZHLJKW-RELVGHVLJQHGWRSXPS2+H[FHVV  (VWLPDWHG7RWDO&HPHQW9ROXPH         3ODQIRU¶RIWDLO         6HFWLRQ&DOFXODWLRQ9RO %%/6  ´FVJ[´OLQHU DQQXOXV ¶[ESI  ´2+[´DQQXOXV ¶±¶ [ESI[    ´6KRHWUDFN[ESI 7RWDOEEO 9HULILHG FHPHQW FDOFV  EMP    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A &HPHQW6OXUU\'HVLJQ           'URSGULOOSLSHGDUWDQGGLVSODFHZLWKGULOOLQJPXG,IKROHFRQGLWLRQVDOORZ±FRQWLQXHURWDWLQJ DQGUHFLSURFDWLQJOLQHUWKURXJKRXWGLVSODFHPHQW7KLVZLOOHQVXUHDKLJKTXDOLW\FHPHQWMREZLWK FRYHUDJHDURXQGWKHSLSH  'LVSODFHFHPHQWDWPD[UDWHRIEEOPLQ5HGXFHSXPSUDWHWRESPSULRUWRODWFKLQJ'3 GDUWLQWROLQHUZLSHUSOXJ1RWHSOXJGHSDUWXUHIURPOLQHUKDQJHUUXQQLQJWRRODQGUHVXPH SXPSLQJDWIXOOGLVSODFHPHQWUDWH'LVSODFHPHQWYROXPHFDQEHUH]HURHGDWWKLVSRLQW  ,IHOHYDWHGGLVSODFHPHQWSUHVVXUHVDUHHQFRXQWHUHGSRVLWLRQOLQHUDWVHWWLQJGHSWKDQGFHDVH UHFLSURFDWLRQ 0RQLWRUUHWXUQV SUHVVXUHFORVHO\ZKLOHFLUFXODWLQJ1RWLI\'ULOOLQJ)RUHPDQ LPPHGLDWHO\RIDQ\FKDQJHV  %XPSWKHSOXJDQGSUHVVXUHXSWRXSDVUHTXLUHGE\%DNHUSURFHGXUHWRVHWWKHOLQHUKDQJHU HQVXUHSUHVVXUHLVDERYHQRPLQDOVHWWLQJSUHVVXUHEXWEHORZSXVKHUWRRODFWLYDWLRQSUHVVXUH  +ROGSUHVVXUHIRUPLQXWHV  6ODFNRIIWRWDOOLQHUZHLJKWSOXVNWRFRQILUPKDQJHULVVHW  'RQRWRYHUGLVSODFHE\PRUHWKDQVKRHWUDFN6KRHWUDFNYROXPHLVEEOV  &RQWLQXHSUHVVXULQJXSWRDFWLYDWH/73SXVKHUWRRODQGVHWSDFNHUZLWKUXQQLQJWRROLQ FRPSUHVVLRQ  3UHVVXUHXSWRSVLWRQHXWUDOL]HWKHSXVKHUWRRODQGUHOHDVHWKHUXQQLQJWRRO +5'( IURP WKHOLQHU  %OHHGSUHVVXUHWR]HURWRFKHFNIORDWHTXLSPHQW:DWFKIRUIORZ1RWHDPRXQWRIIOXLGUHWXUQHG DIWHUEXPSLQJSOXJDQGUHOHDVLQJSUHVVXUH  38SDVWIUHHWUDYHOYHULI\VHWWLQJWRROLVUHOHDVHGFRQILUPHGE\ORVVRIOLQHUZHLJKW   >ĞĂĚ;ϭϬ͕ϴϳϱ͛DƚŽϲϲϲϱ͛DͿdĂŝů;ϭϭ͕ϴϳϱ͛ƚŽϭϬ͕ϴϳϱ͛DͿ ^LJƐƚĞŵdžƚĞŶĚĞĚŽŶǀĞŶƚŝŽŶĂů ĞŶƐŝƚLJϭϮůďͬŐĂůϭϱ͘ϯůďͬŐĂů zŝĞůĚϮ͘ϰĨƚϯͬƐŬϭ͘ϮϰĨƚϯͬƐŬ DŝdžĞĚtĂƚĞƌϭϰ͘ϬϵŐĂůͬƐŬϱ͘ϱϴŐĂůͬƐŬ DŝdžĞĚ&ůƵŝĚϭϰ͘ϬϵŐĂůͬƐŬϱ͘ϱϴŐĂůͬƐŬ     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 3UHVVXUHXSGULOOSLSHWRSVLDQGSLFNXSWRUHPRYHWKH56SDFNRIIEXVKLQJIURPWKH56 QLSSOH%XPSXSSUHVVXUHDVUHT¶GWRPDLQWDLQSVL'3SUHVVXUHZKLOHPRYLQJSLSHXQWLOWKH SUHVVXUHGURSVUDSLGO\LQGLFDWLQJSDFNRIILVDERYHWKHVHDOLQJDUHD HQVXUHWKDWSVLZLOOEH HQRXJKWRRYHUFRPHK\GURVWDWLFGLIIHUHQWLDODWOLQHUWRS   ,PPHGLDWHO\ZLWKWKHORVVRISUHVVXUHDQGEHIRUH'3UHDFKHV]HURLQLWLDWHFLUFXODWLRQZKLOH SLFNLQJXSWRSRVLWLRQWKHERWWRPRIWKHVWLQJHULQVLGHWKHWLHEDFNVOHHYH,QFUHDVHSXPSUDWHWR ZHOOERUHFOHDQXSUDWHXQWLOWKHVOHHYHDUHDLVWKRURXJKO\FOHDQHG  3LFNXSWRWKHKLJKUDWHFLUFXODWLRQSRLQWDERYHWKHWLHEDFNH[WHQVLRQPDUNWKHSLSHIRU UHFLSURFDWLRQGRQRWUHWDJWKHOLQHUWRSDQGFLUFXODWHWKHZHOOFOHDQ:DWFKIRUFHPHQWUHWXUQV DQGUHFRUGWKHHVWLPDWHGYROXPH5RWDWH FLUFXODWHWRFOHDUFPWIURP'3  5'FHPHQWHUVDQGIOXVKHTXLSPHQW322+/''3DQGUXQQLQJWRRO9HULI\WKHOLQHUWRSSDFNHU UHFHLYHGWKHUHTXLUHGVHWWLQJIRUFHE\LQVSHFWLQJWKHURWDWLQJGRJVXE  %DFNXSUHOHDVHIURPOLQHUKDQJHU  ,IWKH+5'(WRROVWLOOGRHVQRWUHOHDVHK\GUDXOLFDOO\OHIWKDQG FRXQWHUFORFNZLVH WRUTXHZLOO KDYHWREHDSSOLHGWRWKHWRRO7KLVWRUTXHDFWVWRVKHDUEUDVVVFUHZV%OHHGRIISXPSSUHVVXUH DQGHQVXUHWKDWWKHWRROLVLQWKHQHXWUDOSRVLWLRQ$SSO\OHIWKDQGWRUTXHDVUHTXLUHGWRVKHDU VFUHZV  127(6RPHKROHFRQGLWLRQVPD\UHTXLUHPRYHPHQWRIWKHGULOOSLSHWR³ZRUN´WKHWRUTXHGRZQ WRWKHVHWWLQJWRRO  $IWHUVFUHZVKDYHVKHDUHGWKHWRSVXEDQGERG\RIWKHVHWWLQJWRROZLOOWXUQWXUQ7KHQ SURFHHGVODFNLQJRIIVHWGRZQZHLJKWWRVKHDUVHFRQGVHWRIVKHDUVFUHZV7KHWRSVXEZLOOGURS LQFKHV$WWKLVSRLQWWKHERWWRPVXEQRORQJHUVXSSRUWVWKHFROOHWILQJHUV3LFNVWUDLJKWXS ZLWKZRUNVWULQJWRUHOHDVHFROOHWIURPWKHSURILOH Ensure to report the following on wellez: x3UHIOXVKW\SHYROXPH EEOV  ZHLJKW SSJ  x&HPHQWVOXUU\W\SHOHDGRUWDLOYROXPH ZHLJKW x3XPSUDWHZKLOHPL[LQJESPQRWHDQ\VKXWGRZQGXULQJPL[LQJRSHUDWLRQVZLWKDGXUDWLRQ x3XPSUDWHZKLOHGLVSODFLQJQRWHZKHWKHUGLVSODFHPHQWE\SXPSWUXFNRUPXGSXPSVZHLJKW W\SH RIGLVSODFLQJIOXLG x1RWHLIOLQHULVUHFLSURFDWHGRUURWDWHGGXULQJWKHMRE x&DOFXODWHGYROXPHRIGLVSODFHPHQWDFWXDOGLVSODFHPHQWYROXPHZKHWKHUSOXJEXPSHG