The URL can be used to link to this page

Home My WebLink About221-072CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. From:McLellan, Bryan J (OGC) To:Chad Helgeson Cc:Noel Nocas; Donna Ambruz Subject:RE: BRU 223-24 (PTD# 221-072) Coil Cleanout Date:Thursday, April 24, 2025 10:37:00 AM Chad, No sundry required for this one. For future reference, if multiple pools are open in a well, a CT cleanout might need a sundry since there will be comingling rules, potential logging requirements for allocating production. Check the comingling orders for specifics. Bryan McLellan Senior Petroleum Engineer Alaska Oil & Gas Conservation Commission Bryan.mclellan@alaska.gov +1 (907) 250-9193 From: Chad Helgeson <chelgeson@hilcorp.com> Sent: Thursday, April 24, 2025 8:24 AM To: McLellan, Bryan J (OGC) <bryan.mclellan@alaska.gov> Cc: Noel Nocas <Noel.Nocas@hilcorp.com>; Donna Ambruz <dambruz@hilcorp.com> Subject: BRU 223-24 (PTD# 221-072) Coil Cleanout Bryan, We lost a well BRU 223-24 to fill again this week. We have SL tagging the fill on it today, but it is looking like it will need a coil cleanout to get back onto production. Pending the SL work today, we could get coil on the well this weekend for a cleanout. It will be a Nitrified/fluid cleanout. We do not plan to set any plugs, patches or add any perfs. We are submitting a 48hr notice for BOP test today in case we need the cleanout this weekend. Based on your conversation with Noel reviewing the regulations, we are not conducting any work that requires Sundry approval. I just want to make sure that you/AOGCC agrees that a coil cleanout does not require a Sundry approval. Attached is a current schematic of the well and the plan would be to clean out as deep as we can. Regards Chad Helgeson Operations Engineer Kenai Asset Team 907-777-8405 - O 907-229-4824 - C The information contained in this email message is confidential and may be legally privileged and is intended only for the use of theindividual or entity named above. If you are not an intended recipient or if you have received this message in error, you are herebynotified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that theonward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibilityis accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. Nolan Vlahovich Hilcorp Alaska, LLC Geotech 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 564-4558 E-mail: nolan.vlahovich@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 2/20/2025 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 SFTP DATA TRANSMITTAL T#20250220 Well API #PTD #Log Date Log Company Log Type AOGCC ESet # BCU 18RD 50133205840100 222033 1/27/2025 AK E-LINE Patch BRU 223-24 50283201830000 221072 1/26/2025 AK E-LINE Perf CLU 10RD 50133205530100 222113 11/2/2024 YELLOWJACKET PLUG GP 03-87 50733204370000 166052 12/16/2024 AK E-LINE Plug/Cement IRU 44-36 50283200890000 193022 1/22/2025 AK E-LINE Perf KU WD-01 50133203450000 181107 10/15/2024 YELLOWJACKET PERF MPI 1-29 50029216690000 186181 1/29/2025 AK E-LINE Perf MPU C-39 50029228490000 197248 1/27/2025 AK E-LINE TubingCut MPU E-20A 50029225610100 204054 2/1/2025 READ CaliperSurvey MPU K-33 50029227290000 196202 2/8/2025 AK E-LINE TubeCut MPU S-08 50029231680000 203123 2/6/2025 AK E-LINE CmtRtr/Punch MRU A-13 50733200770000 168002 2/6/2025 AK E-LINE TubingPunch MRU M-02 50733203890000 187061 1/22/2025 AK E-LINE Perf MRU M-32RD2 50733204620200 217091 2/10/2025 AK E-LINE TubingPunch NCIU A-09 50883200290100 222024 1/31/2025 AK E-LINE Perf NCIU A-16 50883201270000 208098 1/30/2025 AK E-LINE Perf NCIU A-21 50883201990000 224086 1/15/2025 AK E-LINE Plug, Perf NK-41A 50029227780100 197158 1/6/2025 HALLIBURTON Coilflag PAVE 3-1 50029238060000 224140 1/4/2025 YELLOWJACKET CBL PBU P1-13 50029223720000 193074 12/3/2024 HALLIBURTON PPROF PTM P1-07A 50029219960100 204037 12/31/2024 YELLOWJACKET PPROF Please include current contact information if different from above. T40127 T40128 T40129 T40130 T40131 T40132 T40133 T40134 T40135 T40136 T40137 T40138 T40139 T40140 T40141 T40142 T40143 T40144 T40145 T40146 T40147 BRU 223-24 50283201830000 221072 1/26/2025 AK E-LINE Perf Gavin Gluyas Digitally signed by Gavin Gluyas Date: 2025.02.20 14:09:18 -09'00' 1. Operations Susp Well Insp Plug Perforations Fracture Stimulate Pull Tubing Operations shutdown Performed: Install Whipstock Perforate Other Stimulate Alter Casing Change Approved Program Mod Artificial Lift Perforate New Pool Repair Well Coiled Tubing Ops Other: ______________________ Development Exploratory 3. Address:Stratigraphic Service 6. API Number: 7. Property Designation (Lease Number):8. Well Name and Number: 9. Logs (List logs and submit electronic data per 20AAC25.071):10. Field/Pool(s): 11. Present Well Condition Summary: Total Depth measured 10,000 feet See Schematic feet true vertical 9,648 feet N/A feet Effective Depth measured 6,935 feet 2953 & 6997 feet true vertical 6,685 feet 2903 & 6745 feet Perforation depth Measured depth See Schematic feet True Vertical depth See Schematic feet Tubing (size, grade, measured and true vertical depth)4-1/2" 12.75# / P-110 7,013' MD 6,761'' TVD Packers and SSSV (type, measured and true vertical depth)2,953', 6,997' MD 2,903', 6,745' TVD N/A 12. Stimulation or cement squeeze summary: Intervals treated (measured): Treatment descriptions including volumes used and final pressure:N/A 13a. Prior to well operation: Subsequent to operation: 13b. Pools active after work: 15. Well Class after work: Daily Report of Well Operations Exploratory Development Service Stratigraphic Copies of Logs and Surveys Run 16. Well Status after work: Oil Gas WDSPL Electronic Fracture Stimulation Data GSTOR GINJ SUSP SPLUG Sundry Number or N/A if C.O. Exempt: Authorized Name and Digital Signature with Date:Contact Name: Contact Email: Authorized Title:Contact Phone: Chad Helgeson, Operations Engineer 325-018 Sr Pet Eng:Sr Pet Geo:Sr Res Eng: WINJ WAG 1034 Water-BblOil-Bbl 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. Noel Nocas, Operations Manager 907-564-5278 N/A Swell Pkr, Baker ZXP Liner Top Pkr; N/A chelgeson@hilcorp.com 907-777-8405 measured true vertical Packer Representative Daily Average Production or Injection Data Casing Pressure Tubing Pressure 14. Attachments (required per 20 AAC 25.070, 25.071, & 25.283) 0 Gas-Mcf MD 350 Size 120' 1 3501395 0 3518 277 measured TVD 7" 4-1/2" STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS 221-072 50-283-20183-00-00 3800 Centerpoint Drive, Suite 1400 Anchorage, Alaska 99503 Hilcorp Alaska, LLC N/A 5. Permit to Drill Number:2. Operator Name 4. Well Class Before Work: ADL0021128 Beluga River / Sterling-Beluga Gas Beluga River Unit (BRU) 223-24 Plugs Junk measured Length Production Liner 7,206' 3,003' Casing Structural 6,948' 9,648' 7,206' 10,000' 120'Conductor Surface Intermediate 16" 9-5/8" 120' 3,259' 5,410psi 7,500psi 2,980psi 5,750psi 7,240psi 8,430psi 3,259'3,192' Burst Collapse 1,410psi 3,090psi p k ft t Fra O s O 6. A G L PG , Form 10-404 Revised 10/2022 Due Within 30 days of Operations Submit in PDF format to aogcc.permitting@alaska.gov By Gavin Gluyas at 9:17 am, Feb 14, 2025 Noel Nocas (4361) Digitally signed by Noel Nocas (4361) Date: 2025.02.13 17:48:37 -09'00' BJM 4/14/25 RBDMS JSB 021925 DSR-2/18/25 Page 1/1 Well Name: BRU 223-24 Report Printed: 2/10/2025WellViewAdmin@hilcorp.com Alaska Weekly Report - Operations Jobs Actual Start Date:1/16/2025 End Date: Report Number 1 Report Start Date 1/20/2025 Report End Date 1/21/2025 Last 24hr Summary SL MIRU, PT Lube 500/2000. Determined well clear of obstruction to 5720'KB with 2.65 Guage ring- Drifted Well with 27.5' Dummy guns to 5720'KB Report Number 2 Report Start Date 1/26/2025 Report End Date 1/27/2025 Last 24hr Summary PJSM, Crew travel to location, PIck up lube & run #1, CCL/GR/GUNS (2-3/8"), Pressure test 250/2500-good, Run in hole, Correlate, Perf G9 (5177-5186), Pull up hole, Perf G9 (5165-5169), Pull up hole, Perf G8 (5151-5156), Pull out of the hole, Pick up & make up run #2 ( CCL/GR/GUNS) (2-3/8"), run in the hole, Correlate, G4 (5068-5072), Pull up hole, Perf G3 (5014-5019), Pull up hole, Perf G2 (4995-4997), Pull out of hole, Pick up & make up run #3 (CCL/GR/GUNS)(2-3/8"), Run in hole, Perf G2 (4979-4991), Pull up hole, Perf G1 (4956-4964), Pull out of the hole, Pick up & make up run #4 (CCL/GR/GUNS) (2-3/8"), Run in the hole, Correlate, Perf G1 (4935-4940), Pull up hole, Perf F10 (4899-4908), Pull out of the hole, Secure well & rig down for the night. Field: Beluga River Sundry #: 325-018 State: Alaska Rig/Service:Permit to Drill (PTD) #:221-072Permit to Drill (PTD) #:221-072 Wellbore API/UWI:50-283-20183-00-00 , Perf G8 (5151-5156), p, Perf G3 (5014-5019 ( Perf G9 (5177-5186 ), p Perf G2 (4979-4991 , Perf G9 (5165-5169 , Perf G1 (4935-4940 (, Perf F10 (4899-4908 , Perf G2 (4995-4997), p Perf G1 (4956-4964), ( _____________________________________________________________________________________ Updated By DMA 01-10-25 SCHEMATIC Well: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 Completed: 12/22/21 PERFORATION DETAIL Zone Top (MD)Btm (MD)Top (TVD)Btm (TVD)FT Date Status Top of Pool: 3,059’ MD & 3003’ TVD Bel F10 4,899’4,908’4,752’4,761’9'1/26/25 Open Bel G1 4,935’4,940’4,786’4,791’5'1/26/25 Open Bel G1 4,956’4,964’4,806’4,813’8'1/26/25 Open Bel G2 4,979’4,991’4,828’4,839’12'1/26/25 Open Bel G2 4,995’4,997’4,843’4,845’2'1/26/25 Open Bel G3 5,014’5,019’4,861’4,865’5'1/26/25 Open Bel G4 5,068’5,072’4,912’4,916’4'1/26/25 Open Bel G8 5,151’5,156’4,990’4,995’5'1/26/25 Open Bel G9 5,165’5,169’5,004’5,008’4'1/26/25 Open Bel G9 5,177’5,186’5,015’5,024’9'1/26/25 Open Bel H 5,256’5,276’5,090’5,109’20’1/30/23 Open Bel H2 5,344’5,358’5,174’5,188’14’1/30/23 Open Bel H3 5,370’5,378’5,199’5,207’8’1/30/23 Open Bel H4 5,397’5,407’5,225’5,234’10’1/30/23 Open Bel H5 5,455’5,469’5,280’5,294’14’1/30/23 Open Bel H 5,671’5,691’5,486’5,505’20 12/22/21 Open Bel H 5,717’5,731’5,529’5,543’14 12/22/21 Open Bel H 5,744’5,762’5,555’5,572’18 12/22/21 Open Bel H 5,839’5,851’5,645’5,656’12 12/22/21 Open Bel I 6,043’6,049’5,838’5,843’6 12/22/21 Open Bel I 6,055’6,065’5,849’5,859’10 12/22/21 Open Bel I 6,066’6,086’5,860’5,879’20 12/21/21 Open Bel I 6,185’6,201’5,972’5,987’16 12/21/21 Open T-8 8,695’8,715’8,384’8,403’20 12/2/21 Isolated T-8 8,720’8,740’8,408’8,427’20 12/2/21 Isolated T-17 9,667’9,687’9,325’9,345’20 11/29/21 Isolated T-17 9,700’9,720’9,357’9,377’20 11/29/21 Isolated T-19 9,906’9,926’9,557’9,646’20 11/26/21 Isolated OPEN HOLE / CEMENT DETAIL 9-5/8”TOC @ Surface (50% excess) 7"TOC @ 3260’ (CBL 10-31-21) 4-1/2” Liner TOC @ 7065’ (CBL 11-24-21) 4-1/2” Tubing TOC @ 2484’ (CBL 12-17-21) CASING & TUBING DETAIL Size Type Wt Grade Conn.ID Top Btm 16”Conductor – Driven to Set Depth 84 X-56 Weld 15.01”Surf 120’ 9-5/8”Surf Csg 40 L-80 DWC 8.835”Surf 3,259’ 7"Int. Csg 26 L-80 DWC 6.276”Surf 7,206’ 4-1/2"Prod Lnr 12.75 P-110 TS-HP 3.958”6,997’10,000’ 4-1/2"Tubing 12.75 P-110 TS-HP 3.958”Surf 7,013’ JEWELRY DETAIL No.Depth (MD) Depth (TVD)ID OD Item 1 1,990’1,987’3.958”5.625”Chemical Injection Sub 2 2,953’2,903’6.276”8.835”7” Swell Packer 3 6,935’6,685’Cement Retainer (Quadco FH) 3.A 6980-83’(19) 0.25” Tubing Punch Holes 4 6,997’6,745’4.875”6.540”Liner hanger / LTP Assembly 5 7,100’6,845’CIBP for coil depth control 6 8,665’8,355’CIBP w 29’ cement 7 9,642’9,301’CIBP (12/02/21) 8 9,804’9,458’CIBP, set 11/28/21 (top of fill at 9807’) 1. Type of Request:Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: ___________________ 2.Operator Name:4. Current Well Class: 5. Permit to Drill Number: Exploratory Development 3. Address:Stratigraphic Service 6.API Number: 7. If perforating:8. Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Yes No 9. Property Designation (Lease Number):10. Field: 11. Total Depth MD (ft):Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: Junk (MD): 10,000'N/A Casing Collapse Structural Conductor 1,410psi Surface 3,090psi Intermediate 5,410psi Production 7,500psi Liner Packers and SSSV Type:Packers and SSSV MD (ft) and TVD (ft): 12. Attachments:Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations:OIL WINJ WDSPL Suspended 16. Verbal Approval:Date: GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Contact Email: Contact Phone: Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other Conditions of Approval: Post Initial Injection MIT Req'd? Yes No APPROVED BY Approved by: COMMISSIONER THE AOGCC Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng chelgeson@hilcorp.com 907-777-8405 Noel Nocas, Operations Manager 907-564-5278 Suspension Expiration Date: Will perfs require a spacing exception due to property boundaries? Current Pools: MPSP (psi):Plugs (MD): 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: Tubing Size: PRESENT WELL CONDITION SUMMARY Chad Helgeson, Operations Engineer AOGCC USE ONLY Tubing Grade:Tubing MD (ft):Perforation Depth TVD (ft): Subsequent Form Required: STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 ADL0021128 221-072 50-283-20183-00-00 Hilcorp Alaska, LLC Proposed Pools: 12.75# / P-110 TVD Burst 7,013' 8,430psi 3,192' Size 120' 7"7,206' 3,259' MD See Attached Schematic 7,240psi 2,980psi 5,750psi 120' 6,948' 120' 3,259' January 30, 2025 4-1/2" 10,000' Perforation Depth MD (ft): 7,206' 3800 Centerpoint Drive, Suite 1400 Anchorage, Alaska 99503 Beluga River Unit (BRU) 223-24CO 802A Same 9,648'4-1/2" ~1707psi 3,003' See Schematic Length Swell Pkr, Baker ZXP Liner Top Pkr; N/A 2,953' MD/2,903' TVD, 6997' MD / 6745' TVD; N/A 9,648'6,935'6,685' Beluga River Undefined Beluga Gas 16" 9-5/8" See Attached Schematic m n P s 66 t _ N Form 10-403 Revised 06/2023 Approved application valid for 12 months from date of approval.Submit PDF to aogcc.permitting@alaska.gov By Grace Christianson at 11:05 am, Jan 17, 2025 325-018 Digitally signed by Noel Nocas (4361) DN: cn=Noel Nocas (4361) Date: 2025.01.17 10:30:09 - 09'00' Noel Nocas (4361) Sterling-Beluga Gas SFD DSR-1/22/25SFD 1/20/2025BJM 1/23/25 10-404 *&: Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2025.01.23 15:54:45 -09'00'01/23/25 RBDMS JSB 012425 Well Prognosis Well Name:BRU 223-24 API Number:50-283-20183-00-00 Current Status:Gas Producer Permit to Drill Number:221-072 First Call Engineer:Chad Helgeson (907) 777-8504 (O)(907) 229-4824 (C) Second Call Engineer:Scott Warner (907) 564-4506 (O)(907) 830-8663 (C) Maximum Expected BHP:2211 psi @ 5024’ TVD (Based on 0.44 psi/ft gradient)) Max. Potential Surface Pressure:1707 psi (Based on 0.1 psi/ft gas gradient to surface) Applicable Frac Gradient:0.748 psi/ft using 14.4 ppg EMW FIT at the Surface shoe Shallowest Allowable Perf TVD:MPSP/(0.748-0.1) = 1707 psi / 0.648 = 2,635‘ TVD Top of Applicable Gas Pool:~3,059’MD/ ~3,003’ TVD Brief Well Summary BRU 223-24 is a 2021 grass roots well tested the Tyonek before being completed as a producer in the Beluga H & I sands in late 2021. In 2023 additional Beluga H Sands were added. This wells production has declined to just below 900 mcf/day. The purpose of this work/sundry is toincrease production above unloading rateby adding additional perforations in the Beluga G&F sands. All sands lie in the BELUGA RIVER, UNDEFINED GAS POOL. Wellbore Conditions: 7” TOC 10-31-21 CBL, TOC @ ~3260’ 4-1/2” TOC 12-17-21 CBL, TOC @ ~2484’ SL tags 11-12-2022 2” DDB tagged @ 6086’ 02-09-2024 2” DDB tagged @ 6040’ Procedure 1. RU E-line, PT lubricator to 2000 psi 2. Perforate Beluga sands within the below intervals with the well shut-in: Formation MD TOP MD BASE TVD TOP TVD BASE H Top Pool ~3,059'~3,003' Bel F10 ±4,899’±4,908’±4,752’±4,761’±9 Bel G1 ±4,935’±4,940’±4,786’±4,791’±5 Bel G1 ±4,956’±4,964’±4,806’±4,813’±8 Bel G2 ±4,979’±4,991’±4,828’±4,839’±12 Bel G2 ±4,995’±4,997’±4,843’±4,845’±2 Bel G3 ±5,014’±5,019’±4,861’±4,865’±5 Bel G4 ±5,068’±5,072’±4,912’±4,916’±4 Bel G8 ±5,151’±5,156’±4,990’±4,995’±5 Bel G9 ѷ͔Ϡ͕͔͐Ѝ ѷ͔Ϡ͕͐͘Ѝ ѷ͔Ϡ͏͏͓Ѝ ѷ͔Ϡ͏͏͗Ѝ ѷ͓ Bel G9 ѷ͔Ϡ͖͖͐Ѝ ѷ͔Ϡ͕͐͗Ѝ ѷ͔Ϡ͏͔͐Ѝ ѷ͔Ϡ͏͓͑Ѝ ѷ͘ a) If any zone produces sand and/or water or needs isolated, RIH and set plug above the perforations OR patch across the perforations. Sterling-Beluga Gas Pool (See CO 802A.) SFD Well Prognosis E-line Procedure (Contingency if water is encountered after perforating): 1. MIRU E-Line, PT lubricator to 2500 psi 2. RIH and set plug above the perforations OR set patch over the wet perforations. Attachments: 1. Current Well Schematic 2. Proposed Well Schematic _____________________________________________________________________________________ Updated By DMA 02-09-24 SCHEMATIC Well: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 Completed: 12/22/21 PERFORATION DETAIL Zone Top (MD)Btm (MD)Top (TVD)Btm (TVD)FT Date Status Bel H 5,256’5,276’5,090’5,109’20’1/30/23 Open Bel H2 5,344’5,358’5,174’5,188’14’1/30/23 Open Bel H3 5,370’5,378’5,199’5,207’8’1/30/23 Open Bel H4 5,397’5,407’5,225’5,234’10’1/30/23 Open Bel H5 5,455’5,469’5,280’5,294’14’1/30/23 Open Bel H 5,671’5,691’5,486’5,505’20 12/22/21 Open Bel H 5,717’5,731’5,529’5,543’14 12/22/21 Open Bel H 5,744’5,762’5,555’5,572’18 12/22/21 Open Bel H 5,839’5,851’5,645’5,656’12 12/22/21 Open Bel I 6,043’6,049’5,838’5,843’6 12/22/21 Open Bel I 6,055’6,065’5,849’5,859’10 12/22/21 Open Bel I 6,066’6,086’5,860’5,879’20 12/21/21 Open Bel I 6,185’6,201’5,972’5,987’16 12/21/21 Open T-8 8,695’8,715’8,384’8,403’20 12/2/21 Isolated T-8 8,720’8,740’8,408’8,427’20 12/2/21 Isolated T-17 9,667’9,687’9,325’9,345’20 11/29/21 Isolated T-17 9,700’9,720’9,357’9,377’20 11/29/21 Isolated T-19 9,906’9,926’9,557’9,646’20 11/26/21 Isolated OPEN HOLE / CEMENT DETAIL 9-5/8”TOC @ Surface (50% excess) 7"TOC @ 3260’ (CBL 10-31-21) 4-1/2” Liner TOC @ 7065’ (CBL 11-24-21) 4-1/2” Tubing TOC @ 2484’ (CBL 12-17-21) CASING & TUBING DETAIL Size Type Wt Grade Conn.ID Top Btm 16”Conductor – Driven to Set Depth 84 X-56 Weld 15.01”Surf 120’ 9-5/8”Surf Csg 40 L-80 DWC 8.835”Surf 3,259’ 7"Int. Csg 26 L-80 DWC 6.276”Surf 7,206’ 4-1/2"Prod Lnr 12.75 P-110 TS-HP 3.958”6,997’10,000’ 4-1/2"Tubing 12.75 P-110 TS-HP 3.958”Surf 7,013’ JEWELRY DETAIL No.Depth (MD) Depth (TVD)ID OD Item 1 1,990’1,987’3.958”5.625”Chemical Injection Sub 2 2,953’2,903’6.276”8.835”7” Swell Packer 3 6,935’6,685’Cement Retainer (Quadco FH) 3.A 6980-83’(19) 0.25” Tubing Punch Holes 4 6,997’6,745’4.875”6.540”Liner hanger / LTP Assembly 5 7,100’6,845’CIBP for coil depth control 6 8,665’8,355’CIBP w 29’ cement 7 9,642’9,301’CIBP (12/02/21) 8 9,804’9,458’CIBP, set 11/28/21 (top of fill at 9807’) _____________________________________________________________________________________ Updated By CAH 01-16-25 PROPOSED Well: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 Completed: 12/22/21 PERFORATION DETAIL Zone Top (MD)Btm (MD)Top (TVD)Btm (TVD)FT Date Status Top of Pool: 3,059’ MD & 3003’ TVD Bel F10 ±4,899’±4,908’±4,752’±4,761’±9 TBD Proposed Bel G1 ±4,935’±4,940’±4,786’±4,791’±5 TBD Proposed Bel G1 ±4,956’±4,964’±4,806’±4,813’±8 TBD Proposed Bel G2 ±4,979’±4,991’±4,828’±4,839’±12 TBD Proposed Bel G2 ±4,995’±4,997’±4,843’±4,845’±2 TBD Proposed Bel G3 ±5,014’±5,019’±4,861’±4,865’±5 TBD Proposed Bel G4 ±5,068’±5,072’±4,912’±4,916’±4 TBD Proposed Bel G8 ±5,151’±5,156’±4,990’±4,995’±5 TBD Proposed Bel G9 ±5,165’±5,169’±5,004’±5,008’±4 TBD Proposed Bel G9 ±5,177’±5,186’±5,015’±5,024’±9 TBD Proposed Bel H 5,256’5,276’5,090’20’1/30/23 Open Bel H2 5,344’5,358’5,174’5,188’14’1/30/23 Open Bel H3 5,370’5,378’5,199’5,207’8’1/30/23 Open Bel H4 5,397’5,407’5,225’5,234’10’1/30/23 Open Bel H5 5,455’5,469’5,280’5,294’14’1/30/23 Open Bel H 5,671’5,691’5,486’5,505’20 12/22/21 Open Bel H 5,717’5,731’5,529’5,543’14 12/22/21 Open Bel H 5,744’5,762’5,555’5,572’18 12/22/21 Open Bel H 5,839’5,851’5,645’5,656’12 12/22/21 Open Bel I 6,043’6,049’5,838’5,843’6 12/22/21 Open Bel I 6,055’6,065’5,849’5,859’10 12/22/21 Open Bel I 6,066’6,086’5,860’5,879’20 12/21/21 Open Bel I 6,185’6,201’5,972’5,987’16 12/21/21 Open T-8 8,695’8,715’8,384’8,403’20 12/2/21 Isolated T-8 8,720’8,740’8,408’8,427’20 12/2/21 Isolated T-17 9,667’9,687’9,325’9,345’20 11/29/21 Isolated T-17 9,700’9,720’9,357’9,377’20 11/29/21 Isolated T-19 9,906’9,926’9,557’9,646’20 11/26/21 Isolated OPEN HOLE / CEMENT DETAIL 9-5/8”TOC @ Surface (50% excess) 7"TOC @ 3260’ (CBL 10-31-21) 4-1/2” Liner TOC @ 7065’ (CBL 11-24-21) 4-1/2” Tubing TOC @ 2484’ (CBL 12-17-21) CASING & TUBING DETAIL Size Type Wt Grade Conn.ID Top Btm 16”Conductor – Driven to Set Depth 84 X-56 Weld 15.01”Surf 120’ 9-5/8”Surf Csg 40 L-80 DWC 8.835”Surf 3,259’ 7"Int. Csg 26 L-80 DWC 6.276”Surf 7,206’ 4-1/2"Prod Lnr 12.75 P-110 TS-HP 3.958”6,997’10,000’ 4-1/2"Tubing 12.75 P-110 TS-HP 3.958”Surf 7,013’ JEWELRY DETAIL No.Depth (MD) Depth (TVD)ID OD Item 1 1,990’1,987’3.958”5.625”Chemical Injection Sub 2 2,953’2,903’6.276”8.835”7” Swell Packer 3 6,935’6,685’Cement Retainer (Quadco