EXPS SUHVVXUHGRIORDWVKROG x3HUFHQWPXGUHWXUQVGXULQJMRELILQWHUPLWWHQWQRWHWLPLQJGXULQJSXPSLQJRIMRE)LQDOFLUFXODWLQJ SUHVVXUH x1RWHLISUHIOXVKRUFHPHQWUHWXUQVDWVXUIDFH YROXPH x1RWHWLPHFHPHQWLQSODFH x1RWHFDOFXODWHGWRSRIFHPHQW    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A x$GGDQ\FRPPHQWVZKLFKZRXOGGHVFULEHWKHVXFFHVVRUSUREOHPVGXULQJWKHFHPHQWMRE  Send final “As-Run” liner tally & liner and cement report to cdinger@hilcorp.com and Frank.Roach@hilcorp.com. This will be included with the EOW documentation that goes to the AOGCC. ´7LHEDFN5XQ  /'H[FHVV'3ZKLOH:2&'LVSODFHZHOOWRLQKLELWHGIUHVKZDWHU  7HVWFDVLQJDQGOLQHUODSWRSVLPLQ  38WLHEDFNDVVHPEO\DQG5,+ZLWK´,%70WXELQJ x%2766669DWa¶LQWLHEDFNVWULQJ  1RJRWLHEDFNVHDODVVHPEO\LQOLQHU3%5DQGPDUNSLSH38SXSMRLQW V LIQHFHVVDU\WRVSDFH RXWWLHEDFNVHDOVLQ3%5  38KDQJHUDQGODQGVWULQJLQKDQJHUERZO1RWHGLVWDQFHRIVHDOVIURPQRJR  ,QVWDOOSDFNRIIDQGWHVWKDQJHUYRLG  0,7,$´[´DQQXOXVWRSVLDQGFKDUWIRUPLQXWHV  0,77´OLQHUDQGWLHEDFNWRSVLDQGFKDUWIRUPLQXWHV  5'02  ,QVWDOO%39LQZHOOKHDG  1'%23(  18GU\KROHWUHHRU LIVSDFHSHUPLWWLQJ IXOOWUHHDQGWHVWWRSVL  5'02+LOFRUS5LJ       3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 'ULOOLQJ%23(6FKHPDWLF     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A :HOOKHDG6FKHPDWLF       3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A $QWLFLSDWHG'ULOOLQJ+D]DUGV  ´+ROH6HFWLRQV /RVW&LUFXODWLRQ (QVXUHOEVRIHDFKRIWKHGLIIHUHQWVL]HVRI&DOFLXP&DUERQDWHDUHDYDLODEOHRQORFDWLRQWRPL[ /&0SLOOVDWPRGHUDWHSURGXFWFRQFHQWUDWLRQV  +ROH&OHDQLQJ 0DLQWDLQUKHRORJ\ZYLVFRVLILHUDVQHFHVVDU\6ZHHSKROHZEEOVKLYLVSLOOVDVQHFHVVDU\ 2SWLPL]HVROLGVFRQWUROHTXLSPHQWWRPDLQWDLQGHQVLW\DQGPLQLPL]HVDQGFRQWHQW0DLQWDLQ<3 EHWZHHQWRRSWLPL]HKROHFOHDQLQJDQGFRQWURO(&'  :HOOERUHVWDELOLW\ 0DLQWDLQ0:DVQHFHVVDU\XVLQJDGGLWLRQVRI&DOFLXP&DUERQDWHDVZHLJKWLQJPDWHULDO$WRUTXH UHGXFWLRQOXEHPD\EHXVHGLQWKLVKROHVHFWLRQLQFRQFHQWUDWLRQVXSWRLIQHHGHG0DLQWDLQ.&O LQV\VWHPIRUVKDOHLQKLELWLRQ  &RDO'ULOOLQJ 7KHIROORZLQJOHVVRQVZHUHOHDUQHGIURPH[WHQVLYHH[SHULHQFHGULOOLQJFRDOVHDPVLQ&RRN,QOHW7KH QHHGIRUJRRGSODQQLQJDQGGULOOLQJSUDFWLFHVLVDOVRHPSKDVL]HGDVDNH\FRPSRQHQWIRUVXFFHVV x.HHSWKHGULOOSLSHLQWHQVLRQWRSUHYHQWDZKLSSLQJHIIHFWZKLFKFDQGLVWXUEFRDOVHFWLRQV x 8VHDVSKDOWW\SHDGGLWLYHVWRIXUWKHUVWDELOL]HFRDOVHDPV x,QFUHDVHIOXLGGHQVLW\DVUHTXLUHGWRFRQWUROUXQQLQJFRDOV x(PSKDVL]HJRRGKROHFOHDQLQJWKURXJKK\GUDXOLFV523DQGV\VWHPUKHRORJ\  +6 +6LVQRWSUHVHQWLQWKLVKROHVHFWLRQ  &ORVH$SSURDFK 7KHSODQIDLOV$&ZLWK&/8 3 $¶G DWWKHHQGRIWKHZHOOSDWK1RDFWLRQUHTXLUHG 3UHVVXUHV DV KLJK DV  SSJ (0:  EMP    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A +LOFRUS5LJ/D\RXW     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A ),7/273URFHGXUH  )RUPDWLRQ,QWHJULW\7HVW ),7 DQG /HDN2II7HVW /27 3URFHGXUHV  3URFHGXUHIRU),7   'ULOO RIQHZIRUPDWLRQEHORZWKHFDVLQJVKRH WKLVGRHVQRWLQFOXGHUDWKROHEHORZWKHVKRH   &LUFXODWHWKHKROHWRHVWDEOLVKDXQLIRUPPXGGHQVLW\WKURXJKRXWWKHV\VWHP38LQWRWKHVKRH  &ORVHWKHEORZRXWSUHYHQWHU UDPRUDQQXODU   3XPSGRZQWKHGULOOVWHPDWWRESP  2QDJUDSKSORWWKHIOXLGSXPSHG YROXPHRUVWURNHV YVGULOOSLSHSUHVVXUHXQWLODSSURSULDWHVXUIDFH SUHVVXUHLVDFKLHYHGIRU),7DWVKRH$GGFDVLQJSUHVVXUHWHVWGDWDWRJUDSKLIUHFHQWDQGDYDLODEOH  6KXWGRZQDWUHTXLUHGVXUIDFHSUHVVXUH+ROGIRUDPLQLPXPPLQXWHVRUXQWLOWKHSUHVVXUHVWDELOL]HV 5HFRUGWLPHYVSUHVVXUHLQPLQXWHLQWHUYDOV  %OHHGWKHSUHVVXUHRIIDQGUHFRUGWKHIOXLGYROXPHUHFRYHUHG  7KHSUHGHWHUPLQHGVXUIDFHSUHVVXUHIRUHDFKIRUPDWLRQLQWHJULW\WHVWLVEDVHGRQDFKLHYLQJDQ(0:DW OHDVWSSJKLJKHUWKDQWKHHVWLPDWHGUHVHUYRLUSUHVVXUHDQGDOORZLQJIRUDQDSSURSULDWHDPRXQWRINLFN WROHUDQFHLQFDVHZHOOFRQWUROPHDVXUHVDUHUHTXLUHG  :KHUHUHTXLUHGWKH/27LVSHUIRUPHGLQWKHVDPHIDVKLRQDVWKHIRUPDWLRQLQWHJULW\WHVW,QVWHDGRI VWRSSLQJDWDSUHGHWHUPLQHGSRLQWVXUIDFHSUHVVXUHLVLQFUHDVHGXQWLOWKHIRUPDWLRQEHJLQVWRWDNHIOXLG DWWKLVSRLQWWKHSUHVVXUHZLOOFRQWLQXHWRULVHEXWDWDVORZHUUDWH7KHV\VWHPLVVKXWLQDQGSUHVVXUH PRQLWRUHGDVZLWKDQ),7     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A &KRNH0DQLIROG6FKHPDWLF     3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A &DVLQJ'HVLJQ,QIRUPDWLRQ       3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A ´+ROH6HFWLRQ0$63  !!!!!!!! ! !!!!!! D $) &DQQHU\/RRS8QLW5'B%+/ &DQQHU\/RRS8QLW5'B73+ &DQQHU\/RRS8QLW5'B6+/ $'/ $'/ $'/ $'/ $'/ $'/ $'/ $'/ $'/ $'/ $'/ $'/Kenai R iver Hilcorp Alaska, LLC FEE ADL 60568 James Kenneth Foute Hilcorp Alaska, LLC FEE ADL 60568 Hilcorp Alaska, LLC FEE AA-092401 Hilcorp Alaska, LLC FEE ADL 60569 C W C FISHERIES INC JOSEPH A COCHRAN Hilcorp Alaska, LLC FEE C-605069 Hilcorp Alaska, LLC FEE C-605069 Hilcorp Alaska, LLC FEE C-605069 ALASKA PACKERS ASSOCIATIONCHARLES R WEBBER &/81R3DG &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/8%+/ &/86%+/ &/86%+/ &/86%+/ &/86%+/ &/86%+/ .8%+/ &/85'%+/ &/85'%+/ &/85'%+/ &/85'3%%+/ &$11(5</22381,7          61: &DQQHU\/RRS8QLW &/85' ZS6XUYH\    )HHW $ODVND6WDWH3ODQH=RQH1$'¯ /HJHQG &/8B5'BZS $)&DQQHU\/RRS8QLW5'B%+/ !&DQQHU\/RRS8QLW5'B6+/ D &DQQHU\/RRS8QLW5'B73+ !2WKHU6XUIDFH:HOO/RFDWLRQV 2WKHU%RWWRP+ROH/RFDWLRQV :HOO3DWKV 2LODQG*DV8QLW%RXQGDU\ 0DS'DWH    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 6SLGHU3ORW *RYHUQPHQWDO6HFWLRQV   ^hWZ^    3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A ¶5DGLXVIRU6669      3DJH9HUVLRQ-XO\  CLU-05RD2 Drilling Procedure Rev A 'LUHFWLRQDO3URJUDP ZS $WWDFKHG            ! "  #  $ %!&'&&  !(  !  !  3000 3500 4000 4500 5000 5500 6000 6500 7000 7500 8000 8500 9000 9500 10000 10500True Vertical Depth (1000 usft/in)2500 3000 3500 4000 4500 5000 5500 6000 6500 7000 7500 8000 8500 9000 9500 Vertical Section at 53.00° (1000 usft/in) CLU-05RD2 wp01 Tgt45005000 5 5 0 0 6 0 0 0 6 5 0 0 7 0 0 0 7 5 0 0 8 0 0 0 8 5 0 0 9 0 0 0 9 5 0 0 1 0 0 0 0 1050 0 110 00 11500 12000 12500 CLU05RD45005000 5 5 0 0 6 0 0 0 6 5 0 0 7 0 0 0 7500 8000 8500 9000 950 0 1 0000 10 50 0 110 0 0 11 4 2 4 CLU05 9 5/8" 7" TOW 4 1/2" x 6 3/4"45005 0 0 0 5 5 0 0 6 0 0 0 6 5 0 0 7 0 0 0 7 5 0 0 8 0 0 0 8 5 0 0 9 0 0 0 9 5 0 0 1 0 0 0 0 1 0 5 0 0 1 1 0 0 0 1 1 5 0 0 1 1 8 7 5 CLU-05RD2 wp03 Start Dir 12.5º/100' : 6665' MD, 5487.17'TVD : 30° RT TF End Dir : 6682' MD, 5503.09' TVD Start Dir 2º/100' : 6702' MD, 5521.7'TVD End Dir : 6978.65' MD, 5773.82' TVD Start Dir 2º/100' : 8587.12' MD, 7206.68'TVD End Dir : 8706.51' MD, 7313.11' TVD Total Depth : 11874.71' MD, 10138.5' TVD Tyonek D6 Hilcorp Alaska, LLC Calculation Method:Minimum Curvature Error System:ISCWSA Scan Method: Closest Approach 3D Error Surface: Ellipsoid Separation Warning Method: Error Ratio WELL DETAILS: Cannery Loop Unit 05 Ground Level: 20.50 +N/-S +E/-W Northing Easting Latitude Longitude 0.00 0.00 2388620.75 272695.38 60° 31' 55.840 N 151° 15' 43.471 W SURVEY PROGRAM Date: 2022-07-14T00:00:00 Validated: Yes Version: Depth From Depth To Survey/Plan Tool 198.40 6440.40 Baker Hughes INTEQ MWD (Cannery Loop Unit 05) 3_MWD 6527.00 6665.00 Survey #1 (Cannery Loop Unit 05RD) 3_MWD_Interp Azi 6665.00 7000.00 CLU-05RD2 wp03 (Cannery Loop Unit 05RD2) 3_MWD_Interp Azi 7000.00 11874.71 CLU-05RD2 wp03 (Cannery Loop Unit 05RD2) 3_MWD+IFR1+MS+ FORMATION TOP DETAILS TVDPath TVDssPath MDPath Formation 4923.50 4885.00 6077.40 Top CINGSA 5128.50 5090.00 6293.21 Base CINGSA 9988.50 9950.00 11706.51 Tyonek D6 REFERENCE INFORMATION Co-ordinate (N/E) Reference:Well Cannery Loop Unit 05, True North Vertical (TVD) Reference:Actual @ 38.50usft Measured Depth Reference:Actual @ 38.50usft Calculation Method:Minimum