FH) 3.A 6980-83’(19) 0.25” Tubing Punch Holes 4 6,997’6,745’4.875”6.540”Liner hanger / LTP Assembly 5 7,100’6,845’CIBP for coil depth control 6 8,665’8,355’CIBP w 29’ cement 7 9,642’9,301’CIBP (12/02/21) 8 9,804’9,458’CIBP, set 11/28/21 (top of fill at 9807’) DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No Well Log Information: Digital Med/Frmt ReceivedStart Stop OH / CH Comments Log Media Run No Electr Dataset Number Name Interval List of Logs Obtained:LWD, Mudlogs, WaveSonic, Plug Perf, CBL, XRMI YesYes YesMud Log Samples Directional Survey REQUIRED INFORMATION (from Master Well Data/Logs) DATA INFORMATION Log/ Data Type Log Scale DF 11/15/20213156 7219 Electronic Data Set, Filename: BRU_223- 24_WAVE_31OCT21.las 35950ED Digital Data DF 11/15/20213230 7219 Electronic Data Set, Filename: BRU_223- 24_WAVE_31OCT21_ProcessedLog-V1.las 35950ED Digital Data DF 11/15/2021 Electronic File: BRU_223- 24_WAVE_31OCT21.pdf 35950ED Digital Data DF 11/15/2021 Electronic File: BRU_223- 24_WAVE_31OCT21_img.tiff 35950ED Digital Data DF 11/15/2021 Electronic File: BRU_223- 24_WAVE_31OCT21_ProcessedLog-V1.dlis 35950ED Digital Data DF 11/15/2021 Electronic File: BRU_223- 24_WAVE_31OCT21_ProcessedLog-V1.pdf 35950ED Digital Data DF 11/15/2021 Electronic File: BRU_223- 24_WAVE_31OCT21_ProcessedLog-V1_img.tiff 35950ED Digital Data DF 11/15/2021 Electronic File: BRU_223- 24_WAVE_31OCT21_Waveform_CH-4.dlis 35950ED Digital Data DF 12/2/202170 10000 Electronic Data Set, Filename: BRU 223-34 LWD Final.las 36055ED Digital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final MD.cgm36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final TVD.cgm36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-23 - DSR Actual_VSec.pdf 36055ED Digital Data DF 12/2/2021 Electronic File: BRU 223-24 - Definitive Survey Report.pdf 36055ED Digital Data DF 12/2/2021 Electronic File: BRU 223-24 - DSR Actual_Plan.pdf 36055ED Digital Data Thursday, February 22, 2024AOGCC Page 1 of 8 BRU 223-34 LWD Final.las DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No DF 12/2/2021 Electronic File: BRU 223-24 - DSR GIS.txt36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 - DSR.txt36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 Final Surveys.xlsx36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final MD.emf36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final TVD.emf36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final MD.pdf36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final TVD.pdf36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final MD.tif36055EDDigital Data DF 12/2/2021 Electronic File: BRU 223-24 LWD Final TVD.tif36055EDDigital Data DF 12/20/2021130 10000 Electronic Data Set, Filename: BRU 224-23 Final Mud Log LAS.las 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_DEL_0- 10000.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_FEL_0- 10000.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_GRL_0- 10000.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_DEL_0- 9648.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_FEL_0- 9648.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_GRL_0- 9648.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_DEL_0- 10000.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_FEL_0- 10000.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_GRL_0- 10000.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_DEL_0- 9648.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_FEL_0- 9648.cgm 36100ED Digital Data Thursday, February 22, 2024AOGCC Page 2 of 8 BRU 224-23 Final Mud Log LAS.las DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No DF 12/20/2021 Electronic File: BRU-223-24_5TVD_GRL_0- 9648.cgm 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_DEL_0- 10000.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_FEL_0- 10000.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_GRL_0- 10000.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_DEL_0- 9648.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_FEL_0- 9648.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_GRL_0- 9648.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_DEL_0- 10000.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_FEL_0- 10000.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_GRL_0- 10000.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_DEL_0- 9648.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_FEL_0- 9648.emf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_GRL_0- 9648.emf 36100ED Digital Data DF 12/20/2021 Electronic File: Hilcorp BRU-223-24 Halliburton SDL End of Well Report.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_DEL_0- 10000.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_FEL_0- 10000.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_GRL_0- 10000.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_DEL_0- 9648.pdf 36100ED Digital Data Thursday, February 22, 2024AOGCC Page 3 of 8 DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No DF 12/20/2021 Electronic File: BRU-223-24_2TVD_FEL_0- 9648.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_GRL_0- 9648.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_DEL_0- 10000.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_FEL_0- 10000.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_GRL_0- 10000.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_DEL_0- 9648.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_FEL_0- 9648.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_GRL_0- 9648.pdf 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_DEL_0- 10000.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_FEL_0- 10000.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2MD_GRL_0- 10000.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_DEL_0- 9648.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_FEL_0- 9648.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_2TVD_GRL_0- 9648.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_DEL_0- 10000.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_FEL_0- 10000.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5MD_GRL_0- 10000.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_DEL_0- 9648.tif 36100ED Digital Data Thursday, February 22, 2024AOGCC Page 4 of 8 DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No DF 12/20/2021 Electronic File: BRU-223-24_5TVD_FEL_0- 9648.tif 36100ED Digital Data DF 12/20/2021 Electronic File: BRU-223-24_5TVD_GRL_0- 9648.tif 36100ED Digital Data DF 1/5/20229938 6965 Electronic Data Set, Filename: BRU_223- 24_CBL_30-Nov-2021_(3579).las 36188ED Digital Data DF 1/5/20229929 9490 Electronic Data Set, Filename: BRU_223- 24_Perf Plug_30-Nov-2021_(3579).las 36188ED Digital Data DF 1/5/2022 Electronic File: BRU_223-24_CBL_30-Nov- 2021_(3579).pdf 36188ED Digital Data DF 1/5/2022 Electronic File: BRU_223-24_Perf Plug_30-Nov- 2021_(3579).pdf 36188ED Digital Data DF 1/5/20229650 9510 Electronic Data Set, Filename: BRU_223- 24_Plug Perf_8-Dec-2021_(3588).las 36189ED Digital Data DF 1/5/20227225 6840 Electronic Data Set, Filename: BRU_223- 24_Plug Punch_8-Dec-2021_(3588).las 36189ED Digital Data DF 1/5/20228914 8428 Electronic Data Set, Filename: BRU_223- 24_Plug_8-Dec-2021_(3588).las 36189ED Digital Data DF 1/5/2022 Electronic File: BRU_223-24_Plug Perf_8-Dec- 2021_(3588).pdf 36189ED Digital Data DF 1/5/2022 Electronic File: BRU_223-24_Plug Punch_8-Dec- 2021_(3588).pdf 36189ED Digital Data DF 1/5/2022 Electronic File: BRU_223-24_Plug_8-Dec- 2021_(3588).pdf 36189ED Digital Data DF 1/10/20221450 7746 Electronic Data Set, Filename: BRU_223- 24_WAVE_10NOV21.las 36192ED Digital Data DF 1/10/20227190 9344 Electronic Data Set, Filename: BRU_223- 24_WAVE_10NOV21_ProcessedLog-V1.las 36192ED Digital Data DF 1/10/2022 Electronic File: BRU_223- 24_WAVE_10NOV21.pdf 36192ED Digital Data DF 1/10/2022 Electronic File: BRU_223- 24_WAVE_10NOV21_img.tiff 36192ED Digital Data DF 1/10/2022 Electronic File: BRU_223- 24_WAVE_10NOV21_ProcessedLog-V1.dlis 36192ED Digital Data DF 1/10/2022 Electronic File: BRU_223- 24_WAVE_10NOV21_ProcessedLog-V1.pdf 36192ED Digital Data Thursday, February 22, 2024AOGCC Page 5 of 8 DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No DF 1/10/2022 Electronic File: BRU_223- 24_WAVE_10NOV21_ProcessedLog-V1_img.tiff 36192ED Digital Data DF 1/10/2022 Electronic File: BRU_223- 24_WAVE_10NOV21_Waveform_CH-4.dlis 36192ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21.pdf 36193ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21_img.tiff 36193ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21_PROCESSED_STATIC_DY NAMIC_IMAGE_1to20.pdf 36193ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21_PROCESSED_STATIC_DY NAMIC_IMAGE_1to20_img.tiff 36193ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21_PROCESSED_XRMI_IMAG E.dlis 36193ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21_RAW_XRMI_IMAGE.dlis 36193ED Digital Data DF 1/11/2022 Electronic File: BRU_223- 24_XRMI_10NOV21_RAW_XRMI_IMAGE.ver 36193ED Digital Data DF 1/13/20226906 2346 Electronic Data Set, Filename: BRU_223- 24_CBL_17-Dec-2021_(3606).las 36226ED Digital Data DF 1/13/2022 Electronic File: BRU_223-24_CBL_17-Dec- 2021_(3606).pdf 36226ED Digital Data DF 1/13/2022 Electronic File: BRU_223-24_CBL_31OCT21.dlis36227EDDigital Data DF 1/13/2022 Electronic File: BRU_223-24_CBL_31OCT21.pdf36227EDDigital Data DF 1/13/2022 Electronic File: BRU_223- 24_CBL_31OCT21_img.tiff 36227ED Digital Data DF 1/14/20229650 9510 Electronic Data Set, Filename: BRU_223- 24_Plug Perf_8-Dec-2021_(3588).las 36228ED Digital Data DF 1/14/20227225 6840 Electronic Data Set, Filename: BRU_223- 24_Plug Punch_8-Dec-2021_(3588).las 36228ED Digital Data DF 1/14/20228914 8428 Electronic Data Set, Filename: BRU_223- 24_Plug_8-Dec-2021_(3588).las 36228ED Digital Data DF 1/14/2022 Electronic File: BRU_223-24_Plug Perf_8-Dec- 2021_(3588).pdf 36228ED Digital Data Thursday, February 22, 2024AOGCC Page 6 of 8 DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No Well Cores/Samples Information: ReceivedStart Stop Comments Total Boxes Sample Set NumberName Interval INFORMATION RECEIVED Completion Report Production Test Information Geologic Markers/Tops Y Y / NA Y Mud Logs, Image Files, Digital Data Composite Logs, Image, Data Files Cuttings Samples Y / NA Y Y / NA Directional / Inclination Data Mechanical