Curvature Project:Kenai C.I.U. Site:Cannery Loop Unit #1 Pad Well:Cannery Loop Unit 05 Wellbore:Cannery Loop Unit 05RD2 Design:CLU-05RD2 wp03 CASING DETAILS TVD TVDSS MD Size Name 5487.17 5448.67 6665.00 7 7" TOW 10138.50 10100.00 11874.71 4-1/2 4 1/2" x 6 3/4" SECTION DETAILS Sec MD Inc Azi TVD +N/-S +E/-W Dleg TFace VSect Target Annotation 1 6665.00 19.63 52.13 5487.17 1944.87 2685.60 0.00 0.00 3315.27 Start Dir 12.5º/100' : 6665' MD, 5487.17'TVD : 30° RT TF 2 6682.00 21.50 55.03 5503.09 1948.41 2690.41 12.50 30.00 3321.24 End Dir : 6682' MD, 5503.09' TVD 3 6702.00 21.50 55.03 5521.70 1952.61 2696.41 0.00 0.00 3328.56 Start Dir 2º/100' : 6702' MD, 5521.7'TVD 4 6978.65 27.02 54.26 5773.82 2018.43 2789.04 2.00 -3.62 3442.15 End Dir : 6978.65' MD, 5773.82' TVD 5 8587.12 27.02 54.26 7206.68 2445.29 3382.23 0.00 0.00 4172.79 Start Dir 2º/100' : 8587.12' MD, 7206.68'TVD 6 8706.51 26.90 49.00 7313.11 2478.86 3424.64 2.00 -95.30 4226.85 End Dir : 8706.51' MD, 7313.11' TVD 7 11706.51 26.90 49.00 9988.50 3369.33 4449.01 0.00 0.00 5580.85 CLU-05RD2 wp01 Tgt 8 11874.71 26.90 49.00 10138.50 3419.26 4506.44 0.00 0.00 5656.77 Total Depth : 11874.71' MD, 10138.5' TVD 140015751750192521002275245026252800297531503325350036753850South(-)/North(+) (350 usft/in)1750 1925 2100 2275 2450 2625 2800 2975 3150 3325 3500 3675 3850 4025 4200 4375 4550 4725 4900 5075West(-)/East(+) (350 usft/in)CLU-05RD2 wp01 TgtC L U0 5 R D CLU059 5/8" 7" TOW4 1/2" x 6 3/4"37504000425 04 500475 050005 2 5 0 5 5 0 0 5 7 5 0 6 0 0 0 6 2 5 0 6 5 0 0 6 7 5 0 7 0 0 0725075007750800082508500875090009250950097501000010139CLU-05R D 2 w p03Start Dir 12.5º/100' : 6665' MD, 5487.17'TVD : 30° RT TFEnd Dir : 6682' MD, 5503.09' TVDStart Dir 2º/100' : 6702' MD, 5521.7'TVDEnd Dir : 6978.65' MD, 5773.82' TVDStart Dir 2º/100' : 8587.12' MD, 7206.68'TVDEnd Dir : 8706.51' MD, 7313.11' TVDTotal Depth : 11874.71' MD, 10138.5' TVDCASING DETAILSTVDTVDSS MDSize Name5487.17 5448.67 6665.00 7 7" TOW10138.50 10100.00 11874.71 4-1/2 4 1/2" x 6 3/4"Project: Kenai C.I.U.Site: Cannery Loop Unit #1 PadWell: Cannery Loop Unit 05Wellbore: Cannery Loop Unit 05RD2Plan: CLU-05RD2 wp03WELL DETAILS: Cannery Loop Unit 05Ground Level: 20.50+N/-S +E/-WNorthingEastingLatitudeLongitude0.00 0.002388620.75 272695.38 60° 31' 55.840 N 151° 15' 43.471 WREFERENCE INFORMATIONCo-ordinate (N/E) Reference:Well Cannery Loop Unit 05, True NorthVertical (TVD) Reference:Actual @ 38.50usftMeasured Depth Reference:Actual @ 38.50usftCalculation Method:Minimum Curvature 140015751750192521002275245026252800297531503325350036753850South(-)/North(+) (350 usft/in)1750 1925 2100 2275 2450 2625 2800 2975 3150 3325 3500 3675 3850 4025 4200 4375 4550 4725 4900 5075West(-)/East(+) (350 usft/in)500055006000650070007500CLU 153000350040004500Cannery Loop Unit 076 0 0 0 6 5 0 07000750080008500CLU #134 5 0 0 5 0 0 0 5 5 0 0Cannery Loop Unit 08550060006 5 0075008 0 0 08500 CANNERY LOOP UNIT 01RDCANNERY LOOP UNIT 01RDPB155006000650070007 5 0 0 8 0 0 0 9 0 0 0 9 5 0 0 1 0 2 1 2Cannery Loop Unit 0140004 5 005000550060006500700075008000100001 1 25 3 CLU05RD8 0 0 010226 CLU05300035004 5 0 050005275Cannery Loop Unit 0670007500CLU 145000CLUS-6 wp046 5 0 0 7 0 0 07500900095001000010139CLU-05RD2 wp03Project: Kenai C.I.U.Site: Cannery Loop Unit #1 PadWell: Cannery Loop Unit 05Wellbore: Cannery Loop Unit 05RD2Plan: CLU-05RD2 wp03  )"  *   "   ! +" ,- +" !             .  . /      ! 0 " ! 12 "#$#$% $ $ &'($ )  !3* !+' / ,-./ , 1 +" $ &'($ ) 4 2 +" 0  .$ 1  * 5 *  )" 1 6   **  1!2345  $6 , 1!23, -,-,6    78 "  %  90)  99  )  ! !!  7 * ! !  3!  !! "! 4 2!3 8 !3 5! 03"    $ ) "  $ ) $ ) :*  ! ;'*'<= ! '(( ='=2 !2! =2  =:'>1', :>8!(0 . .  !!   3! ! 8 !3 4 2!3 $ ) 98:. 94:  !! "! $ ) $ ) $ )5 0    $ ) $ )   ! '(( =!2 !2! =1'( !. 28 0! $ ) =:'>(8, :>8'820 . /  " !!  ;<= 7! 32 ;,= *  ! #3  ;<=   ! 1  4*13!" ?@@"!!! 1<8<!!! 8' 2'8  ='(1!(1 2 - !  #!4    !3* !+'  , -!" "!   27 *;,-= ; += 94: ; += !"!  ;<= 98:. ; += ,!> 2= == '( '" !!  ;<= #?!*2 ;<= 98:. ; += , 7" ;<= 94: ; += 1   2 ; += -!"   2 ; +=  3 3  ;<: += @!   ;<: += ,  ;<: +=  "!  ,-  *  + ! =(= 188(2 8(22!'1='= == 88(=2 '2=12!! =18 18(8 '1'!= =(! 8=81 ! =1=8 1!= !2'!= 2! 8('! *'=!*!(!!! 2(18! (8' 22'(!8!=!2!= 12(= 2''! ' '(!!'! 88!12 !==(8!=!2!( (2!2 =(( *1'*88*!' 8!8=8! 82((=2 ''81!=1( 2=2 !28= 8 881' '=1''1 1((81!=1 2=1 1 8 =88' 81!= '(81!=1 (282           )"  *   "   ! +" ,- +" !             .  . /      ! 0 " ! 12 "#$#$% $ $ &'($ )  !3* !+' / ,-./ , 1 +" $ &'($ ) 4 2 +" 0  .$ 1   2 ; += '" !!  ;<= #?!*2 ;<= 98:. ; += 1 4 2!3 ; += 1 8 !3 ; += 94: ; +=  0 -!"   2 ; += ,-  +  & -"!  (  (  !2! =1'(! '(( =!2*!  1(8 (= 1('1 = (8'(8 !2! =1=!8! '(( =!211(1 8( ' '(!8 ! '(!'= '!' '!18!2! =1(2'! '(( =!'1'8'(=! 82 8888 ! 888'8 8'= 8=28(!!2! 2'! '(( =!8(8 81 =' =8 !( =!( = ===8((!2! 2!! '(( =!=2'8=22(' 1 =(8 8 =(2 ( 1!1!2! 2=! '(( =!12!1=2 ! !2! ==8 ( =1(! ' =8!2! 2!1! '(( =''11=!'!( != 2'8 21 2! !( !8''!2! 2!!1! '(( =882'=!'8 '2' (8=8 11 (88' !211 '==(=!2! 2'!! '(( =8(!('!!! 8=( 1'(8 ' 1'88= '=(= !(!!2! 2821! '(( ===(11=! =!1'  '8 '1  !! 821! =(!1!2! 2=8'! '(( ==2'1(=2!( ('=  !88 2  ! = (288!2! 2(88! '(( =(= 2==!1( =1  !28 21  !8 22!( 1!2'(!2! (=! '(( =11 ==!'2 ''22  !218 (1  !=!1( ((21 !18!2! (!!8! '(( 22! !!88(=! ''8  '2!8 !  '! 2 88!2! (8(=! '(( 2!'2 '2!( (88  8=8 !8  8'12 !(= ('18!2! (2(!! '(( 28(2 '1282 !( !!82  28 !!  11  !8(8!2! 112! '(( 2=22= 8(1 ! !1('  =8(8 !2(  =! 28(( !88'18!!2! 18'=! '(( 211 =!!!(= '8!  288 '  =(! !2 !(182!2! 1('=! '(( (=8( =8!=!'= '8='  (''8 ''8  2122 !'8 '!8('1!2' !!! '(( (88=2 2!!2 !! '1!8  1!=8 '8  ('= !=21 '=882!2' =88! '(( (2881 21(!! 88222 ! 18 '(8  1(= !1!1' 81(!2' 2! '(( 12 (2!'='!' '2 ! 8 8'  1(! '!=( 82!(8!2' (('! '(( 1'(2 18'!( =(( ! !88 8! ! 1( '=!18 =28'2!2' !(12! '(( 12'(1! '8(1 =!'' ! !128 8= ! 1' 811 (2''1!2' !==2! '(1 1'! (''22 =(28 ! '(18 8=2 ! (!22 88!2 =!!'!2' '((! '(1 812! 88!2 !8 2'(( ! 8(!8 8(8 ! !88 8('8 ==2(1!2' '2!''! '(1 ((2! !28 !( (!!8( ! 288 8(8 ! '== 1= 2!8'18!2' 8!12! '(1 !='! !=('' (1!' ! ==(8 8(! ! '=18 1'2 2(!!'=!2' 8((=! '(1 =811! ''=8 !2 1=' ! 2=8 8(' ! 8'8 1(81 ('(='81!2' 8!1! '(1 !'!! '11(  !118 ! ('8 82( ! 81!2 ='21= (18!!2' =!('! '(1 !8'1! 882 2!  11 ! 1!'8 8(' ! '1'= ==2' 1'(!('!2' =8=!8! '(1 !2'! (=2  2 ! 12( 8228 ! =!'2 =(! 11'!82 !2' ==2=! '(1 !(8!! !'(2 =(  2==! :AB ' 88 8='2 ! =1'' 2==  1(((!2' 2(2! '(1 '22(! (('=(  !'228 ' '!8 8(= ! =(( 2'(=  ='!=!(!2' 2281! '(1 '8! =8!(11  '88( ' !!8 8(8 ! 28!1= 21!2  !'!(=1'!2' (''1! '(1 '11! 288=1  '2'22 ' '18 8((' ! ( ('!  (28!2' (1!21! '(1 8!18! 2===2  888! ' 88 8(1! ! (== (288  !'('18=!2' 1!! '(1 8=(!8! (!2'2  '8= ' '8 8(2' ! 1!=( 18  !181'8((!28 2! '(1 2! ((2=('  (!=( ' 128 8(2( ! 1((= 1!  '!21!!28 ==!! '(1 8=1! 181==!  =''! ' =((8 8(2 ' 8(8 11!1  8((!8(1 !28 !!(1! '(1 (8(' 1=8   2!2 ' 2(8 8(=' ' 1'  '=2  8=('8!28 (==! '(1 =!82' 2''8  218 ' (288 8(2 ' 21  2!  !!2282'!28 !'('=! '(1 =='8' '!8!  (='8 ' 1=8 8(=! ' !'  (  2('8=(!28 !18(2! '(1 2(' 1!  1!1=8          )"  *   "   ! +" ,- +" !             .  . /      ! 0 " ! 12 "#$#$% $ $ &'($ )  !3* !+' / ,-./ , 1 +" $ &'($ ) 4 2 +" 0  .$ 1   2 ; += '" !!  ;<= #?!*2 ;<= 98:. ; += 1 4 2!3 ; += 1 8 !3 ; += 94: ; +=  0 -!"   2 ; += ,-  +  &C -"!  8 18 8(= ' !1'!'  !8  ='=!82 !28 '''! '(1 28' !82' !  8 !8 8(8 ' ''8!2  21'  =2'18=!28 '1!! '(1 2=2=1' !122  ! 8=2 8 !88 82' ' '1=1  !1!  2'!'82!!28 88(1! '(1 (=' '(1 '' ! = 8 '28 8= ' 8='2  !