Integrity Test Information Daily Operations Summary Y Y / NA Y Core Chips Core Photographs Laboratory Analyses Y / NA Y / NA Y / NA COMPLIANCE HISTORY Date CommentsDescription Completion Date:12/22/2021 Release Date:1/22/2024 DF 1/14/2022 Electronic File: BRU_223-24_Plug Punch_8-Dec- 2021_(3588).pdf 36228ED Digital Data DF 1/14/2022 Electronic File: BRU_223-24_Plug_8-Dec- 2021_(3588).pdf 36228ED Digital Data DF 10/26/2022 Interpretative data, not required under 20 AAC 25.071. Will not be released. M.Guhl 2/22/2024 37190ED Digital Data DF 3/10/20235619 5874 Electronic Data Set, Filename: BRU_223- 24_PPROF_12-Feb-2023_(4167).las 37548ED Digital Data DF 3/10/2023 Electronic File: BRU_223-24_PPROF_12-Feb- 2023_(4167).pdf 37548ED Digital Data DF 3/28/20236011 5182 Electronic Data Set, Filename: BRU_223- 24_Perf_30-Jan-2023_(4149).las 37574ED Digital Data DF 3/28/2023 Electronic File: BRU_223-24_Perf_30-Jan- 2023_(4149).pdf 37574ED Digital Data 2/3/2022250 10000 7 1799Cuttings Thursday, February 22, 2024AOGCC Page 7 of 8 DATA SUBMITTAL COMPLIANCE REPORT API No.50-283-20183-00-00Well Name/No.BELUGA RIV UNIT 223-24 Completion Status 1-GASCompletion Date 12/22/2021 Permit to Drill 2210720 Operator Hilcorp Alaska, LLC MD 10000 TVD 9648 Current Status 1-GAS 2/22/2024 UIC No Comments: Compliance Reviewed By:Date: Thursday, February 22, 2024AOGCC Page 8 of 8 M. Guhl 2/22/2024 From:Heusser, Heather A (DNR) To:Guhl, Meredith D (OGC) Cc:Morgan, Kirk A (DNR) Subject:RE: Beluga River Unit 223-24, PTD 221-072, Extended Confidentiality? Date:Wednesday, February 21, 2024 10:50:08 AM Hi Meredith, The DOG Director’s Office confirmed we have not received an extended confidentiality request for Beluga River Unit 223-24. Happy releasing! Heather Ann Heusser Natural Resource Specialist IV State of Alaska Department of Natural Resources Division of Oil and Gas 550 West 7th Avenue, Suite 1100 Anchorage AK 99501-3560 heather.heusser@alaska.gov From: Guhl, Meredith D (OGC) <meredith.guhl@alaska.gov> Sent: Wednesday, February 7, 2024 10:57 AM To: Heusser, Heather A (DNR) <heather.heusser@alaska.gov> Subject: Beluga River Unit 223-24, PTD 221-072, Extended Confidentiality? Hello Heather, Hilcorp Alaska’s Beluga River Unit exploratory well BRU 223-24, PTD 221-072, API 50-283-20183-00- 00 is due for release after January 22, 2024. Has Hilcorp requested extended confidentiality for this well? Thank you, Meredith Meredith Guhl (she/her) Petroleum Geology Assistant Alaska Oil and Gas Conservation Commission 333 W. 7th Ave, Anchorage, AK 99501 meredith.guhl@alaska.gov Direct: (907) 793-1235 CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Meredith Guhl at 907-793-1235 or meredith.guhl@alaska.gov. STATE OF ALASKA RECEIVED ALASKA OIL AND GAS CONSERVATION COMMISSION By Kayla Junke at 11:07 am, Mar 28, 2023 REPORT OF SUNDRY WELL OPERATIONS 1. Operations Susp Well Insp❑ Plug Perforations ❑ Fracture Stimulate ❑ Pull Tubing ❑ Operations shutdown ❑ Performed: Install Whipstock❑ Perforate 0 Other Stimulate ❑ Alter Casing ❑ Change Approved Program ❑ Mod Artificial Lift❑ Perforate New Pool ❑ Repair Well ❑ Coiled Tubing Ops ❑ Other: ❑ 2. Operator Name 4. Well Class Before Work: 5. Permit to Drill Number: Hilcorp Alaska, LLC Development ❑✓ Stratigraphic ❑ Exploratory ❑ Service ❑ 221-072 3. Address: 3800 Certterpoint Drive, Suite 1400 6. API Number: Anchorage, Alaska 99503 50-283-20183-00-00 7. Property Designation (Lease Number): 8. Well Name and Number: ADL0021128 Beluga River Unit (BRIJ) 223-24 9. Logs (List logs and submit electronic data per 20AAC25.071): 10. Field/Pool(s): N/A Beluga River / Undefined Beluga Gas 11. Present Well Condition Summary: Total Depth measured 10,000 feet Plugs measured See Schematic feet true vertical 9,648 feet Junk measured N/A feet Effective Depth measured 6,935 feet Packer measured feet true vertical 6,685 feet true vertical feet Casing Length Size MD TVD Burst Collapse Structural Conductor 120' 16" 120' 120' 2,980psi 1,410psi Surface 3,259' 9-5/8.1 3,259' 3,192' 5,750psi 3,090psi Intermediate 7,206' 7" 7,206' 6,948' 7,240psi 5,410psi Production 3,003' 4-1/2" 10,000, 9,648' 8,430psi 7,500psi Liner Perforation depth Measured depth See Schematic feet True Vertical depth See Schematic feet Tubing (size, grade, measured and true vertical depth) 4-1/2" 12.75#/ P-110 7,013' MD 6,761"TVD Swell Pkr, Baker ZXP Packers and SSSV (type, measured and true vertical depth) Liner Tolp Pkr: N/A 2,953', 6,997' MD 2,903', 6,745' TVD N/A 12. Stimulation or cement squeeze summary: Intervals treated (measured): N/A Treatment descriptions including volumes used and final pressure: N/A 13a. Representative Daily Average Production or Injection Data Oil-Bbl Gas-Mcf I Water-Bbl Casing Pressure Tubing Pressure Prior to well operation'l 0 1 3803 1 132 1 430 1 303 Subsequent to operation: 10 1 3071 116 1440 1296 13b. Pools active after work: 14. Attachments (required per 20 AAC 25.070 25.071, s 25.283) 15. Well Class after work: Daily Report of Well Operations ❑✓ Exploratory ❑ Development Q Service ❑ Stratigraphic ❑ Copies of Logs and Surveys Run ❑ 16. Well Status after work: Oil LJ Gas WDSPL Electronic Fracture Stimulation Data ❑ GSTOR ❑ WINJ ❑ WAG ❑ GINJ LJ SUSP ❑ SPLUG ❑ 17. 1 hereby Certify that the foregoing is true and correct to the best of my knowledge. Sundry Number or N/A if C.O. Exempt: sgretl by Ncel No s Noel Nocas 322667 (4361)N Authorized Name and oDN:—Ncel No(4361), u=u..�. (4361) Digital Signature with Date: D.W: 2023,a1.2610 M6048VO' Contact Name: Jake Flora, Operations Engineer Contact Email: 0ake.flora(Whilcorlo.com Authorized Title: Noel Nocas, Operations Manager 907-564-5278 Contact Phone: 907-777-8442 Sr Pet Eng: I ISr Pet Geo: I I Sr Res Eng: DSR-3/28/23 Form 10-404 Revised 10/2022 Due Within 30 days of Operations Submit in PDF format to aogcc.permitting@alaska.gov RBDMS JSB 033023 Hilcorp Alaska, LLC Well Operations Summary Well Name Rig API Number Well Permit Number Start Date End Date BRU 223-24 50-283-20183-00-00 221-072 1/30/23 3/5/23 Daily Operations: 01/30/2023 -Monday AKE line crew attend morning production meeting. Obtain PTW and hold PJSM. Hook up to triplex PT trailer and mobe to K pad location. Spot equipment and begin RU. MU Run #1- 3-1/8" Gun Gamma Ray/CCL, shock sub, and 2-3/4" x 14' (6spf/60D) GeoD perfgun. (10.3' CCL to top shot). PU tool string, lubricator and stab on wellhead. PT 250/2500 psi. Pass. Open swab - SITP - 1087 psi. Set down in tree due to ice sheath in well bore. RU heater on well head and pump 10 gal. of methanol down tubing. Cleared ice, RIH. Found fluid level at 4720', continue down and tag PBTD at 6047'. Run correlation pass, adjust -2', position and shoot H5 sand at 5455'-5469' (14'). Initial - 1093.5 psi, 5 min - 1093.7 psi, 10 min - 1095.3 psi, 15 min.-1097.6 psi. OOH. Spent gun mucky. MU Run #2 (10'). Open swab - 1123.3 psi. RIH. Correlate, position gun and shoot H4 sand at 5397'- 5407' (10'). Initial - 1165 psi, 5 min - 1174 psi, 10 min - 1178.7 psi, 15 min - 1183.1 psi. OOH. MU Run #3 (8'). Open swab - 1200 psi. RIH, correlate, position gun and shoot H3 sand at 5370'-5378' (8') Initial - 1228.8 psi, 5 min - 1257 psi, 10 min - 1275 psi, 15 min - 1300 psi. OOH. MU Run #4 (14'). Open swab - 1393 psi. RIH, correlate, position gun and shoot H2 sand at 5344'-5358' (14') Initial - 1490.2 psi, 5 min - 1500.2 psi, 10 min - 1514 psi. 15 min - 1525 psi. OOH. MU Run #5 (20'). Open swab - 1580 psi. RIH, locate fluid level at 5450', continue in hole, correlate, position gun and shoot the H sand at 5256' -5276' (20'). Initial - 1619.5 psi, 5 min - 1622.4 psi, 10 min - 1622 psi 15 min - 1621.4 psi. OOH. Bull plug dry.Close swab - 1620 psi. Secure well and RD. Hand well over to production to bring on line. Park equipment and leave Beluga for Kenai. 03/05/2023 - Sunday Evaluating PLT data for additional perforations. K Hilcorp Alaska, LLC Orig. KB Elev.: 18.5' / GL Elev.: 74.4' 9-5/8" 4J1 SBJ6'12[9[22 saw nuz[n 7" 8-112" Hole 3 Hale Bel H Bell 3 3A 4 t 5 6 _ T-8 7 - T-17 8 T-19 4-112" 6-1/8" Hole TD=10,000' (M D) / TD = 9,648' (ND) PBTD = 6,935' (MD) / PBTD = 6,685' (ND) SCHEMATIC Well: BRU 223-24 PTD:221-072 API: 50-283-20183-00-00 Completed: 12/22/21 CASING &TUBING DETAIL Size Type Wt Grade Conn. ID Top Btm 16" Conductor- Driven to Set Depth 84 X-56 Weld 15.01" Surf 120' 9-5/8" SurfCsg 40 L-80 DWC 8.835" Surf 3,259' 7" Int. Csg 26 L-80 DWC 6.276" Surf 7,206' 4-1/2" Prod Lnr 12.75 P-110 TS-HP 3.958" 6,997' 10,000' 4-1/2" Tubing 12.75 P-110 TS-HP 3.958" Surf 7,013' JEWELRY DETAIL No. �� II ID OD ItemMpND 1 1,990, 1,987' 3.958" 1 5.625" Chemical Injection Sub 2 2,953' 2,903' 6.276" 8.835" 7" Swell Packer 3 6,935' 6,685' Cement Retainer (Quadco FH) 3.A 6980-83' (19)0.25" Tubing Punch Holes 4 6,997' 6,745' 4.875" 6.540" Liner hanger /LTP Assembly 5 7,100' 6,845' CIBP for coil depth control 6 8,665' 8,355' CIBP w 29'cement 7 9,642' 9,301' CIBP(12/02/21) 8 9,804' 9,458' CIBP, set 11/28/21(top of fill at 9807') PERFORATION DETAIL Zone Top (MD) Btm (MD) Top (ND) Btm (TVD) FT Date Status Bel H 5,256' 5,276' 5,090' 5,109' 20' 1/30/23 Open Bel H2 5,344' 5,358' 5,174' 5,188' 14' 1/30/23 Open Bel H3 5,370' 5,378' 5,199, 5,207' 8' 1/30/23 Open Bel H4 5,397' 5,407' 5,225' 5,234' 10' 1/30/23 Open Bel H5 5,455' 5,469' 5,280' 5,294' 14' 1/30/23 Open Bel H 5,671' 5,691' 5,486' 5,505, 20 12/22/21 Open Bel 5,717' 5,731' 5,529' 5,543' 14 12/22/21 Open Bel 5,744' 1 5,762' 5,555' 1 18 12/22/21 Open Bel 5,839' 5,851' 5,645' 12 12/22/21 Open Bell 6,043' 6,049' 5,838' 6 12/22/21 Open Bell 6,055' 6,065' 5,849' 10 12/22/21 Open Bell 6,066' 6,086' 5186V 20 12/21/21 Open Bell 6,185' 6,201' 5,972' j8,42720 16 12/21/21 Open T-8 8,695' 8,715' 8,384' 20 12/2/21 Isolated T-8 8,720' 8,740' 8,409' 20 12/2/21 Isolated T-17 9,667' 9,687' 9,325' 20 11/29/21 IsolatedT-17 9,700' 9,7W 9,357' 20 11/29/21 Isolated T-19 9,906' 9,926' 9,557' 9,646' 20 11/26/21 Isolated OPEN HOLE / CEMENT DETAIL 9-5/8" TOC @ Surface (50% excess) 7" TOC @ 3260' (CBL 10-31-21) 4 1/2 TOC @ 7065'(CBL 11-24-21) Liner 4-1/2" TOC @ 2484'(CBL 12-17-21) Tubing Updated By DMA 03-24-23 Kyle Wiseman Hilcorp Alaska, LLC Geo Tech 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 564-4558 E-mail: kyle.wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 3/28/2023 To: Alaska Oil & Gas Conservation Commission Natural Resources Technician 333 W. 7th Ave. Ste#100 