(1'  2(!'8!28 88! '(1 (8=' 8!(2 = ! ('!' 8 8'8 88== ' !2(  !11=1  ('1(=''!28 12! '(1 ((8(=' 8(1' ! ! 8 81'8 8'8 ' 1!  ''2!2  ((1(2!(!28 =82! '(1 1!82' 88= ! '8 8 (=8 8!! ' ==28  '2  182!2!28 ==81! '(1 1(28' =!!!8 !1 ! '22!1 8 =(8 8 ' 2'1(  8'2  1(1=1!28 2=8! '(1 111(' =1!8(' ! 8'12= 8 22'8 '1(! ' (28  8(( ! '28!=!28 21((! '1 '!!8' 2='!8 '( ! 1 8 (=8 '(8 ' (2'  8(='1 ! ('!='!28 (==! '1 ==(' ('88 ! (! 8 18 '22' ' 18'(8  !'! ! !22!'!28 (!!! '1 111'' 1'8 1= ! ='2(  8 '=! 8 !  =1 ! 2!21!!(!28 (12! '1 '88!' 1(!= ! =2  8'8 '!1 8 1!!  ((1' ! !!1 !28 18'=! '1 ==(88 =2!2 ! 2!!'  !'=8 ''1 8 222  =!1 ! !=!!'!!28 1(!!! '1 11=8 ''!2 81 ! 22(  '!(8 '12 8 !8(1(  =!1( ! !1881(!2 !!! '1 !!1'88 !8(!' ! (!(  818 !122 8 '!2(  =(= ! ''!''!8!!2 18'! '1 !2!88 !(((!8' ! (282  '8 !('! 8 81!=  21!! ! '=(==''!2 1=!1! '1 !(88 '22=1 ! 1!''  =88 !=1 8 8(11  2'8'= ! 8!!'=2 !2 '=!! '1 '(=8 88( ! 1=!  =1=8 !2! 8 2!'=  2(8 ! 8'''1 !2 ='1! '1 ''!18 ''(=!( ' '!(  2((8 !8 8 =('  2(2 ! 8==2!8(!2 12! '1 '8!8 =2''1 ' 81  ((8 !' 8 28  (!( ! 81=(1'('!2 !!=!(! '1 '2!28 2!=! ' 212  128 !81 8 (!(1  (!'1 ! !1'!!2 !'(! '1 '1(8 2(11 == ' 8=1 = =28 != 8 18  (8'=2 ! =(1 !2 !(2!! '1 8=8 (2==( ' 82' = 228 11! 8 1!'  (82( ! 8!((!2 !(88! '1 82!8 ((8 ' 2' , '45# = =!8 (2!  '2  (=' ! 2='=(!2 '=(1! '1 8'828 1=!8 ' 2(( = !88 =(1  1'  ((28 ! 1('28 !2 '!12! '1 8!' !(!! ' !=1= = !1'! =!2  !(  ((2== ! ==1=(1 !2 ''21! '1 8211 1( ' !(' @ '45# = '8(8 8  (1  (1=2( ! =(18'=2 !2 '! '1 8==(2 8'1 ( ' !''1 = 888 '1=  !21  1'' ! ='21!1 !2 '=1''! '1 8(= !'!1 =' ' !='1 = !2 !(1  '8(!  1!22 ! =888'=!2 '(=(! '1 81( '='!!8 ' !2=8( D:AB = =1!! !  '121  1!2== ! ==!28!!2 '18! '1 81=1 '2!1 1 ' !(=== = ='1' (  8818  1'( ! =2=(2!28 !2 8((! '1 2' 8=88  ' '8! = == 1='  8(22  188(2 ! =(=!'!2 82=2! '1 '=( 88(=2 8 ' '!2 !&E:FGGGF1AC&CF,-< ,,7CB,>. = =2 !2'  81==  18=1 ! =(('='1!2 8!82! '1 2 8(=! ' '(2! = =(! !  '1  18(8 ! =18'!2 8!!8! '1 2! 8=81 ! ' '!!8 8!GGAF1&DF,- = 2! !  !2  1!= ! =1=8'!2 8!(='! '1 !! 8('! ' '!(= !E:FGCF1&CF,- = ( !'8=  =!!  1282 ! 2!282!!2 81=(! '1 8!( 2'2! ' '== = 1 !8  2'!2  11(= ! 2=2188!2 81'(=! '1 =! ==822 ! ' 82'1          )"  *   "   ! +" ,- +" !             .  . /      ! 0 " ! 12 "#$#$% $ $ &'($ )  !3* !+' / ,-./ , 1 +" $ &'($ ) 4 2 +" 0  .$ 1   2 ; += '" !!  ;<= #?!*2 ;<= 98:. ; += 1 4 2!3 ; += 1 8 !3 ; += 94: ; +=  0 -!"   2 ; += ,-  +  C& -"!  = 12(= !2!  22'(! ! (8' ! 2(188!=!2 !!! '1 (!' 2''!! ' 88! 8!GDCA&GF1CC&AF,- 2  !2!  21!(8 ! !81 ! 21=18!=!2 '8(! '1 12 28'8  ' 8( 2  !2!  ((1! ! =' ! (''218!=!2 =2(=! '1 ==2 (8'8! ' 812!2 2 ! !2!  12 ! 222 ! (2=28!=!2 =!8! '1 =8!8 1'! ' 8!=1 2 ' !2! = =( ! '2 ! 128!=!2 =8!=!! '1 ==(!!= !( ' ((! 2 8 !2! = 81= ! '! ! 1888'8!=!2 =(! '1 =18= == ' =''8 2  !2! = !'(! ! =21 ! 1('8!=!2 22'(! '1 21(2= 112 ' =2(12 2 = !2! = '!2'' ! (''' ' (18!=!2 282=! '1 282= !(((' ' 2!8'1 2 2 !2! = 8=8 ! !1(= ' 28!=!2 21!8! '1 22'= '221 ' 2=1(! 2 ( !2! = 81 ! !'=8 ' 118!=!2 (!1!! '1 212'= 8==11  ' (!8 2 1 !2! = 182 ! !=!18 ' !(('8!=!2 (==1! '1 (!'(= =2  ' (==2 (  !2! = =('== ! !(18( ' =28!=!2 18!(! '1 (81= =8= ' 1=1 (  !2! = 22!28 ! '=! ' !!18!=!2 18==! '1 (28('= 2'8!8  ' 1 ( ! !2! = (=(! ! '8!= ' !'1828!=!2 1218! '1 1== (!''! ' 11=18 ( ' !2! = 11 ! '=1 ' !2='8!=!2= =8!! '1 1!=8(= 1!8 8 8!'= ( 8 !2! 2 '111 ! '1=' ' ''!!8!=!2= '(! '1 1!'2 81  8 (221 (  !2! 2 !12 ! 8!!2 ' '8!=!2= 1(! '1 12('2 12  8 ''! ( (2! !2! 2 !==( ! 88!1 ' '(!!'8!=!2= !'28! '1 ='2 =(( 8 2!21 !E:FAAC&F1CG&GAF,- ( = !2 2 !( ! 88(2' ' '(=1='2!2= !(8! '1 '1(2 21=! 8 2(=8 ( 2= !=1 2 '' ! 82((= ' 8!8=881!2= ==2(! '1 '''22 !28=! 8 !!=( 8!ACG&F1C&F,- ( ( !=1 2 '1=8( ! == ' 8==81!2= 11!'! '1 =2 '21( 8 !=1 ( 1 !=1 2 8(== ! '=!1 ' 81281!2= !''18! '1 (1!2 882= 8 '8( 1  !=1 2 28(8 ! =12 ' !8(81!2= !=(=8! '1 (2 '='8  8 '1' 1  !=1 2 ==8! ! 1== ' 181!2= '''! '1 8222 =!! 8 888 1 ! !=1 2 2'! ! =!'8 ' 1'881!2= ''(=! '1 2=12 282 8 881( 1 ' !=1 2 (8!'( ! =! ' =!2!181!2= '2!22! '1 !=2 ('(( 8 8182 1 8 !=1 2 1'= ! =(82 ' ==8'81!2= 8282! '1 !'8='2 (1'= 8 '1( 1  !=1 ( !28 ! 28'1 ' =1(81!2= 88!(! '1 !='=2 1(!!8  8 (81( 1 = !=1 ( 11! ! 2882 ' 2!12'81!2= 82=(1! '1 !1!=2( 28! 8 =' 1 2 !=1 ( 11 ! 22'2 ' 2='(281!2= =! '1 '!=1( == 8 =2! 1 ( !=1 ( !((!( ! ('8' ' 21(!81!2= 8='! '1 '2( !812( 8 2!'( 1 1 !=1 ( '228= ! (''! ' ('!=81!2= (! '1 '212'( ''(1= 8 2=   !=1 ( 8===8 ! (=!( ' (=='81!2= =2!! '1 8(2( 8!(8  8 (=   !=1 ( (! ! (1!8( ' 1881!2= =8!! '1 8'22(( 2'! 8 (2(  ! !=1 ( =8811 ! 1!!= ' 1'8=81!2= =('! '1 8==(( ==81  8 11  ' !=1 ( 2'82 ! 1( ' 1=(281!2= 21(8! '1 81(!( =1=2  8 18=  8 !=1 ( (!'' ! 1(' 8 !(181!2= 28! '1 !8(8( 2(8( 8 11(   !=1 ( 1!' ' ! 8 '2881!2= 2(1!! '1 '(=( (28'  '='  = !=1 1 2 ' 8(1 8 2(81!2= (!'1=! '1 (!((( 1='!  (8  2 !=1 1 1(1 ' 2( 8 ''81!2= ((=2! '1 =11 !'1   !=(  ( !=1 1 (2 ' != 8 '18281!2= (1''2! '1 =81!1 82   22  1 !=1 1 !=1! ' !118 8 2'=!81!2= 1!((! '1 ==1181 !'2  !=(          )"  *   "   ! +" ,- +" !             .  . /      ! 0 " ! 12 "#$#$% $ $ &'($ )  !3* !+' / ,-./ , 1 +" $ &'($ ) 4 2 +" 0  .$ 1   2 ; += '" !!  ;<= #?!*2 ;<= 98:. ; += 1 4 2!3 ; += 1 8 !3 ; += 94: ; +=  0 -!"   2 ; += ,-  +  DD&D -"!    !=1 1 '(8' ' 1=! 8 !22281!2= 1=!21! '1 =1(1=1 '11'  !=1(   !=1 1 882= ' (1' 8 !8181!2= 112! '1 2!21(1 81  '2  ! !=1 1 '=21 ' !(11 8 !2==81!22 '!!! '1 221 81(!1   '!!  ' !=1 1 =!12 ' !8(=2 8 '!81!22 ==1! '1 2(='1 (282   '12'(  8 !=1 1 2 ' !2(' 8 '88'81!22 =!! '1 (1 =2==  88!   !=1 1 (8'' ' '(' 8 '2(8181!22 '='!! '1 (8821 2=('  8(2=  = !=1 1 (1' ' ''22! 8 8!=881!22 2'! '1 (2'11 (  '!2(  2= !=1 1 1(( ' '=1'' 8 88181!22 !(! '1 181 1  (( , $G  ( !=1  2(2 ' '12( 8 8(1'81!22 !88! '1 1'' '''2   =!'  (282 !=1  '( ' 81!= 8 =8881!22 !=='(! '1 1!(   ==2= ,   2AC&CF1A&F,-:BHG:B ,34* 2!:*! 3 2  ,- ; += 4 2!3 ; += 8 !3 ; += 94: ; += 98:. ; += ,3 ! #3  ;<= ! !& ;<= * !+.91 1(( ! '1 18 !22 !(' '=1'' 8 881  * A  9 *3 $ 6 -!"   2 ; += 1   2 ; +=  !3 !* ;B=  !* ;B=4*  !3 ! 2;.-0 8(22= ==2(*<! 8<!;5='<8; '( (2828*<! =*'<8 1   2 ; += -!"  2 ; += ! !"!  ;<=4* !2 3 ! ;<= 7 *!  -!"   2 = !1'!  !( ? ,@  = 228 8 1!' .,@   2= 1 1(( .  =           )"  *   "   ! +" ,- +" !             .  . /      ! 0 " ! 12 "#$#$% $ $ &'($ )  !3* !+' / ,-./ , 1 +" $ &'($ ) 4 2 +" 0  .$ 1   2 ; += -!"  2 ; += 98:. ; += 94: ; +=  "  !  **  # !  = ==  8(22  188(2 ! =(=   !B<>C===>" 8(22>.D C':..E = =(!  '1  18(8 ! =18 4 C==(!>" '1>.D = 2!  !2  1!= ! =1=8   !B<>C=2!>" !2>.D = 12(=  22'(! ! (8' ! 2(18 4 C=12(=>" 22'(!>.D ( (2! 2 !==( ! 88!1 ' '(!!'   !B<>C((2!>" 2!==(>.D ( 2= 2 '' ! 82((= ' 8!8=8 4 C(2=>" 2''>.D  (282  '( ' 81!= 8 =88 .  AC(282>" '(>.D         5HYLVHG 75$160,77$//(77(5&+(&./,67 :(//1$0(BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 37'BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBB'HYHORSPHQW BBB6HUYLFH BBB([SORUDWRU\ BBB6WUDWLJUDSKLF7HVW BBB1RQ&RQYHQWLRQDO ),(/'BBBBBBBBBBBBBBBBBBBBBBBBBB 322/BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KHFN%R[IRU$SSURSULDWH/HWWHU3DUDJUDSKVWREH,QFOXGHGLQ7UDQVPLWWDO/HWWHU &+(&. 