Anchorage, AK 99501 DATA TRANSMITTAL **CONFIDENTIAL** WELL: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 Perforation Run 1/30/2023. Folder Contents: Please include current contact information if different from above. Kyle Wiseman Hilcorp Alaska, LLC Geo Tech 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 564-4558 E-mail: kyle.wiseman@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 3/10/2023 To: Alaska Oil & Gas Conservation Commission Natural Resources Technician 333 W. 7th Ave. Ste#100 Anchorage, AK 99501 DATA TRANSMITTAL **CONFIDENTIAL** WELL: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 Production Profile Run 2/12/2023. Folder Contents: Please include current contact information if different from above. David Douglas Hilcorp Alaska, LLC Sr. GeoTechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal. Received By: Date: Date: 10/24/2022 To: Alaska Oil & Gas Conservation Commission Natural Resources Technician 333 W. 7th Ave. Ste#100 Anchorage, AK 99501 DATA TRANSMITTAL **CONFIDENTIAL** WELL: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 EXTENDED MICRO IMAGER (XRMI) INTERPRETATION Run 1 11/15/2021 Folder Contents: Please include current contact information if different from above. PTD:221-072 T37190 Kayla Junke Digitally signed by Kayla Junke Date: 2022.10.26 09:21:33 -08'00' a a k - 0-4-2- Hilrnrp A14wks, LLC, Date: 02/03/2022 David Douglas Hilcorp Alaska, LLC Sr. GeoTechnician 3800 CenterPoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com To: Alaska Oil & Gas Conservation Commission RECEIVED Petroleum Geology Assistant 333 W 7th Ave Ste 100 Anchorage, AK 99501 FEB 0 3 2322 AOGCC DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* Washed and Dried Well Samples (10/19/2021 to 11/09/2021) B Set (7 Boxes): WELL I" SAMIE INTERVAL (FEET t MD) BRU 223-24 BOX 1 OF 7 250' - 3000' MD BRU 223-24 BOX 2 OF 7 3000' - 4440' MD BRU 223-24 BOX 3 OF 7 4440' - 5670' MD BRU 223-24 BOX 4 OF 7 5670' - 6840' MD BRU 223-24 BOX 5 OF 7 6840' - 7990' MD BRU 223-24 BOX 6 OF 7 7990' - 9250' MD BRU 223-24 BOX 7 OF 7 9250' - 10000' MD (TD) Please include current contact information if different from above. l q_q q Please acknowledge receipt by signing and returning one copy of this transmittal or FAX to 907 564-4422 Rec ived : Date: C; I L( / 2 ^ S 1 David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/13/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* PLUG SET – PERF RECORD – TUBING PUNCH (08Dec2021) Please include current contact information if different from above. 37' (6HW eceived By: 01/14/2022 By Abby Bell at 8:37 am, Jan 14, 2022 David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/13/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* Cement Bond Log (31Oct2021) Please include current contact information if different from above. Received By: 01/13/2022 37' (6HW By Abby Bell at 4:02 pm, Jan 13, 2022 David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/13/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* Cement Bond Log (17Dec2021) Please include current contact information if different from above. Received By: 01/13/2022 37' (6HW By Abby Bell at 4:02 pm, Jan 13, 2022 David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/10/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* Extended Range Micro-Imager (XRMI): 11/10/2021 Raw and Processed Images Please include current contact information if different from above. Received By: 01/11/2022 37' (6HW By Abby Bell at 8:40 am, Jan 11, 2022 D:HOO6WDWXV2LO 63/8* 2WKHU $EDQGRQHG 6XVSHQGHG E:HOO&ODVV $$& $$&'HYHORSPHQW ([SORUDWRU\ *,1- :,1- :'63/1RRI&RPSOHWLRQVB 6HUYLFH 6WUDWLJUDSKLF7HVW 2SHUDWRU1DPH 'DWH&RPS6XVSRU 3HUPLWWR'ULOO1XPEHU6XQGU\ $EDQG $GGUHVV 'DWH6SXGGHG $3,1XPEHU D/RFDWLRQRI:HOO*RYHUQPHQWDO6HFWLRQ 'DWH7'5HDFKHG:HOO1DPHDQG1XPEHU 6XUIDFH 7RSRI3URGXFWLYH,QWHUYDO 5HI(OHYDWLRQV.% )LHOG3RROV%HOXJD5LYHU)LHOG */ %) 7RWDO'HSWK 3OXJ%DFN'HSWK0'79' 3URSHUW\'HVLJQDWLRQ E/RFDWLRQRI:HOO6WDWH%DVH3ODQH&RRUGLQDWHV1$' 7RWDO'HSWK0'79' '15$SSURYDO1XPEHU 6XUIDFH [ \ =RQH 73, [ \ =RQH 6669'HSWK0'79' 7KLFNQHVVRI3HUPDIURVW0'79' 7RWDO'HSWK [ \ =RQH 'LUHFWLRQDORU,QFOLQDWLRQ6XUYH\ <HVDWWDFKHG1R :DWHU'HSWKLI2IIVKRUH 5HGULOO/DWHUDO7RS:LQGRZ0'79' 6XEPLWHOHFWURQLFLQIRUPDWLRQSHU$$& IW06/ /RJV2EWDLQHG %27720 ; / / 3 2SHQWRSURGXFWLRQRULQMHFWLRQ" <HV 1R :DVK\GUDXOLFIUDFWXULQJXVHGGXULQJFRPSOHWLRQ" <HV 1R '(37+,17(59$/0' $02817$1'.,1'2)0$7(5,$/86(' 'DWH)LUVW3URGXFWLRQ 0HWKRGRI2SHUDWLRQ)ORZLQJJDVOLIWHWF +RXUV7HVWHG 3URGXFWLRQIRU *DV0&) 7HVW3HULRG &DVLQJ3UHVV &DOFXODWHG *DV0&) 2LO*UDYLW\$3,FRUU 3UHVV+RXU5DWH $'/ 1$ 1$ 1$1$ 1$ 0' 79' 6U5HV(QJ6U3HW*HR6U3HW(QJ 1$ 1$ 2LO%EO :DWHU%EO VXVSHQVLRQRUDEDQGRQPHQWZKLFKHYHURFFXUVILUVW7\SHVRIORJVWREHOLVWHGLQFOXGHEXWDUHQRWOLPLWHGWRPXGORJVSRQWDQHRXVSRWHQWLDOJDPPDUD\ FDOLSHUUHVLVWLYLW\SRURVLW\PDJQHWLFUHVRQDQFHGLSPHWHUIRUPDWLRQWHVWHUWHPSHUDWXUHFHPHQWHYDOXDWLRQFDVLQJFROODUORFDWRUMHZHOU\DQGSHUIRUDWLRQ UHFRUG$FURQ\PVPD\EHXVHG$WWDFKDVHSDUDWHSDJHLIQHFHVVDU\ 1$ )ORZLQJ 3OHDVHVHHDWWDFKHGVFKHPDWLFIRUSHUIRUDWLRQGHWDLO /:'ORJV0XGORJV:DYH6RQLF3OXJ3HUI&%/3OXJSHUI&%/:DYH6RQLF ;50,&%/ &%/3HUI 352'8&7,217(67 'DWHRI7HVW )ORZ7XELQJ 2LO%EO 6XUIDFH *DV2LO5DWLR&KRNH6L]H &%/72& :DWHU%EO 3HU$$&LDWWDFKHOHFWURQLFLQIRUPDWLRQ 6XUIDFH '(37+6(70' /73 0' 79' 3$&.(56(70'79' 6XUIDFH &$6,1*:73(5 )7*5$'( 723 6(77,1*'(37+0' 6XUIDFH 6(77,1*'(37+79' %27720 723 EEOV 6XUIDFH +2/(6,=($02817 38//(' %58 )6/ ):/6HF715:60$. &(0(17,1*5(&25' &HQWHUSRLQW'ULYH6XLWH$QFKRUDJH$. )1/ )(/6HF715:60$. )6/ ):/6HF715:60$. %HOXJD5LYHU8QGHILQHG*DV 0' 79' 1RYHPEHU 2FWREHU 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 :(//&203/(7,21255(&203/(7,215(3257$1'/2* +LOFRUS$ODVND//& :$* *DV &RQG 6XUIDFH /V[7V[ 'ULYHQ /V[7V[ 6,=(,I<HVOLVWHDFKLQWHUYDORSHQ0'79'RI7RSDQG%RWWRP3HUIRUDWLRQ 6L]HDQG1XPEHU'DWH3HUIG EEOFPWSXPSHGEHWZHHQWXELQJ DQGFDVLQJ $&,')5$&785(&(0(17648((=((7& &$6,1*/,1(5$1'&(0(17,1*5(&25' /LVWDOOORJVUXQDQGSXUVXDQWWR$6DQG$$&VXEPLWDOOHOHFWURQLFGDWDZLWKLQGD\VRIFRPSOHWLRQ /V[7V[ 78%,1*5(&25' :,1- 63/8*2WKHU $EDQGRQHG6XVSHQGHG 6WUDWLJUDSKLF7HVW 1R 1R DWWDFKHG1R )RUP5HYLVHG 6XEPLWZLWKLQGD\VRI&RPSOHWLRQ6XVSHQVLRQRU$EDQGRQPHQW By Samantha Carlisle at 10:37 am, Jan 11, 2022 AOGCC RBDMS HEW 1/13/2022 Completion Date 12/22/2021 HEW GDLB 02/02/2022 DSR-1/13/22BJM 8/31/22 D:HOO6WDWXV2LO 63/8* 2WKHU $EDQGRQHG 6XVSHQGHG E:HOO&ODVV $$& $$&'HYHORSPHQW ([SORUDWRU\ *,1- :,1- :'63/1RRI&RPSOHWLRQVB 6HUYLFH 6WUDWLJUDSKLF7HVW 2SHUDWRU1DPH 'DWH&RPS6XVSRU 3HUPLWWR'ULOO1XPEHU6XQGU\ $EDQG $GGUHVV 'DWH6SXGGHG $3,1XPEHU D/RFDWLRQRI:HOO*RYHUQPHQWDO6HFWLRQ 'DWH7'5HDFKHG:HOO1DPHDQG1XPEHU 6XUIDFH 7RSRI3URGXFWLYH,QWHUYDO 5HI(OHYDWLRQV.% )LHOG3RROV%HOXJD5LYHU)LHOG */ %) 7RWDO'HSWK 3OXJ%DFN'HSWK0'79' 3URSHUW\'HVLJQDWLRQ E/RFDWLRQRI:HOO6WDWH%DVH3ODQH&RRUGLQDWHV1$' 7RWDO'HSWK0'79' '15$SSURYDO1XPEHU 6XUIDFH [ \ =RQH 73, [ \ =RQH 6669'HSWK0'79' 7KLFNQHVVRI3HUPDIURVW0'79' 7RWDO'HSWK [ \ =RQH 'LUHFWLRQDORU,QFOLQDWLRQ6XUYH\ <HVDWWDFKHG1R :DWHU'HSWKLI2IIVKRUH 5HGULOO/DWHUDO7RS:LQGRZ0'79' 6XEPLWHOHFWURQLFLQIRUPDWLRQSHU$$& IW06/ /RJV2EWDLQHG %27720 ; / / 3 2SHQWRSURGXFWLRQRULQMHFWLRQ" <HV 1R :DVK\GUDXOLFIUDFWXULQJXVHGGXULQJFRPSOHWLRQ" <HV 1R '(37+,17(59$/0' $02817$1'.,1'2)0$7(5,$/86(' 'DWH)LUVW3URGXFWLRQ 0HWKRGRI2SHUDWLRQ)ORZLQJJDVOLIWHWF +RXUV7HVWHG 3URGXFWLRQIRU *DV0&) 7HVW3HULRG &DVLQJ3UHVV &DOFXODWHG *DV0&) 2LO*UDYLW\$3,FRUU 3UHVV+RXU5DWH $'/ 1$ 1$ 1$1$ 1$ 0' 79' 6U5HV(QJ6U3HW*HR6U3HW(QJ 1$ 1$ 2LO%EO :DWHU%EO VXVSHQVLRQRUDEDQGRQPHQWZKLFKHYHURFFXUVILUVW7\SHVRIORJVWREHOLVWHGLQFOXGHEXWDUHQRWOLPLWHGWRPXGORJVSRQWDQHRXVSRWHQWLDOJDPPDUD\ FDOLSHUUHVLVWLYLW\SRURVLW\PDJQHWLFUHVRQDQFHGLSPHWHUIRUPDWLRQWHVWHUWHPSHUDWXUHFHPHQWHYDOXDWLRQFDVLQJFROODUORFDWRUMHZHOU\DQGSHUIRUDWLRQ UHFRUG$FURQ\PVPD\EHXVHG$WWDFKDVHSDUDWHSDJHLIQHFHVVDU\ 1$ )ORZLQJ 3OHDVHVHHDWWDFKHGVFKHPDWLFIRUSHUIRUDWLRQGHWDLO /:'ORJV0XGORJV:DYH6RQLF3OXJ3HUI&%/3OXJSHUI&%/:DYH6RQLF ;50,&%/ &%/3HUI 352'8&7,217(67 'DWHRI7HVW )ORZ7XELQJ 2LO%EO 6XUIDFH *DV2LO5DWLR&KRNH6L]H &%/72& :DWHU%EO 3HU$$&LDWWDFKHOHFWURQLFLQIRUPDWLRQ 6XUIDFH '(37+6(70' /73 0' 79' 3$&.(56(70'79' 6XUIDFH &$6,1*:73(5 )7*5$'( 723 6(77,1*'(37+0' 6XUIDFH 6(77,1*'(37+79' %27720 723 EEOV 6XUIDFH +2/(6,=($02817 38//(' %58 )6/ ):/6HF715:60$. &(0(17,1*5(&25' &HQWHUSRLQW'ULYH6XLWH$QFKRUDJH$. )1/ )(/6HF715:60$. )6/ ):/6HF715:60$. %HOXJD5LYHU8QGHILQHG*DV 0' 79' 1RYHPEHU 2FWREHU 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 :(//&203/(7,21255(&203/(7,215(3257$1'/2* +LOFRUS$ODVND//& :$* *DV &RQG 6XUIDFH /V[7V[ 'ULYHQ /V[7V[ 6,=(,I<HVOLVWHDFKLQWHUYDORSHQ0'79'RI7RSDQG%RWWRP3HUIRUDWLRQ 6L]HDQG1XPEHU'DWH3HUIG EEOFPWSXPSHGEHWZHHQWXELQJ DQGFDVLQJ $&,')5$&785(&(0(17648((=((7& &$6,1*/,1(5$1'&(0(17,1*5(&25' /LVWDOOORJVUXQDQGSXUVXDQWWR$6DQG$$&VXEPLWDOOHOHFWURQLFGDWDZLWKLQGD\VRIFRPSOHWLRQ /V[7V[ 78%,1*5(&25' :,1- 63/8*2WKHU $EDQGRQHG6XVSHQGHG 6WUDWLJUDSKLF7HVW 1R 1R DWWDFKHG1R )RUP5HYLVHG 6XEPLWZLWKLQGD\VRI&RPSOHWLRQ6XVSHQVLRQRU$EDQGRQPHQW By Samantha Carlisle at 10:37 am, Jan 11, 2022 AOGCC RBDMS HEW 1/13/2022 Completion Date 12/22/2021 HEW GDLB 02/02/2022 DSR-1/13/22BJM 8/31/22 &RQYHQWLRQDO&RUHV <HV1R 6LGHZDOO&RUHV 0' 79' 7RSRI3URGXFWLYH,QWHUYDO %HOXJD+ 7\RQHN /LVWRI$WWDFKPHQWV ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGFRUUHFWWRWKHEHVWRIP\NQRZOHGJH &RQWDFW1DPH &RG\'LQJHU &RQWDFW(PDLOFGLQJHU#KLOFRUSFRP $XWKRUL]HG&RQWDFW3KRQH *HQHUDO ,WHPD ,WHPE ,WHPE ,WHP ,WHP ,WHP ,WHP ,WHP ,WHP ,WHP ,WHP ,WHP ,WHP ,WHP 3XUVXDQWWR$$&DWWDFKWRWKLVIRUPZHOOVFKHPDWLFGLDJUDPVXPPDU\RIGDLO\ZHOORSHUDWLRQVGLUHFWLRQDORULQFOLQDWLRQVXUYH\DQG RWKHUWHVWVDVUHTXLUHGLQFOXGLQJEXWQRWOLPLWHGWRFRUHDQDO\VLVSDOHRQWRORJLFDOUHSRUWSURGXFWLRQRUZHOOWHVWUHVXOWV 5HSRUWPHDVXUHGGHSWKDQGWUXHYHUWLFDOWKLFNQHVVRISHUPDIURVW3URYLGH0'DQG79'IRUWKHWRSDQGEDVHRISHUPDIURVWLQ%R[ $WWDFKHGVXSSOHPHQWDOUHFRUGVVKRXOGVKRZWKHGHWDLOVRIDQ\PXOWLSOHVWDJHFHPHQWLQJDQGWKHORFDWLRQRIWKHFHPHQWLQJWRRO ,IWKLVZHOOLVFRPSOHWHGIRUVHSDUDWHSURGXFWLRQIURPPRUHWKDQRQHLQWHUYDOPXOWLSOHFRPSOHWLRQVRVWDWHLQLWHPDQGLQLWHPVKRZWKH SURGXFLQJLQWHUYDOVIRURQO\WKHLQWHUYDOUHSRUWHGLQLWHP6XEPLWDVHSDUDWHIRUPIRUHDFKDGGLWLRQDOLQWHUYDOWREHVHSDUDWHO\SURGXFHG VKRZLQJWKHGDWDSHUWLQHQWWRVXFKLQWHUYDO 3URYLGHDOLVWLQJRILQWHUYDOVFRUHGDQGWKHFRUUHVSRQGLQJIRUPDWLRQVDQGDEULHIGHVFULSWLRQLQWKLVER[3XUVXDQWWR$$&VXEPLW GHWDLOHGGHVFULSWLRQVFRUHFKLSVSKRWRJUDSKVDQGDOOVXEVHTXHQWODERUDWRU\DQDO\WLFDOUHVXOWVLQFOXGLQJEXWQRWOLPLWHGWRSRURVLW\ SHUPHDELOLW\IOXLGVDWXUDWLRQIOXLGFRPSRVLWLRQIOXLGIOXRUHVFHQFHYLWULQLWHUHIOHFWDQFHJHRFKHPLFDORUSDOHRQWRORJ\ 7KH.HOO\%XVKLQJ*URXQG/HYHODQG%DVH)ODQJHHOHYDWLRQVLQIHHWDERYH0HDQ6HD/HYHO8VHVDPHDVUHIHUHQFHIRUGHSWKPHDVXUHPHQWV JLYHQLQRWKHUVSDFHVRQWKLVIRUPDQGLQDQ\DWWDFKPHQWV 7KH$3,QXPEHUUHSRUWHGWR$2*&&PXVWEHGLJLWVH[ 0HWKRGRI2SHUDWLRQ)ORZLQJ*DV/LIW5RG3XPS+\GUDXOLF3XPS6XEPHUVLEOH:DWHU,QMHFWLRQ*DV,QMHFWLRQ6KXWLQRU2WKHUH[SODLQ 7 3URYLGHDOLVWLQJRILQWHUYDOVWHVWHGDQGWKHFRUUHVSRQGLQJIRUPDWLRQDQGDEULHIVXPPDU\LQWKLVER[6XEPLWGHWDLOHGWHVWDQGDQDO\WLFDO ODERUDWRU\LQIRUPDWLRQUHTXLUHGE\$$& 5HYLHZWKHUHSRUWLQJUHTXLUHPHQWVRI$$&DQGSXUVXDQWWR$6VXEPLWDOOHOHFWURQLFGDWDZLWKLQGD\VRIFRPSOHWLRQ VXVSHQVLRQRUDEDQGRQPHQWZKLFKHYHURFFXUVILUVW :HOO&ODVV6HUYLFHZHOOV*DV,QMHFWLRQ:DWHU,QMHFWLRQ:DWHU$OWHUQDWLQJ*DV,QMHFWLRQ6DOW:DWHU'LVSRVDO:DWHU6XSSO\IRU,QMHFWLRQ 2EVHUYDWLRQRU2WKHU 7 )RUPDWLRQDWWRWDOGHSWK %HOXJD) :HOOERUH6FKHPDWLF'ULOOLQJDQG&RPSOHWLRQ5HSRUWV'HILQLWLYH'LUHFWLRQDO6XUYH\V&VJDQG&PW5HSRUWV 6LJQDWXUHZ'DWH 5HSRUWWKH'LYLVLRQRI2LO *DV'LYLVLRQRI0LQLQJ/DQGDQG:DWHU3ODQRI2SHUDWLRQV/25HJLRQ<</DQG8VH3HUPLW/$6 DQGRU(DVHPHQW$'/QXPEHU ,16758&7,216 0XOWLSOHFRPSOHWLRQLVGHILQHGDVDZHOOSURGXFLQJIURPPRUHWKDQRQHSRROZLWKSURGXFWLRQIURPHDFKSRROFRPSOHWHO\VHJUHJDWHG(DFK VHJUHJDWHGSRROLVDFRPSOHWLRQ 73,7RSRI3URGXFLQJ,QWHUYDO <HV1R :HOOWHVWHG"<HV1R &25('$7$ ,I\HVOLVWLQWHUYDOVDQGIRUPDWLRQVWHVWHGEULHIO\VXPPDUL]LQJWHVWUHVXOWV $WWDFKVHSDUDWHSDJHVWRWKLVIRUPLIQHHGHGDQGVXEPLWGHWDLOHGWHVW LQIRUPDWLRQLQFOXGLQJUHSRUWVSHU$$& 1$0( 7 %HOXJD* %HOXJD' %HOXJD( 6WHUOLQJ& 7KLVIRUPDQGWKHUHTXLUHGDWWDFKPHQWVSURYLGHDFRPSOHWHDQGFRQFLVHUHFRUGIRUHDFKZHOOGULOOHGLQ$ODVND6XEPLWDZHOOVFKHPDWLFGLDJUDP ZLWKHDFKZHOOFRPSOHWLRQUHSRUWDQGZHOOVXQGU\UHSRUWZKHQWKHGRZQKROHZHOOGHVLJQLVFKDQJHG$OOODERUDWRU\DQDO\WLFDO UHSRUWVUHJDUGLQJVDPSOHVRUWHVWVIURPDZHOOPXVWEHVXEPLWWHGWRWKH$2*&&QRPDWWHUZKHQWKHDQDO\VHVDUHFRQGXFWHG ,QIRUPDWLRQWREHDWWDFKHGLQFOXGHVEXWLVQRWOLPLWHGWRVXPPDU\RIGDLO\RSHUDWLRQVZHOOERUHVFKHPDWLFGLUHFWLRQDORULQFOLQDWLRQVXUYH\FRUHDQDO\VLV SDOHRQWRORJLFDOUHSRUWSURGXFWLRQRUZHOOWHVWUHVXOWVSHU$$& ,I<HVOLVWIRUPDWLRQVDQGLQWHUYDOVFRUHG0'79')URP7RDQGVXPPDUL]HOLWKRORJ\DQGSUHVHQFHRIRLOJDVRUZDWHUVXEPLWVHSDUDWHSDJHVZLWKWKLVIRUP LIQHHGHG6XEPLWGHWDLOHGGHVFULSWLRQVFRUHFKLSVSKRWRJUDSKVDQGDOOVXEVHTXHQWODERUDWRU\DQDO\WLFDOUHVXOWVSHU$$& $XWKRUL]HG1DPH0RQW\0\HUV $XWKRUL]HG7LWOH'ULOOLQJ0DQDJHU %HOXJD+ %HOXJD, 3HUPDIURVW%DVH *(2/2*,&0$5.(56/LVWDOOIRUPDWLRQVDQGPDUNHUVHQFRXQWHUHG )250$7,217(676 3HUPDIURVW7RS 1R 1R6LGHZDOO&RUHV<HV 1R )RUP5HYLVHG 6XEPLWZLWKLQGD\VRI&RPSOHWLRQ6XVSHQVLRQRU$EDQGRQPHQW 1.11.2022'LJLWDOO\VLJQHGE\0RQW\00\HUV '1FQ 0RQW\00\HUVF 86 R +LOFRUS$ODVND//&RX 7HFKQLFDO 6HUYLFHV$.'ULOOLQJ HPDLO PP\HUV#KLOFRUSFRP 5HDVRQ,DPDSSURYLQJWKLVGRFXPHQW 'DWH 0RQW\0 0\HUV BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB hƉĚĂƚĞĚǇ͗:ϭͬϭϬͬϮϮ ^,Dd/ tĞůů͗ZhϮϮϯͲϮϰ Wd͗ϮϮϭͲϬϳϮ W/͗ϱϬͲϮϴϯͲϮϬϭϴϯͲϬϬͲϬϬ ŽŵƉůĞƚĞĚ͗ϭϮͬϮϮͬϮϭ WZ&KZd/KEd/> ŽŶĞdŽƉ;DͿƚŵ;DͿdŽƉ;dsͿƚŵ;dsͿ&dĂƚĞ ^ŝǌĞ ^ƚĂƚƵƐ Ğů, ϱ͕ϲϳϭ͛ ϱ͕ϲϵϭ͛ ϱ͕ϰϴϲ͛ ϱ͕ϱϬϱ͛ϮϬϭϮͬϮϮͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů, ϱ͕ϳϭϳ͛ ϱ͕ϳϯϭ͛ ϱ͕ϱϮϵ͛ ϱ͕ϱϰϯ͛ϭϰϭϮͬϮϮͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů, ϱ͕ϳϰϰ͛ ϱ͕ϳϲϮ͛ ϱ͕ϱϱϱ͛ ϱ͕ϱϳϮ͛ϭϴϭϮͬϮϮͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů, ϱ͕ϴϯϵ͛ ϱ͕ϴϱϭ͛ ϱ͕ϲϰϱ͛ ϱ͕ϲϱϲ͛ϭϮϭϮͬϮϮͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů/ ϲ͕Ϭϰϯ͛ ϲ͕Ϭϰϵ͛ ϱ͕ϴϯϴ͛ ϱ͕ϴϰϯ͛ ϲϭϮͬϮϮͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů/ ϲ͕Ϭϱϱ͛ ϲ͕Ϭϲϱ͛ ϱ͕ϴϰϵ͛ ϱ͕ϴϱϵ͛ϭϬϭϮͬϮϮͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů/ ϲ͕Ϭϲϲ͛ ϲ͕Ϭϴϲ͛ ϱ͕ϴϲϬ͛ ϱ͕ϴϳϵ͛ϮϬϭϮͬϮϭͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ Ğů/ ϲ͕ϭϴϱ͛ ϲ͕ϮϬϭ͛ ϱ͕ϵϳϮ͛ ϱ͕ϵϴϳ͛ϭϲϭϮͬϮϭͬϮϭϮͲϳͬϴ͟ϲ^W&KƉĞŶ dͲϴ ϴ͕ϲϵϱ͛ ϴ͕ϳϭϱ͛ ϴ͕ϯϴϰ͛ ϴ͕ϰϬϯ͛ϮϬϭϮͬϮͬϮϭϮͲϯͬϰ͟ϲ^W&/ƐŽůĂƚĞĚ dͲϴ ϴ͕ϳϮϬ͛ ϴ͕ϳϰϬ͛ ϴ͕ϰϬϴ͛ ϴ͕ϰϮϳ͛ϮϬϭϮͬϮͬϮϭϮͲϯͬϰ͟ϲ^W&/ƐŽůĂƚĞĚ dͲϭϳ ϵ͕ϲϲϳ͛ ϵ͕ϲϴϳ͛ ϵ͕ϯϮϱ͛ ϵ͕ϯϰϱ͛ϮϬϭϭͬϮϵͬϮϭϮͲϯͬϰ͟ϲ^W&/ƐŽůĂƚĞĚ dͲϭϳ ϵ͕ϳϬϬ͛ ϵ͕ϳϮϬ͛ ϵ͕ϯϱϳ͛ ϵ͕ϯϳϳ͛ϮϬϭϭͬϮϵͬϮϭϮͲϯͬϰ͟ϲ^W&/ƐŽůĂƚĞĚ dͲϭϵ ϵ͕ϵϬϲ͛ ϵ͕ϵϮϲ͛ ϵ͕ϱϱϳ͛ ϵ͕ϲϰϲ͛ϮϬϭϭͬϮϲͬϮϭϮͲϯͬϰ͟ϲ^W&/ƐŽůĂƚĞĚ KWE,K>ͬDEdd/> ϵͲϱͬϴ͟dKΛ^ƵƌĨĂĐĞ;ϱϬйĞǆĐĞƐƐͿ ϳΗdKΛϯϮϲϬ͛;>ϭϬͲϯϭͲϮϭͿ ϰͲϭͬϮ͟ >ŝŶĞƌdKΛϳϬϲϱ͛;>ϭϭͲϮϰͲϮϭͿ ϰͲϭͬϮ͟ dƵďŝŶŐdKΛϮϰϴϰ͛;>ϭϮͲϭϳͲϮϭͿ ^/E'Θdh/E'd/> ^ŝǌĞdǇƉĞtƚ'ƌĂĚĞŽŶŶ͘/dŽƉƚŵ ϭϲ͟ŽŶĚƵĐƚŽƌʹƌŝǀĞŶ ƚŽ^ĞƚĞƉƚŚϴϰyͲϱϲtĞůĚϭϱ͘Ϭϭ͟^ƵƌĨϭϮϬ͛ ϵͲϱͬϴ͟^ƵƌĨƐŐϰϬ>ͲϴϬtϴ͘ϴϯϱ͟^ƵƌĨϯ͕Ϯϱϵ͛ ϳΗ/Ŷƚ͘ƐŐ Ϯϲ>ͲϴϬtϲ͘Ϯϳϲ͟^ƵƌĨϳ͕ϮϬϲ͛ ϰͲϭͬϮΗWƌŽĚ>ŶƌϭϮ͘ϳϱWͲϭϭϬd^Ͳ,Wϯ͘ϵϱϴ͟ϲ͕ϵϵϳ͛ϭϬ͕ϬϬϬ͛ ϰͲϭͬϮΗdƵďŝŶŐϭϮ͘ϳϱWͲϭϭϬd^Ͳ,Wϯ͘ϵϱϴ͟^ƵƌĨϳ͕Ϭϭϯ͛ :t>Zzd/> EŽ͘ĞƉƚŚ ;DͿ ĞƉƚŚ ;dsͿ/K/ƚĞŵ ϭϭ͕ϵϵϬ͛ϭ͕ϵϵϬ͛ϯ͘ϵϱϴ͟ϱ͘ϲϮϱ͟ŚĞŵŝĐĂů/ŶũĞĐƚŝŽŶ^Ƶď ϮϮ͕ϵϱϯ͛Ϯ͕ϵϬϮ͛ϲ͘Ϯϳϲ͟ϴ͘ϴϯϱ͟ϳ͟^ǁĞůůWĂĐŬĞƌ ϯϲ͕ϵϯϱ͛ϲ͕ϲϴϬ͛ĞŵĞŶƚZĞƚĂŝŶĞƌ;YƵĂĚĐŽ&,Ϳ ϯ͘ϲϵϴϬͲϴϯ͛;ϭϵͿϬ͘Ϯϱ͟dƵďŝŶŐWƵŶĐŚ,ŽůĞƐ ϰϲ͕ϵϵϳ͛ϲ͕ϳϵϬ͛ϰ͘ϴϳϱ͟ϲ͘ϱϰϬ͟>ŝŶĞƌŚĂŶŐĞƌͬ>dWƐƐĞŵďůǇ ϱϳ͕ϭϬϬ͛ϲ͕ϵϰϱ͛/WĨŽƌĐŽŝůĚĞƉƚŚĐŽŶƚƌŽů ϲϴ͕ϲϲϱ͛ϴ͕ϯϲϬ͛/WǁϮϵ͛ĐĞŵĞŶƚ ϳϵ͕ϲϰϮ͛ϵ͕ϯϬϭ͛/W;ϭϮͬϬϮͬϮϭͿ ϴϵ͕ϴϬϰ͛ϵ͕ϰϱϴ͛/W͕ƐĞƚϭϭͬϮϴͬϮϭ;ƚŽƉŽĨĨŝůůĂƚϵϴϬϳ͛Ϳ $FWLYLW\'DWH 2SV6XPPDU\ 6WDUWULJDFFHSWDQFHFKHFNOLVWVSRWFUDQHDQGVWDUWKDQJLQJZLQGZDOOVRQSLWPRGLQVWDOOKDQGUDLOVRQSLWPRGLQVWDOOHGWUDQVGXFHUVRQVWDQGSLSHLQVWDOOQG YDOYHRQPH]]NLOOFOXVWHUZHOGHUIDEULFDWLQJIORZOLQHIRUVXUIDFHIORZULVHUWRVKDNHUVIXQFWLRQHGNQLIHYDOYHLQVWDOOHGWURXJKEHWZHHQSLWPRGVDQGVWDUW ZLUHLQRIFHQWULIXJHLQVWDOOIORRUGUDLQV3HQLQVXOD3XPSLQJSXOOHGDSSUR[LPDWHO\JDOORQVIURPVWDQGDORQHVHSWLFV\VWHPDQGVWDJHGWUXFNIRUEDFNKDXORQ EDUJH,QVWDOOSDQLFOLQHRQFKRNHPDQLIROGFRQWZRUNLQJVWHDPWKURXJKRXWWKHULJEULQJLQDQGRIIORDGPXGSURGXFWEULQJLQVXUIDFHVKRHWUDFNODQGLQJ MRLQWKDQJHUFOHDQHGSLWVRIGHEULVZHOGHUFRQWWRZHOG/272WDEVLQSLWVVWDJHG;2 V7,:DQGGDUWRQIORRUGUHVVVKDNHUV3XWEEOVZDWHULQSLWDQGVWDUW WHVWLQJFHQWULIXJDOSXPSV58WRVHFRQGERLOHUWLHRIIVHUYLFHORRSFDEOH58FDWZDONI38'3&&,WUDQVSRUWFXWWLQJVER[DQGWXERI'3WRORFDWLRQ7UDQVIHU IOXLGWRVXFWLRQSLWORDGUDFNVZLWK'37HVWVWDQGSLSHOLQHVWSVLOHDNLQJLQPH]]WLJKWHQDQGUHWHVWVWDQGSLSHOHDNLQJDQGJRRVHQHFNDWWHPSWWRWLJKWHQ UHWHVWVWLOOOHDNLQJ58DQGUHPRYHJRRVHQHFNDQGNHOO\KRVHIURPVWDQGSLSHDQGFKDQJHRXW2ULQJ:DLWRQUHSODFHPHQW2ULQJ58W383LSH38DQG 5DFNEDFNSLSHVWDQGV&KHFN&URZQ6DYHU&URZQVDYHUQRWUHOHDVLQJVKXWWOHYDOYHIXOORIGHEULVDQGZDWHUDWWHPSWWRFOHDQRXWDQGSXUJHDLUV\VWHPORRN IUHSODFHPHQWVKXWWOHYDOYH&RQWLQXH38SLSHUDFNLQJEDFNLQWKHGHUULFNVWDQGVWRWDOSLFNHGXS &RQW38'3VLQJOHVEXLOGLQJVWDQGVDQGUDFNLQJEDFNLQGHUULFNWKHQVWDUWUDFNLQJEDFN+:'3*RWQRWLILFDWLRQIURP$2*&&5HSWKH\ZHUHIO\LQJ LQHDUO\IRUGLYHUWHUWHVW&&,VHWFHPHQWVLORULJHOHFWULFLDQFRQWZLULQJLQFHQWULIXJHLQSLWPRG4XDGFR5HSLQILHOGDWDQGLQVWDOOHGWZRKRUQOLJKW FOXVWHUVIRUJDVDODUPVWKHQFDOLEUDWHGDQGWHVWHGV\VWHP&UHZLQVWDOOHG7 VLQNRRPH\OLQHVWRDQQXODUDQGIXQFWLRQWHVWHGEDJNQLIHYDOYHQXPHURXVWLPHV &RQWEXLOGLQJVSXGPXGLQVXFWLRQSLW6HWZHOORQGLYHUWHUVLJQVDWSDGHQWUDQFHDQGERWKVLGHVRIULJIODJJHGRIIKD]DUGDUHDV IURPGLYHUWHUYHQWOLQH RSHQLQJ$2*&&5HSRQORFDWLRQDW'LGLQVSHFWLRQRIHTXLSPHQWDQGGLYHUWHUYHQWOLQHWLPHGNQLIHYDOYHDQGDQQXODUSHUIRUPHGNRRPH\GUDZGRZQ WHVWHGDXGLRYLVXDOJDVDODUPV397 VDQGIORZVKRZ0HDVXUHGYHQWOLQHDQGQHDUHVWLJQLWLRQVRXUFH1RLVVXHV5HOHDVHG4XDGFR5HSDQG$2*&& 5HS/HYHOHGVXEEDVHDGMXVWHGWRUTXHWXEHDQG7EDUWRFHQWHUSLSHLQWDEOH,QVWDOOHGRULQJLQVWDQGSLSHJRRVHQHFNRULQJPLVVLQJFRQWEXLOGLQJVSXGPXG VWDJHGFXWWLQJVWRWHVDQGGUDJRQER[VWDJHGVXSHUVXFNHUFRQWZLUHLQFHQWULIXJH&2FRPSHQVDWRURQWRSGULYHSUHVVXUHWHVWVWDQGSLSH,QVWDOOHG,'ZHDU ULQJLQVWDUWLQJKHDG38UDFNEDFNUHPDLQGHU+:'3WDJJHGERWWRPDW 5.% WRJURXQGOHYHO RIFRQGXFWRUVHW/RDG5DFNVDQGEULQJ%+$ FRPSRQHQWVWRIORRU08%+$DVSHU''0:'ELWEUHDNHUZRXOGQ WILWLQURWDU\WDEOHWRPDNHXS)DEULFDWH %LWEUHDNHUSODWHIRUPDVWHUEXVKLQJV08ELWWR PRWRUWRUTXHVHQVRUVQRWIXQFWLRQLQJSURSHUO\EOHHGDLULQOLQHVUHWRUTXHJDXJHEDGFKDQJHJDXJHDQGUHWRUTXHQRWDEOHWRJHWKLJKHQRXJKWRUTXHYDOXHLQVWDOO GRXEOHOLQHDQGUHWRUTXHWRVSHF&RQWLQXH08%+$0RWRUDQG'00:'708SORDG0:' )LQLVK08%+$WR 08MDUVWDQG7DJDW FOHDQRXW FRQGXFWRUWR VSXGZHOOGULOO KROHIURP WR JSPSVL USPNWRUTXH38.62.527.&LUFXODWHWKHKROHFOHDQIORZFKHFNWKHZHOOVWDWLF322+RQHOHYDWRUVIURP WR LQVLGHWKHFRQGXFWRUQR LVVXHVUDFNEDFNMDUVWDQG6HUYLFHWKHWRSGULYHEORFNVGUDZZRUNVDQG,53HUIRUPGHUULFNLQVSHFWLRQWLJKWHQWRUTXHWXEHWXUQEXFNOHV08UHPDLQLQJ%+$ )OH[FROODUV;2MWV+:'3;2DQGMDUVWDQG&RQWLQXHGULOOLQJIURP WR JSPSVL530IWOEVRIWRUTXHRQERWWRP(&'SSJ0: 'ULOO 6XUIDFH+ROHI W JSPSVLUSPWTRQ(&'SSJ0:SSJN:2%38:N62:N527N&LUFXODWH ERWWRPVXSIORZFKHFNZHOOVOLJKWVHHSDJHGURSSHG LQPLQ2EWDLQ6XUYH\322+I W ZRUNHGWKURXJKWLJKWVSRWVI W WKHQSXOOHG ZLWKRXWLVVXHVW 6HUYLFHULJDQGGUDZZRUNVJUHDVHWRSGULYH5,+W ZLWKRXWLVVXHWDJXSRQILOO KLJKZDVKDQGUHDPWRERWWRPSXPS+L9LV 6ZHHS5HVXPH'ULOOLQJ'ULOO 6XUIDFH+ROHI W JSPSVL530WTRQERWWRPN38:N62:N527N:2%0: SSJ(&'SSJ'LVWDQFHWRSODQ KLJK ULJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV 'DLO\0HWDOEEOV 7RWDO0HWDOEEOV 'ULOO 6XUIDFH+ROHI W JSPSVL530NWTRQEWWP:2%N0:SSJYLV(&'SSJ38N62N527 N%XLOGGHJ WDUJHWLQJGHJ'ULOO 6XUIDFH+ROHI W JSPSVL530NWTRQEWWP:2%N0:SSJYLV (&'SSJ38N62N527N%XLOGGHJ WR WKHQKROGGHJWDQJHQW&LUFXODWHKROHFOHDQJSPSVLIORZFKHFNZHOO VHHLQJYHU\VOLJKWVHHSDJH3XOOZLSHUWULSRQHOHYDWRUVIURP ZRUNWKUXWLJKWVSRW# ZLWKXSWRNRYHUSXOODW SXOOLQJWLJKWSXPSRXWI WR JSPSVLSXOORQHOHYDWRUVWR 6HUYLFHULJDQG7RS'ULYH%3+VWDWLFORVVUDWH5,+I W WDJILOO KLJKZDVKWRERWWRP 3XPS+L9LV6ZHHS6ZHHSEDFNVWNVODWHQR,QFUHDVHLQFXWWLQJV'ULOO$KHDGI W JSPSVLUSPNWTRQERWWRPN:2%38: N62:N527N(&'SSJ0:SSJ'ULOO$KHDGI W JSPSVLUSPNWTRQERWWRPN:2%38:N62:N527 N(&'SSJ0:SSJ+DUGVSRWV3XPSELWEDOOLQJVZHHSZLWKQRFKDQJHLQ523'LVWDQFHWRSODQ +LJK 5LJKW&XWWLQJVLQ'UDJRQ%R[HV EEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV Q/$7/21* HYDWLRQ5.% $3, :HOO1DPH )LHOG &RXQW\6WDWH %58 %HOXJD5LYHU +LOFRUS(QHUJ\&RPSDQ\&RPSRVLWH5HSRUW $ODVND &RQWUDFWRU $)( $)( -RE1DPH%58'ULOOLQJ+$.RQO\ 6SXG'DWH 'ULOO KROHI W DWVXUIDFHVHFWLRQ7'JSPSVLUSPNWTRQERWWRPN:2%38N62N527N0:SSJYLV (&'SSJ0DLQWDLQGHJWDQJHQW7DNHILQDOVXUYH\ KLJK OHIW&%8JSPSVLUSPNWRUTXHZRUNLQJSLSH IORZFKHFNZHOO VWDWLF3XOOZLSHUWULSSXOORQHOHYDWRUVI NRYHUSXOODW NRYHUSXOOVDW DQG SXPSRXWI WR JSPSVLWKHQSXOO RQHOHYDWRUVWR ZLWKQRRWKHULVVXHV5,+RQHOHYDWRUVI WR NVHWGRZQ# 38DQGZRUNWKUXHDVLO\ZDVKODVWVWDQGWRERWWRP3XPS EEOKLYLVVZHHSZLWKSSEZDOQXWPDUNHUDURXQGFOHDQXSWKHZHOOERUHJSPSVLUSPNWRUTXHZRUNLQJSLSHVZHHSEDFNVWNVHDUO\ QRLQFUHDVHIORZFKHFNZHOOVOLJKWVHHSDJH322+I W 1RKROHLVVXHV6WDQGEDFNDQG/'%+$'RZQORDG0:'FRQWLQXH/'%+$%UHDNELW JUDGHGLQJDXJH&OHDUIORRU3XOOZHDUULQJGXPP\UXQKDQJHU58:HDWKHUIRUG/RDGUDFNVZ FDVLQJRIIORDGFHPHQWWUXFNVLQWREXONVLORVDQG UHWXUQWREDUJHODQGLQJIVKLSSLQJEDFNWR(DVWVLGH6XEPLW%23WHVWQRWLILFDWLRQWR$2*&&5,+Z &DVLQJDVSHUGHWDLO08DQGEDNHUORFNIORDW HTXLSPHQWFKHFNIORDWVKHOGFRQWLQXH5,+W ILOOLQJRQWKHIO\DQGWRSSLQJRIIHYHU\MWV,QVWDOOLQJFHQWUDOL]HUV&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWLQXHWR38DQGUXQ /':&&FDVLQJDVSHUWDOO\IURP WR #-7YHULI\SLSHFRXQWWRUTXHWRIWOEVILOORQWKHIO\DQGWRS RIIHYHU\MWVEEOORVVHV7,+08WKHKDQJHUDQGODQGLQJMRLQW3XOOURWDU\EXVKLQJVWDJDW ZLWKNVHWGRZQ$FRDOGHSWKRQORJ/'ODQGLQJMW DQGKDQJHU08VZHGJH ZRUNLQJMWDQG7'38N62N6WDJHSXPSWRESPSVLZDVKWKUXFRDODW ZDVKWR FLUFXODWHDQGFRQGLWLRQ PXGILQDOSSJYLV<3EEOORVVHV6SRWDQG58FHPHQWHUV/'ZRUNLQJMWDQGVZHGJH08KDQJHUDQGODQGLQJMWDVSHU:+5ODQGKDQJHUDW ZLWKNRQKDQJHU5'FDVLQJHTXLSPHQW%ORZGRZQWRSGULYH58FHPHQWKHDGGRJERQHVDQGFLUFKRVHZLWQHVVORDGLQJSOXJV38 ZLWKWKHULJ OLQHXSDQGFLUFXODWHESPSVL3-60ZLWKDOOSDUWLHVLQYROYHG/LQHXSFHPHQWHUVSXPSEEOVZDWHUWHVWOLQHVWSVLRSHQHGXSDQGSXPSHG EEOVRISSJ7XQH3ULPHG6SDFHUDWESPSVLGURSSHGERWWRPSOXJSXPSHGEEOV6[SSJ7\SH,,,/HDGFHPHQWDWESPSVL IROORZHGE\EEOVV[SSJ7\SH,,,7DLOFHPHQWDWESPSVLGURSSHGWRSSOXJDQGGLVSODFHGZSSJVSXGPXGDWESPVORZHGSXPSVZ EEOVWRJRWRESPEXPSHGWKHSOXJEEOVLQWRFDOFXODWHGGLVSODFHPHQW)&3SVLSUHVVXUHXSWSVLIPLQEOHHGRIIEEOVFKHFN IORDWVKHOG&,3KUVQRORVVHVGXULQJMREEEOVRIFHPHQWEDFNWRVXUIDFHGLGUHFLSURFDWHGXULQJMRE5'FHPHQWHTXLSPHQWDQGEORZGRZQ 5HOHDVH+DOOLEXUWRQ&HPHQWHUV5HPRYHODQGLQJMWLQVWDOOSDFNRIIDQG5,/'67HVW3DFNRIIWSVLIPLQ5LJGRZQGLYHUWHUYHQWOLQH1'IORZOLQHDQG EHOOQLSSOH)XQFWLRQNQLIHYDOYHDQGDQQXODU )LWWLQJRQ$FFXPXODWRUIDLOHGVKXWLQDFFXPXODWRUDQGEOHHGGRZQFOHDQXSK\GUDXOLFIOXLGGUXPSXPSHGRXW RIIORRUVXPSWRGUXPFOHDQDQGZLSHGRZQZDOOVUHSDLUEURNHQILWWLQJ&RQWLQXH1''LYHUWHU5LVHUDQG$QQXODU1'.QLIHYDOYHDQG7SXOOVSDFHUVSRRODQG VWDJHIFUDQH18:HOOKHDG%6HFWLRQWHVWVHDOVWSVLIPLQ6SRW6SDFHUVSRRODQGVSRWLQFUDQHKRLVWGLYHUWHUDQQXODUDQG7RQWRFUDGOHORRNIRU ILWWLQJVIK\GUDXOLF%RS/LIW&URVVFKDLQDQGVHFXUH'LYHUWHUDQG7RQFUDGOH&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV 6FRSHRXWFUDGOH,QVWDOOOLIWLQJSODWHRQ%23FUDQH%23FRPSRQHQWVLQWRFHOODUDQGDVVHPEOHVDPH,QVWDOODGDSWRUIODQJHRQERWWRPRIWKH%23)LQLVK FOHDQLQJSLWVEXLOGLQJSSJ.