237,216 7(;7)25$33529$//(77(5 08/7, /$7(5$/ ,IODVWWZRGLJLWV LQ$3,QXPEHUDUH EHWZHHQ 7KH SHUPLW LV IRU D QHZ ZHOOERUH VHJPHQW RI H[LVWLQJ ZHOO 3HUPLW 1XPEHU BBBBBBBBBBBBB$3, 1XPEHUBBBBBBBBBBBBBBBBBBBBBB 3URGXFWLRQ IURPRULQMHFWLRQ LQWRWKLVZHOOERUHPXVW EHUHSRUWHGXQGHU WKHRULJLQDO$3,1XPEHUVWDWHGDERYH 6SDFLQJ ([FHSWLRQ 7KHSHUPLWLVDSSURYHGVXEMHFWWRIXOOFRPSOLDQFHZLWK$$& $SSURYDO WR SURGXFH RU LQMHFW LV FRQWLQJHQW XSRQ LVVXDQFH RI D FRQVHUYDWLRQ RUGHU DSSURYLQJ D VSDFLQJ H[FHSWLRQ 7KH 2SHUDWRU DVVXPHVWKHOLDELOLW\RIDQ\SURWHVWWRWKHVSDFLQJH[FHSWLRQWKDWPD\ RFFXU 'U\'LWFK6DPSOH $OOGU\GLWFKVDPSOHVHWVVXEPLWWHGWRWKH$2*&& PXVWEHLQQRJUHDWHU WKDQIRRW VDPSOHLQWHUYDOVIURPEHORZWKHSHUPDIURVWRUIURPZKHUH VDPSOHVDUHILUVWFDXJKWDQGIRRW VDPSOHLQWHUYDOVWKURXJKWDUJHW ]RQHV 1RQ &RQYHQWLRQDO :HOO 3OHDVHQRWHWKHIROORZLQJVSHFLDOFRQGLWLRQRIWKLVSHUPLW 3URGXFWLRQRU SURGXFWLRQWHVWLQJRIFRDOEHGPHWKDQHLVQRWDOORZHGIRUWKLVZHOO XQWLO DIWHUWKH2SHUDWRUKDVGHVLJQHGDQGLPSOHPHQWHGDZDWHUZHOOWHVWLQJ SURJUDPWRSURYLGHEDVHOLQHGDWDRQZDWHUTXDOLW\DQGTXDQWLW\7KH 2SHUDWRU PXVWFRQWDFWWKH$2*&& WRREWDLQDGYDQFHDSSURYDORIVXFK D ZDWHUZHOOWHVWLQJSURJUDP :HOO/RJJLQJ 5HTXLUHPHQWV 5HJXODWLRQ$$& D DXWKRUL]HVWKH$2*&&WRVSHFLI\W\SHV RIZHOOORJVWREHUXQ,QDGGLWLRQWRWKHZHOOORJJLQJSURJUDPSURSRVHG E\ WKH2SHUDWRULQWKHDWWDFKHGDSSOLFDWLRQWKHIROORZLQJZHOOORJVDUH DOVRUHTXLUHGIRUWKLVZHOO 3HU6WDWXWH$6 G  % DQG5HJXODWLRQ$$& FRPSRVLWHFXUYHVIRU DOO ZHOOORJVUXQPXVWEHVXEPLWWHGWRWKH$2*&& ZLWKLQGD\VDIWHUFRPSOHWLRQVXVSHQVLRQRUDEDQGRQPHQWRIWKLV ZHOORUZLWKLQGD\VRIDFTXLVLWLRQRIWKHGDWDZKLFKHYHURFFXUVILUVW &/85'  %HOXJD*DV8SSHU7\RQHN*DV7\RQHN'*DV.(1$,&$11(5</223 :(//3(50,7&+(&./,67&RPSDQ\+LOFRUS$ODVND//&:HOO1DPH&$11(5</22381,75',QLWLDO&ODVV7\SH'(93(1'*HR$UHD8QLW2Q2II6KRUH2Q3URJUDP'(9)LHOG 3RRO:HOOERUHVHJ$QQXODU'LVSRVDO37'.(1$,&/8%(/8*$*$6 .(1$,&/8833(57<21(..(1$,&/87<21(.'*$61$ 3HUPLWIHHDWWDFKHG1R 6XUIDFHORFDWLRQLQ+LOFRUSIHHOHDVH IRUPHUO\$'/ ZHOOERUHSDVVHVWKUXSULYDWHIHHOHDVHLQ /HDVHQXPEHUDSSURSULDWH<HV ZKLFK+LOFRUSRZQVZRUNLQJLQWHUHVWWRSSURGXFWLYHLQWHUYDODQG7'OLHLQ$'/ 8QLTXHZHOOQDPHDQGQXPEHU<HV .HQDL&/8%HOXJD*DV8SSHU7\RQHN*DV7\RQHN'*DV±DOOJRYHUQHGE\&2$ :HOOORFDWHGLQDGHILQHGSRRO<HV :HOOORFDWHGSURSHUGLVWDQFHIURPGULOOLQJXQLWERXQGDU\<HV :HOOORFDWHGSURSHUGLVWDQFHIURPRWKHUZHOOV<HV 6XIILFLHQWDFUHDJHDYDLODEOHLQGULOOLQJXQLW<HV ,IGHYLDWHGLVZHOOERUHSODWLQFOXGHG<HV 2SHUDWRURQO\DIIHFWHGSDUW\<HV 2SHUDWRUKDVDSSURSULDWHERQGLQIRUFH<HV 3HUPLWFDQEHLVVXHGZLWKRXWFRQVHUYDWLRQRUGHU<HV 3HUPLWFDQEHLVVXHGZLWKRXWDGPLQLVWUDWLYHDSSURYDO<HV &DQSHUPLWEHDSSURYHGEHIRUHGD\ZDLW1$ :HOOORFDWHGZLWKLQDUHDDQGVWUDWDDXWKRUL]HGE\,QMHFWLRQ2UGHU SXW,2LQFRPPHQWV  )RUVHUY1$ $OOZHOOVZLWKLQPLOHDUHDRIUHYLHZLGHQWLILHG )RUVHUYLFHZHOORQO\ 1$ 3UHSURGXFHGLQMHFWRUGXUDWLRQRISUHSURGXFWLRQOHVVWKDQPRQWKV )RUVHUYLFHZHOORQO\ 1$ 1RQFRQYHQJDVFRQIRUPVWR$6 M$  M$' <HV &RQGXFWRUVWULQJSURYLGHG<HV 6LGHWUDFNEHORZVXUIDFHFDVLQJ 6XUIDFHFDVLQJSURWHFWVDOONQRZQ86':V1$ &07YRODGHTXDWHWRFLUFXODWHRQFRQGXFWRU VXUIFVJ<HV &07YRODGHTXDWHWRWLHLQORQJVWULQJWRVXUIFVJ<HV &07ZLOOFRYHUDOONQRZQSURGXFWLYHKRUL]RQV<HV &DVLQJGHVLJQVDGHTXDWHIRU&7% SHUPDIURVW<HV $GHTXDWHWDQNDJHRUUHVHUYHSLW<HV ,IDUHGULOOKDVDIRUDEDQGRQPHQWEHHQDSSURYHG<HV $GHTXDWHZHOOERUHVHSDUDWLRQSURSRVHG1$ 6XUIDFHKROHLVDOUHDG\GULOOHG ,IGLYHUWHUUHTXLUHGGRHVLWPHHWUHJXODWLRQV<HV 'ULOOLQJIOXLGSURJUDPVFKHPDWLF HTXLSOLVWDGHTXDWH<HV %23(VGRWKH\PHHWUHJXODWLRQ<HV .UDWLQJ0363 SVL %23WHVWWRSVL  %23(SUHVVUDWLQJDSSURSULDWHWHVWWR SXWSVLJLQFRPPHQWV <HV &KRNHPDQLIROGFRPSOLHVZ$3,53 0D\ <HV :RUNZLOORFFXUZLWKRXWRSHUDWLRQVKXWGRZQ1R ,VSUHVHQFHRI+6JDVSUREDEOH1$ 0HFKDQLFDOFRQGLWLRQRIZHOOVZLWKLQ$25YHULILHG )RUVHUYLFHZHOORQO\ <HV +6QRWDQWLFLSDWHGEDVHGRQRIIVHWZHOOV 3HUPLWFDQEHLVVXHGZRK\GURJHQVXOILGHPHDVXUHV1$ 3ODQQHGPXGZHLJKWVDSSHDUDGHTXDWHWRFRQWUROWKHRSHUDWRU VIRUHFDVWRIPRVWOLNHO\SRUH 'DWDSUHVHQWHGRQSRWHQWLDORYHUSUHVVXUH]RQHV1$ SUHVVXUHVLQWKHJHRORJLFSURJQRVLVWKDWLQGLFDWHVZHOOZLOOEHQRUPDOO\SUHVVXUHGIURP.23 6HLVPLFDQDO\VLVRIVKDOORZJDV]RQHV1$ WR7\RQHNWKHQRYHUSUHVVXUHG WRSSJ WR7' 6HDEHGFRQGLWLRQVXUYH\ LIRIIVKRUH 1$ &RQWDFWQDPHSKRQHIRUZHHNO\SURJUHVVUHSRUWV>H[SORUDWRU\RQO\@$SSU6)''DWH$SSU%-0'DWH$SSU6)''DWH$GPLQLVWUDWLRQ(QJLQHHULQJ*HRORJ\*HRORJLF&RPPLVVLRQHU'DWH(QJLQHHULQJ&RPPLVVLRQHU'DWH3XEOLF&RPPLVVLRQHU'DWH-/&