&/3+3$PXG#SHU00&RQWLQXHWR18%23VLQVWDOOFKRNHDQGNLOOYDOYHVVHWVWDFNRQZHOOKHDGIODQJHXSDQGWRUTXH EROWVLQVWDOOFKRNHDQGNLOOKRVHV4XDGFRUHSFDOLEUDWHDQGWHVWULJJDVDODUPVZLWQHVVHGE\$2*&&UHS3$&3RZHUPHFKDQLFDUULYHGWRORRNDWULJIORRU HQJLQH,QVWDOOILWWLQJVRQVWDFNKRRNXSNRRPH\OLQHVDGGIOXLGWRDFFXPXODWRUWUDFHDQGIL[FRQWUROZLUHVIUHPRWHWRDFFXPXODWRUIORZHUUDPV2SHQGRRUV DQGLQVWDOOUDPVLQFDYLWLHVJUHDVHGRRUVHDOVDQGWLJKWHQGRRUVKDQJWDUSLQFHOODUJUHDVHFKRNHPDQLIROGFKHFNSUHFKDUJHRQERWWOHVFKDUJHDFFXPXODWRU 38WHVWMRLQWDQG08GDUWDQG7,:VHWWHVWSOXJ)LOOVWDFNDQGFKRNHZLWKZDWHUIXQFWLRQUDPVIUHPRWH08WHVWILWWLQJVDQGSXUJHDLURXWRI V\VWHP3UHVVXUHXSDQGVKHOOWHVWVWDFNIODQJHOHDNRQORZHUIODQJH#SVLEOHHGRIIDQGWLJKWHQIODQJH5HWHVWVWDFNORZOHDNHGEHWZHHQDQQXODUDQG GRXEOHJDWHIODQJHDWSVLEOHHGRIIDQGWLJKWHQIODQJHUHWHVWWLJKWHQOHDN\WHVWSXPSILWWLQJVEUHDNHURQWHVWSXPSWULSSHGEOHHGHUORFNHGFORVHGDQG ZRXOGQ WRSHQEOHHGRIIDQGFKDQJHRXWEOHHGHUOLQHYDOYHUHWHVWVDPH&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV )LQLVKUHSODFLQJWHVWPDQLIROGEOHHGHUDQGZKLWH\YDOYHVKHOOWHVWSUHVVXUHXSWRSVLJRRGEOHHGRIISUHVVXUH7HVW%23(XWLOL]LQJ WHVWMWWRSVL ORZDQGSVLKLPLQHDFKDUWHG$2*&&UHS$(DUOZLWQHVVWHVWLQJ2QWHVWFKRNH+&5OHDNLQJRQKLJKSUHVVXUHWHVWF\FOHYDOYHDWWHPSWWRUHWHVW ORZHUVLQJOHJDWHERWWRPIODQJH[VSRROVWDUWHGOHDNLQJWLJKWHQIODQJHDQGUHWHVWHGJRRG7HVWORZHUSLSHUDPORZSUHVVXUHWHVWIDLOHGF\FOHUDPDQGDWWHPSW WRUHWHVWZKLWH\YDOYHVRQWHVWPDQLIROGVWDUWHGOHDNLQJDWVWHPSDFNLQJ&2VDPHSUHVVXUHXSDQGVWLOOQRWKROGLQJDWORZSUHVVXUH7,:YDOYHKDVVOLJKW OHDNFORVHGDUWDWWHPSWWRUHWHVW2SHQ/35GRRUV,QVSHFWSDFNHUVDQGWHVWMWIRUVFDUULQJJRRGFORVHUDPGRRUV3XOOWHVWSOXJLQVSHFWDQG&2JDVNHWUH LQVWDOOWHVWMWSOXJIORRGVWDFNUHWHVW/35SDVVLQJWHVW7HVWEDFNXS7,:YDOYHJRRG3HUIRUPDFFXPXODWRUWHVW3XOOWHVWMWDQGWHVWEOLQGVWSVL OHDNLQJRIIDWORZSUHVVXUH,QVLGHPDQXDOFKRNHYDOYHOHDNLQJJUHDVHDQGUHWHVWVDPHVWLOOOHDNLQJGUDLQVWDFNDQG&2LQVLGHPDQFKRNHYDOYHIORRGOLQHVDQG UHWHVWOHDNLQJEXWQRWDVEDGIXQFWLRQYDOYHDQGJUHDVHUHWHVWVDPHVWLOOOHDNLQJRIIFKHFNVXUIDFHHTXLSPHQWEORFNYDOYHVRQULJIORRUOHDNLQJFKDQJHRXW UHWHVWVDPHJRRGWHVWWHVWHOHFWULFDQGPDQFKRNHVSDVV)3WHVWVWRWDO5'WHVWHTXLSPHQWEORZGRZQOLQHVYDFRXWJDVEXVWHU87XEH3XOOWHVWMWDQGLQVWDOO ZHDUULQJ2EWDLQ5.% VORDG%+$DQG'3RQUDFNVDQGVWUDS38%+$DVSHU''0:'08%LWDQGPRWRUVFULEHRIIVHW080:''070&XWWLQJVLQ 'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV SS SS SXPSHGEEOV6[SSJ7\SH,,,/HDGFHPHQW 'ULOO KROHI W DWVXUIDFHVHFWLRQ7' SSJ S S S IROORZHGE\EEOVV[SSJ7\SH,,,7DLOFHPHQW J 5,+Z &DVLQJDVSHU GHWDLOU SSSS EXPSHGWKHSOXJEEOVLQWRFDOFXODWHGGLVSODFHPHQW) SSJ \S JS &,3KUVQRORVVHVGXULQJMREEEOVRIFHPHQWEDFNWRVXUIDFHQRORVVHVGXULQJMREIORDWVKHOG SSSJ SJ \ SVLKLPLQHDFKDUWHG$2*&&UHS$(DUOZLWQHVV &RQWLQXHWR08 %+$GRZQORDG0:VKDOORZWHVWWRROV3-60ORDGVRXUFHV5,+ZLWKUHPDLQLQJ%+$WR 'ULIW38DQGVLQJOHLQZLWKMRLQWV GULOOSLSHWR ILOOSLSHDW 08VWDQG'3DQGWRSGULYH:RUNLQJSLSHIURP &%8JSPSVLWUHDWWKLFNPXGUHWXUQVZLWK'HVFR38 .62.3DUNDW 58WHVWHTXLSPHQWILOOOLQHVFORVH835WHVW FDVLQJWRSVLIRUFKDUWHGPLQJRRGWHVWEOHHGRIISUHVVXUHRSHQUDPV EORZGRZQDQG5'WHVWHTXLSPHQWEEOVSXPSHGEEOVEOHGEDFN:DVKGRZQWDJFHPHQW# GULOOFHPHQWJSPSVLUSPN WRUTXHN:2%GULOO)&RQGHSWKDW FOHDQRXWVKRHWUDFNDQGUDWKROHWR 'ULOO QHZKROHIURP WR JSPSVLUSP NWRUTXHN:2%'LVSODFHZHOOWR.&/3RO\PHUPXGVKXWGRZQFOHDQXQGHUVKDNHUVDQGVKLSIOXLGWR,62WDQNV58DQG3HUIRUP),7WSSJVHQG FKDUWVWRVWDWHDQGHQJLQHHUGHFLVLRQPDGHWRSHUIRUPVHFRQG),73UHVVXUHXSDQGSHUIRUP),7WSVL(0:SSJVHQGWRVWDWHDQGHQJLQHHU 5'6FUHHQGRZQDQGFLUFXODWHDQGFRQGLWLRQPXGZKLOHZDLWLQJRQRUGHUVIWRZQ'ULOODKHDGI W JSPSVLUSPWTRQERWWRP 38:N62:N5RWN0:SSJ(&'SSJ'LVWDQFHWRSODQ KLJK 5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV 'ULOO KROHI W JSPSVLUSPNWTRQERWWRPNZRE0:SSJYLV(&'SSJPD[JDVX38N62N5RWN 0DLQWDLQGHJWDQJHQW&UHZFKDQJH370&%8JSPSVL530NWRUTXHZRUNLQJSLSHVORZIORZFKHFNZHOOVHHLQJVOLJKWVHHSDJH:LSHU WULS322+RQHOHYDWRUVI WR LQVLGHWKH FDVLQJQRLVVXHV&DOFXODWHGGLVSODFHPHQW6HUYLFHWKH7'GUDZZRUNVDQG,5,QVSHFWJUDEEHUGLHV DQGVDYHUVXE&OHDQVXFWLRQVFUHHQVRQERWKPXGSXPSV0RQLWRUWKHZHOOVWDWLF5,+RQHOHYDWRUVWR ORDGEEOKLYLVVZHHSLQGULOOSLSHZDVKODVW VWDQGWR ZLWKVZHHSMXVWRXWWKHELW'ULOO KROHI W JSP633SVLUSPNWTRQERWWRPNZRE0DLQWDLQGHJWDQJHQW 0:SSJYLV(&'SSJPD[JDV38N62N5RWN6ZHHSEDFNRQWLPHZLQFUHDVH&RQWGULOOLQJLQWHUPHGLDWHVHFWLRQ) 738.62.527.*30663SVL530'LIISVL74.:2%.(&'33*0:SSJ0D[JDVXQLWV3XPSHG +L9LVVZHHSZZDOQXW FRQGHW# VZHHSFDPHEDFNEEOVODWHZDLQFUHDVHLQFXWWLQJV&UHZFKDQJHKHOG3760&RQWGULOOLQJ LQWHUPHGLDWHVHFWLRQ) 7 38.62.527.*30663SVL530'LIISVL74.:2%.(&'33*0:SSJ 0D[JDVXQLWV# &RQWGULOOLQJLQWHUPHGLDWHVHFWLRQ) 6HHQJDVVSLNH# XQLWVEDFNJURXQGJDVKHOGFRQVLVWHQWDW XQLWVDQGFRQQHFWLRQJDVVWDUWHGFOLPELQJ'HFLVLRQZDVPDGHWRGXVWXS0:WRSSJZKLOHGULOOLQJDKHDG&XUUHQWGHSWKRI 38.62.527 .*30663SVL530'LIISVL74.:2%.(&'33*0:SSJ0D[JDVXQLWV'LVWDQFHWRZHOOSODQ /RZ /HIW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV 'ULOO KROHI W WRQGZLSHULQWHUYDOJSPSVLUSPNWTRQERWWRPNZRE0:SSJYLV(&'SSJPD[JDVX 38N62N5RWN/DVWVXUYH\ ORZ ULJKW&LUFXODWHWKHKROHFOHDQDQGFRQGLWLRQWKHPXGLQFUHDVHWKHPXGZWIURPSSJWRSSJZLWK EDULWHJSPSVLUSPNWRUTXHZRUNLQJSLSHUHFRUGQHZSDUDPHWHUVDQG635V)ORZFKHFNWKHZHOOVHHLQJVRPHVOLJKWVHHSDJH%'7'3XOO ZLSHUWULSRQHOHYDWRUVI NRYHUSXOODW DWWHPSWWRZRUNIUHH087'DQG(.HOO\WRKDYHHQRXJKZRUNLQJURRPSXPSJSPSVLURWDWH DQGZRUNGRZQXQWLOIUHH%DFNUHDPIURP WR DIHZLQFKHVHDFKWLPHZRUNLQJWKUXWLJKWVSRWDQGFOHDQLQJXSVDPHWUDQVLWLRQIURPEHOXJD)WR) JSPSVLUSPNWRUTXHPD[JDVDWXQLWV'HFLVLRQPDGHWRUXQWREWWPDQGZWXS/'(.HOO\5,+WR &%8JSPURWDWLQJ USPDQGZRUNLQJSLSHPD[JDVXUHFHGLQJWRX5,+WRERWWRP# ZDVKLQJODVWVWDQGGRZQ&LUFXODWHJSPSVLUSPNWRUTXH ZRUNLQJSLSHZWXSIURPWRZLWKEDULWHDW%8XREWDLQQHZ635VIORZFKHFNWKHZHOOVWDWLF%'7'1RORVVHV322+RQHOHYDWRUVI WR VHHLQJNRYHUSXOODWWHPSWWRSXPSRXWRIWKHKROHJSPSVLZLWKNRYHUSXOO%522+IURP WR 6KRH3XPSLQJJSPSVL USPNWRNWRUTXH&LUF%8DWWKHVKRH*30633SVL53074.0D[JDVXQLWV3XOOHGLQVLGHWKHVKRHDQGSDUNHGWKHVWULQJ DW &LUFXODWHGDFURVVWKHKROHRQWKH776HUYLFHGULJ*UHDVHGFURZQEORFNV7'6ZDVKSLSH':.6EUDNHOLQNDJHDQGGULYHVKDIW&KDQJHGRXW7'6 JUDEEHUER[SLVWRQ6WDWLFORVVUDWH ESK5,+RQHOHYDWRUV) 7 ZQRLVVXHV+DGFDOFXODWHGSLSHGLVSODFHPHQWIRUWKHWULS38.62 .087'6EURNHFLUF&%8*30633SVL53074.&UHZFKDQJHKHOG3760&RQW&%8*30633SVL53074.0D[ JDVXQLWV&RQW7,+RQHOHYDWRUV) ZQRLVVXHV087'6ZDVKHGODVWVWGWRERWWRPDW 1RILOO38.62.527.&%8PDGHD FRQQHFWLRQ3XPSHGEEOVRISSJ+L9LVVZHHSZZDOQXW FRQGHWZKLOHGULOOLQJGRZQVWGVZHHSFDPHEDFNEEOVODWHZDLQFUHDVHLQFXWWLQJV &OD\*30633SVL53074.(&'SSJ0D[JDVXQLWV&RQWGLUHFWLRQDOGULOOLQJLQWHUPHGLDWHKROH) WRFXUUHQWGHSWKRI 38.62.527.*30633SVL530:2%.74.(&'SSJ0:0D[JDVXQLWV'LVWDQFHWRZHOOSODQ /RZ 5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV JS S S GRZQFOHDQXQGHUVKDNHUVDQGVKLSIOXLGWR,62WDQNV58DQG3HUIRUP),7WSSJVHQGTS \S SS FKDUWVWRVWDWHDQGHQJLQHHUGHFLVLRQPDGHWRSHUIRUPVHFRQG),73UHVVXUHXSDQGSHUIRUP),7WSVL(0:SSJVHQGWRVWDWHDQGHQJLQHHU &RQWLQXHGULOOLQJKROH) WR 0DLQWDLQGHJWDQJHQW*30633SVL530:2%.74.0:9LV(&'SSJ 0D[JDVX38.62.527.'ULOOLQJKROH) WR 0DLQWDLQGHJWDQJHQW*30633SVL530:2%.74 .0:9LV(&'SSJ0D[JDVX38.62.527.$GGGUXPV%DUDOXEH*6WRDVVLVWZLWKVOLGLQJVORZO\GXVWXSWKH0:I WRSSJZKLOHGULOOLQJ&RQWGULOOLQJLQWHUPHGLDWHKROH) 7 *30633SVL'LIISVL53074.:2%.(&'SSJ 0:SSJ0D[JDVXQLWV38.62.527.&LUFXODWHGERWWRPVXSLQFUHDVHG0:WRSSJREWDLQHGVXUYH\DQG635 VRQERWWRP6KXW GRZQSXPSVIORZFKHFNZHOO6OLJKWVHHSDJH*30633SVL53074.0D[JDVXQLWV6WDUWHG ZLSHUWULS322+RQHOHYDWRUV) 7 KDG.RYHUSXOODW ZRUNHGWKURXJKRQHOHYDWRUV+DG.RYHUSXOODW ZHUHXQDEOHWRSXOOWKURXJKRQHOHYDWRUV087'6DQG ZDVKHGWKURXJKPXOWLSOHWLJKWVSRWV)7 $W%8VWURNHVKROHXQORDGHGZLWKFXWWLQJVDWWKHVKDNHUV&OD\*30633SVL38.62 .&UHZFKDQJHKHOG3760$WWHPSWHGWRFRQWZDVKLQJRXWRIWKHKROHZQROXFNNLFNHGLQURWDU\DQGKDGWR%522+) WRFXUUHQWGHSWKRI *30633SVL53074.(&'SSJ0:SSJ0D[JDVXQLWV38.62.527.'LVWDQFHWRZHOOSODQ +LJK 5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWLQXHWR%522+IURP WR DWWKHGHSWKZHVWDUWHG%5IURPSUHYLRXVZLSHULQWHUYDOSXPSLQJJSPSVLUSPNWRUTXHPD[JDV XEEOORVVHV%522+6HUYLFHWKH7'FURZQVKHDYHVDQGGUDZZRUNVZKLOHFLUFXODWLQJJSPSVL5,+RQHOHYDWRUVIURP ZDVKODVWVWDQGWR ERWWRP# VHHLQJ ILOOORDGEEOKLYLVVZHHSDQGFLUFXODWHRXWWKHELWEEOORVVHV7,+&RQWLQXHWRGULOO KROHIURP WRWR 6ZHHS EDFNVWNVODWHZLQFUHDVHPRVWO\FOD\*30633SVL530:2%.74.0:9LV(&'SSJ0D[JDVX38 .62.527.6XEPLW%23WHVWQRWLILFDWLRQWR$2*&&&RQWLQXHWRGULOO KROHIURP WRWR *30633SVL530:2% .74.0:(&'SSJ0D[JDVX38.62.527.'XULQJFRQQHFWLRQDW FOHDQERWKVXFWLRQVFUHHQVRQPXGSXPSV GXHWRSUHVVXUHIOXFWXDWLRQ&RQWGULOOLQJLQWHUPHGLDWHVHFWLRQ) 7VWDUWHGRXUSHU GURSDW *30633SVL'LIISVL 53074.:2%.(&'SSJ0:SSJ0D[JDVXQLWV38.62.527.&UHZFKDQJHKHOG3760&RQWGULOOLQJ LQWHUPHGLDWHVHFWLRQ) WR7'# *30633SVL'LIISVL53074.:2%.(&'SSJ0:SSJ0D[JDV XQLWV38.62.527.&LUFKROHFOHDQREWDLQHGVXUYH\JRW635 V)ORZFKHFNZHOOVOLJKWVHHSDJH%522+) WRFXUUHQWGHSWKRI *30 633SVL53074.(&'SSJ0:SSJ0D[JDVXQLWV38.62.527.'LVWDQFHWRZHOOSODQ /RZ 5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV %522+) WR 3XOOVORZRUZRUNVWULQJZKHQWKHKROHXQORDGVZLWKFOD\DWWKHVKDNHUVDQGOHWFOHDQXSEHIRUHFRQWLQXLQJJSPSVL530 74N(&'SSJ0:YLVPD[JDVX%**X1RWHWRRNPLQWR&27'JUDEEHUGLHVDQGWRVHFXUHVHUYLFHORRS%522+) WR 3XOOVORZRUZRUNVWULQJZKHQWKHKROHXQORDGVZLWKFOD\DWWKHVKDNHUVDQGOHWFOHDQXSEHIRUHFRQWLQXLQJ&%8WKHQSXOOLQWRFDVLQJSDUNLQJ# JSPSVL53074N(&'SSJ0:YLVPD[JDVXEEOORVVHV%522+%'7'6HUYLFHWKH7'EORFNVDQGGUDZ ZRUNVLQVSHFWWKHEUDNHOLQNDJH7,+RQHOHYDWRUV) 7 KDG.VHWGRZQ087'6ZDVKHGUHDPHGWKURXJKWLJKWVSRW*30633SVL 53074.38.62.527.&RQW7,+RQHOHYDWRUV) 7 KDG.VHWGRZQ087'6ZDVKHGUHDPHG) WR7'DW +DGFDOFXODWHGSLSHGLVSODFHPHQWIRUWKHWULS*30633SVL53074.0D[JDVXQLWV38.62.527.&%8SXPSHG EEOSSJ+L9LVVZHHSZZDOQXWVZHHSFDPHEDFNEEOVODWHZDLQFUHDVHLQFXWWLQJV/RVW03URGZDVKSXPSZKLOHFKDVLQJVZHHSGXHWRORYH MR\FRXSOHUIDLOXUH&LUFWLOOVKDNHUVFOHDQHGXS*30633SVL53074.0D[JDVXQLWV)ORZFKHFNHGZHOOVOLJKWVHHSDJH322+) 7 DOWHUQDWLQJ'3EUHDNVEORZGRZQ7'638.62.&UHZFKDQJHKHOG3760&RQW322+) 7 6KRHZQRLVVXHV)ORZFKHFNHG DWWKHVKRHVOLJKWVHHSDJH38.62.5HVXPHG322+) 7 38.62.5DFNHGEDFN+:'3DQGMDUV&XUUHQWO\UDFNLQJEDFNIOH[ FROODUVDW 38.62.&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV 3-60UHPRYHVRXUFHVSOXJLQDQGUHDG0:'LQVSHFWDQG/'UHPDLQLQJ%+$ ELWJUDGH %7$;&7%+$&OHDUDQGFOHDQWKHULJIORRUORDG RXWWRROVDQGFOHDUFDWZDON&DOFXODWHGGLVSODFHPHQWRQ722+6SRWDQG58+(6(OLQH380QHPRQLFORJJLQJWRROV+)1'-ODWFK2%&(1:677:7,6 2%&(1:677*DPPD VWDQGRIIMDU HQKDQFHU:366DQGKHDG 0RQLWRUZHOOZLWKWULSWDQNESKORVVUDWH5,+ZLWKORJJLQJWRROVWDJ7'# (/0ZLWKQRLVVXHV322+ORJJLQJDWISPWR DWWKHVKRH322+/'WRROV5'(OLQH0RQLWRUZHOOZLWKWULSWDQNFRQWLQXHVZLWKESKORVVUDWH 4XDGFRUHSRQORFDWLRQFDOLEUDWHDQGWHVWHGWKHULJJDVDODUPV'UDLQVWDFNSXOOZHDUEXVKLQJ58WHVWHTXLSPHQW08WHVWMW SOXJVHWWHVWSOXJILOOHG VWDFNSXUJHGDLUIURPOLQHV FKRNHPDQLIROG6KHOOWHVWHGVWDFNRN3HUIRUPHGIXOO%23WHVWDVSHU$2*&&UHJXODWLRQV/RZSVL+LJKIRUPLQ SVLRQDQQXODU+DG)3RQWHVWGXHWHVWSXPS*RRGWHVW:LWQHVVZDYHGE\$2*&&-LP5HJJ5'WHVWLQJHTXLS%OHZGRZQFKRNHPDQLIROGVDQG PXGOLQHVSXOOHGWHVWSOXJLQVWDOOHGZHDUULQJ$GMXVWHGSUHVVXUHRQ7'6URERWLFV6WDJHG%+$RQFDWZDON38 08%+$083'&ELWELWVXE DQGVWDEDVSHU''&UHZFKDQJHKHOG3760DQGZHHNO\VDIHW\PHHWLQJZULJFUHZ5,+Z%+$FOHDQRXWDVV\)VXUIDFH7 ILOOHGSLSHDGMXVWHGPD[ 74RQ7'6WR.38.62.&RQW5,+) 7 38.62.6OLS FXWGULOOOLQH ZUDSV&KDQJHGRXWZHLJKWLQGLFDWRUUHURXWHG +<'OLQHVVRWKHUXQDERYHWKHGULOOOLQH6HUYLFHGULJ*UHDVHGFURZQEORFNV':.6EUDNHOLQNDJHDQGGLYHVKDIW&KHFNHGSXOVDWLRQGDPSHQHUSUHVVXUHV 03SVL03SVL5HVHWFURZQRPDWLFDQGFDOLEUDWHGEORFNKHLJKW&RQW5,+Z%+$FOHDQRXWDVV\) WRFXUUHQWGHSWKRI &XWWLQJV LQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWLQXH5,+ZLWK FOHDQRXWDVV\IURP WR ILOOSLSHDW ZDVKODVWVWDQG08VLQJOHZDVKWRERWWRP# WDJ ILOO38.62 .527.%%/ORVVHV7,+&LUFXODWHJSPSVLUSPNWRUTXHZRUNLQJSLSHDW%8LQFUHDVHLQFXWWLQJVDWVKDNHUVZLWKPD[JDV XSXPSEEOKLYLVVZHHSZSSEZDOQXWEDFNVWNVODWHZLQFUHDVHFLUFXODWHXQWLOVKDNHUVFOHDQUHFRUG635VIORZFKHFNZHOOVOLJKWVHHSDJH %'7'EEOORVVHV/'VLQJOH722+RQHOHYDWRUVIURP WR WKHJDOORQSXOVDWLRQGDPSHUK\GUDXOLFILWWLQJIRUWKH$QQXODUVWDUWHGGULSSLQJVWDE )269FORVH835%OHHGRIIDFFXPXODWRUUHPRYHGDPSHULQVWDOOUDWHGSOXJILWWLQJUHHQHUJL]HDFFXPXODWRURSHQ835UHPRYH)269PLQ&RQWLQXHWR 322+) 7 UDFNHGEDFN+:'3/'MDUVIOH[FROODUVVWDEELWVXEDQGELW&DOFXODWHGKROHILOOIRUWKHWULS3862.&OHDQHG FOHDUHGULJ IORRUGUDLQHGVWDFNSXOOHGZHDUULQJ08WHVWMW WHVWSOXJ&KDQJHGRXWXSSHUUDPVIURPWR58WHVWLQJHTXLS6HWWHVWSOXJILOOHGVWDFNZZDWHU SXUJHGRXWDLUIURPV\VWHP3HUIRUPHGWHVWRQWHVWMW$QQXODUSVL/RZSVL+LJKIRUPLQ8SSHUSLSHUDPVSVL/RZSVL+LJKIRUPLQ 2N3XOOHGDQG5'WHVWMWDQGWHVWLQJHTXLS%OHZGRZQOLQHV%URXJKWRXWZHOOKHDG5HSDQGFDVLQJKDQG087,:WRGULYHVXE58:27&2FDVLQJ KDQGOLQJHTXLS&UHZFKDQJHKHOG3760)LQLVKHG58FDVLQJKDQGOLQJHTXLS58ILOOXSOLQHJRWFHQWUDOL]HUVWRULJIORRU38ODQGLQJMWDQGKDQJHU WRUTXHGXSSXSRQWRSRIODQGLQJMW'XPP\UXQKDQJHUDQGPDUNHGODQGLQJMWZWDSH/'ODQGLQJMWDQGKDQJHU+HOG3-60RQUXQQLQJFDVLQJZULJFUHZ :27&29HWFRDQG'6038VKRHWUDFN%DNHU/RNFRQQHFWLRQVWHVWHGIORDWVRN&RQWUXQQLQJ´':&&SSI/FDVLQJDVSHUUXQWDOO\08WRUTXH IWOEV)LOOLQJRQWKHIO\DQGWRSSLQJRIIHYHU\MWV5XQQLQJVSHHG SHUPLQ&XUUHQWGHSWKRI 38.62.&XWWLQJVLQ'UDJRQ%R[HV EEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWUXQQLQJ´':&&/FDVLQJDVSHUUXQWDOO\IURP WR 7RUTXHIWOEV)LOORQWKHIO\DQGWRSRIIHYHU\MWV5,+ISPORVVUDWH DYHUDJLQJESK08VZHGJHDQG7'&%8VWDJHSXPSWRESPSVLUHFRUGSDUDPHWHUVEHIRUHH[LWLQJWKHVKRHUSPNNNWRUTXH%' 7'38.62.527.EEOORVVHV&%8&RQWUXQQLQJ´':&&/FDVLQJDVSHUUXQWDOO\IURP WR #MRLQW08 VZHOO SDFNHUFRQWLQXH5,+WR DWISPESKORVVUDWH5,+&UHZFKDQJH370&RQWUXQQLQJ´':&&/FDVLQJDVSHUUXQWDOO\IURP WR #MRLQW38N62N08VZHGJHDQG7'&%8VWDJHSXPSWRESPSVLZRUNLQJSLSHVORZ%'7'&RQWUXQQLQJ´':&&/FDVLQJ DVSHUUXQWDOO\IURP WR ZLWKQRLVVXHV08VSDUHMRLQW62DQGWDJERWWRPDW SXOOEDFNXSKROH/'VLQJOH08ODQGLQJMRLQWKDQJHU62DQG ODQGKDQJHUSXWWLQJVKRHDW 08FLUFVZHGJHDQGWRSGULYH%UHDNFLUFVWDJLQJXSWRJSPSVL:RUNSLSHRFFDVLRQDOO\KDQJHUWLJKWILWLQ VWDFNVROLPLWHGRQSLSHVWURNH+DGDPD[RIXQLWVDWERWWRPVXS/'OLQHUDQGVWDJHFHPHQWWUXFNVUHPRYHG:HDWKHUIRUGWRQJVIURPULJIORRU6WDJH SOXJODXQFKHUDQGORDGSOXJV58EDLOH[WHQVLRQVVKXWGRZQSXPSEOHZGRZQ7'658FPWKHDGWRVWXPSEOHZDLUEDFNWRFPWWUXFNWRYHULI\OLQHZDV FOHDU+HOG3-60RQFPWMRE3XPSHGEEOVRIZDWHUDKHDGDQGFKHFNHGIRUOHDNV+(6SUHVVXUHWHVWHGOLQHVDWSVL/RZSVL+LJKRN+(6SXPSHG EEOVRISSJ7XQHGVSDFHUDWESPSVLGURSSHGERWWRPSOXJDQGSXPSHGEEOVV[RISSJ7\SH,,,OHDGFPWDWESPSVL)ROORZHG E\EEOVV[RISSJ7\SH,,,WDLOFPWDWESPSVL+(6GURSSHGWRSSOXJWKHQGLVSODFHGZSSJ.&/3+3$PXGDWESPSVL 6HHQERWWRPODQGDQGEXUVWEEOVLQWRGLVSODFHPHQW/DQGHGKDQJHURQVHDWEEOVLQWRGLVSODFHPHQW6ORZHGSXPSWRESPZEEOVWRJR%XPSHG WKHSOXJEEOVLQWRGLVSODFHPHQWFDOFXODWHGEEOV+HOGSVL)&3RISVLIRUPLQEOHGRIIDQGIORDWVKHOG%OHGEDFNEEOVWRWUXFN+DG EEOVRIVSDFHUUHWXUQVWRVXUIDFHDQGEEOVRIOHDGFPWWRVXUIDFH$GGHGOEVV[RI%ULGJH0DNHUWROHDGFPW0L[ZDWHUWHPS3XPSHGH[FHVVRQ ERWKOHDG WDLOFPW/RVWEEOVWKURXJKRXWWKHMRE'LGUHFLSURFDWHIRURIWKHMRE&,3DWKUV:DVKHGXS5'DQGUHOHDVHG+(6 FPW%DFNHGRXWODQGLQJMWDQG/'2SHQHGDQQXOXVYDOYHGUDLQHG IOXVKHGVWDFNZEODFNZDWHU08SDFNRIIUXQQLQJWRROSDFNRIIWR;2DQGVWGRI'3 6HWSDFNRII5,/' V7HVWHGSDFNRIISVL/RZPLQSVL+LJKPLQRN/'SDFNRIIUXQQLQJWRRO&ORVHGEOLQGUDPEOHGRIINRRPH\RSHQHGXSSHU UDPGRRUVFKDQJHGUDPVIURPWRVROLGERGLHVFKHFNVHDOVEXWWRQHGXSUDPGRRUV5HHQHUJL]HGNRRPH\VHWWHVWSOXJRQWHVWMW)LOOHGVWDFNZ ZDWHUDQGSXUJHGRXWDLU&XUUHQWO\58WHVWHTXLSWRWHVWXSSHUUDPV&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV SJTS HUIRUPHGIXOO%23WHVWDVSHU$2*&&UHJXODWLRQV JM J JJ &RQWUXQQLQJ´':&&SSI/FDVLQJDVSHUUXQWDOO\ S %OHGEDFNEEOVWRWUXFN+DG EEOVRIVSDFHUUHWXUQVWRVXUIDFHDQGEEOVRIOHDGFPWWRVXUIDFHU SSSJ SS SXPSHGEEOVV[RISSJ7\SH,,,OHDGFPWDWESPSVL)ROORZHGSSJ S S E\EEOVV[RISSJ7\SH,,,WDLOFPW /RVWEEOVWKURXJKRXWWKHMRE &KDQJHGRXWXSSHUUDPVIURPWR5 SS ZEEOVWRJR%XPSHGJSS WKHSOXJEEOVLQWRGLVSODFHPHQWFDOFXODWHGEEOVSJ S SS GRIIDQGIORDWVKHOGG 6HWWHVWSOXJ58WHVWHTXLSPHQWIORRGHGVWDFNWHVWHGXSSHUGRRUVHDOVDQGUDPVDWIRUPLQHDFKJRRGWHVW5'WHVWHTXLSPHQW&&,WUDQVSRUWHG 6SHUU\GLUHFWLRQDOWRROVWRORFDWLRQDQGRIIORDGHGVDPH5DFNHGDQGWDOOLHGMQWVRI&'6'36SHUU\5HSWHVWHGGLUHFWLRQDOWRROVWREHXVHGRQQH[W %+$EOHGRIINRRPH\XQLWDQGULJPHFKDQLFUHSODFHGEODGGHULQNRRPH\ERWWOH2EWDLQHGDSSURYDOIURP$2*&&-LP5HJJWRSHUIRUPZHHNO\%23WHVWHDUO\DW QRWLILHG4XDGFR5HSDQGPDGHDUUDQJHPHQWVWRIO\KLPRXWIRUJDVDODUPWHVWLQJDGMXVWHGFHPHQWPDQLIROGRQULJIORRU&2DLUOLQHYDOYHRQULJIORRU ORDGHGDQGUHPRYHGH[FHVVFDVLQJDQGXVHG6SHUU\WRROVIURPORFDWLRQVWDUWEULQJLQJLQOLQHUDQGUDFNLQJVDPHVHWWHVWSOXJ)ORRGHGVWDFNVXUIDFH OLQHVDQGFKRNHPDQLIROG&\FOHGYDOYHVDQGSXUJHGDLU5HPRYHGWKUHDGSURWHFWRUVIURPOLQHUIRUGULIWLQJ6ZDSSLQJWRDOWHUQDWH$)(:%6IRUUHPDLQGHU RIZHOO 7HVWHGDOO%23(DWSVLORZSVLKLJKRQDQQXODUSHUIRUPHGGUDZGRZQWHVW1RIDLOXUHV4XDGFR5HSWHVWHGDOODXGLRYLVXDOJDVDODUPV5LJ GRZQWHVWHTXLSPHQWSXOOHGWHVWSOXJDQGVHW,'ZHDUULQJ/'WHVWMRLQWEOHZGRZQVXUIDFHOLQHVDQGWRSGULYH6WDJHG6SHUU\WRROVRQFDWZDON;2 VDQGELW WRULJIORRUKHOG3-60ZLWK6SHUU\5HSVDQGULJFUHZ08GLUHFWLRQDO%+$DVIROORZV+'%6*7'.3'&MHWWHGZLWK[ VPXGPRWRUZLWKEHQG '0*0$'5&713:'DQG70+2&3OXJJHGLQDQGXSORDGHGGDWDWRROV6KDOORZSXOVHWHVWHGWRROVRN/RDGHGVRXUFHV38IOH[FROODUVMDUVDQG5,+ Z+:'37 38.62.&UHZFKDQJHKHOG3760&RQW5,+Z%+$7 38.62.38DQGVLQJOHGLQWKHKROHZ'3) 7 MWV)LOOHGSLSHORDGHGUDFNVZSLSHDQGVWUDSSHGDQGWDOOLHG'338.62.&RQW38DQGVLQJOHGLQWKHKROHZ'3) WR FXUUHQWGHSWKRI 38.62.&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQW38VLQJOHLQKROH&'6'3IURP WR 08WRSGULYHDQGILOOHGSLSHEOHZGRZQWRSGULYH&RQW7,+ZLWKVWDQGV'3IURP WR¶DQG WDJJHGXS.RQFHPHQWWRSRISOXJVDW¶08WRSGULYHILOOHGSLSHZDVKHGUHDPHGGRZQWR¶ZLWKJSPSVLUSPIWOEVWRUTXH 6HHLQJWR.ZRE&%8DW VZDSWROLQHUVRQSXPS6KXWGRZQ58FKDUWUHFRUGHUDLURXWSXPSDQGWHVWUXQOLQHXSRQNLOODQGGULOOVWULQJ FORVHGXSSHUUDPV3XPSHGEEOVWRDFKLHYHSVLRQFDVLQJKHOGPLQRQFKDUW*RRGWHVW%OHGEDFNEEOVRSHQHGXSSHUUDPV5'WHVW HTXLSPHQWOLQHGXSWRGULOO8SZW.GZQZW.ZLWKQRSXPS0DGHKRRNGULOOHGFHPHQWDQGIORDWHTXLSPHQWWR UDWKROHFHPHQWWR WKHQ QHZIRUPDWLRQWR .ZREJSPSVLWRUSPWRIWOEVWRUTXHIWKU5230:YLV(&'DWSSJ%**&%8DW JSPSVLUSPIWOEVRIIERWWWRUTXHPD[JDVXQLWVDWERWWRPV:LWKKROHFOHDQVKXWGRZQDQG58FKDUWUHFRUGHU&ORVHXSSHUUDPVOLQHXS SXPSRQNLOODQGGULOOVWULQJSXPSHGWRWDOEEOVDQGDFKLHYHGSVLIRU),7(0:RISSJ/27(0:RISSJDWSVL%OHGGRZQWR SVLRYHUPLQXWHVEOHGEDFNEEOVVHQWGDWDWR'ULOOLQJ(QJLQHHUDSSURYHGWRGULOODKHDGE\$2*&&5'WHVWHTXLSPHQWRSHQHGUDPVOLQHGXSWR GULOO5HVXPHGGULOOLQJKROHIURP WR URWDWLQJZREWR.JSPSVLUSPIWOEVRQERWWWRUTXHWRIWKU5230: YLV(&' VDWSSJPD[JDVXQLWV38.62.527.&UHZFKDQJHKHOG3760&RQWGULOOLQJSURGXFWLRQKROH) 7 *30633SVL5302QERWWRP74.523WR0:YLV(&' VSSJPD[JDVXQLWV38.62.527. 'LVWDQFHWRZHOOSODQ /RZ 5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWGULOOLQJSURGXFWLRQKROHIURP WR URWDWLQJZRE.JSPSVLUSPIWOEVRQERWWWRUTXHWRIWKU523VOLGLQJZRE. JSPSVLSVLGLIIIWKU5230:YLV(&' VDWSSJ%**XQLWVPD[JDVXQLWVDW &RQWGULOOLQJSURGXFWLRQKROH IURP WR URWDWLQJZRE.JSPSVLUSPIWOEVRQERWWWRUTXHWRIWKU5230:YLV(&' VDWSSJ%** XQLWVPD[JDVXQLWVDW LQWRWKH7\RQHN7DW &%8IRUZLSHUWULSREWDLQHGVXUYH\RQERWWRPJRW635 VIORZFKHFNHGZHOO VWDWLF*30 633SVL53074.322+RQHOHYDWRUV) 7 HQFRXQWHUHGPXOWLSOHWLJKWVSRWVZRUNHGWKURXJKRQHOHYDWRUV+DGFDOFXODWHGKROH ILOOIRUWKHWULS38.62.6HUYLFHGULJ*UHDVHGFURZQEORFNV7'6ZDVKSLSH':.6DQGGULYHVKDIW&RQWLQXHGZGLDJQRVWLFWHVWLQJRI(&0RQ 'HWURLWGLHVHOVHULHVGUDZZRUNVPRWRU5HPRYHG(&0DQGLQVWDOOHG(&0RIIULJ VGUDZZRUNVPRWRU1RWLFHGVLJQLILFDQWLQFUHDVHLQSRZHUIURPGUDZ ZRUNVPRWRU6OLSDQGFXWGULOOOLQHZUDSV &DOLEUDWHGKRRNORDGDQGEORFNKHLJKW5HVHWFURZQRPDWLF5,+) 7 +DG.VHWGRZQDW 087'6ZDVKHGUHDPHGWKURXJKWLJKWVSRW38.62.&UHZFKDQJHKHOG3760&RQW5,+) 7 +DG.VHWGRZQ087'6 ZDVKHGUHDPHGWKURXJKWLJKWVSRW# &RQW5,+) 7 :DVKHGODVWVWGWRERWWRPWDJJHGILOODW 3XPSHGEEO+L9LVVZHHSZ ZDOQXW FRQGHW+DGDVLJQLILFDQWLQFUHDVHLQFXWWLQJVSULRUWR%80RVWO\ILQHFRDO6ZHHSFDPHEDFNRQWLPHZDLQFUHDVHLQFXWWLQJV*30633 SVL53074.(&'SSJ0D[JDVXQLWV38.62.527.&RQW'LUHFWLRQDO'ULOOLQJ´SURGXFWLRQKROHDVSHUZS ) WRFXUUHQWGHSWKRI *30633SVL530:2%.74.(&'SSJ0:SSJ0D[JDVXQLWV38.62. 527.'LVWDQFHWRZHOOSODQ /RZ /HIW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV *RRGWHVW TJ SXPSHGWRWDOEEOVDQGDFKLHYHGSVLIRU),7(0:RISSJ/27(0:RISSJDWSVL SSS V3XPSHGEEOVWRDFKLHYHSVLRQFDVLQJKHOGPLQRQFKDUW DSSURYHGWRGULOODKHDGE\$2*&& SSSJ HVWHGDOO%23(DWSVLORZSVLKLJK &RQWGULOOLQJ´KROHIURP¶WR 5RWDWLQJZRE.JSPSVLUSPIWOEVRQERWWWRUTXHWRIWKU5230:YLV %**XQLWVPD[JDVXQLWVDW &RQWGULOOLQJ´KROHIURP WR 5RWDWLQJZRE.JSPSVLUSPIWOEVRQERWW WRUTXHWRIWKU5236OLGLQJZRE.JSPSVLSVLGLIIIWKU5230:YLV%**XQLWVPD[JDVXQLWVDW¶+DGD VLJQLILFDQWVKRZRIFRDORQVKDNHUVZLWKJDVVSLNHDW XQLWVDW DQGXQLWVDW KDGQRFRDOEXWZHUHERWWRPVXSDIWHUFRQQHFWLRQV$OVR VDZVRPHVOLJKWIORZGXULQJFRQQHFWLRQDW ,QFUHDVHG0:WRSSJZKLOHGULOOLQJDKHDG&RQWGULOOLQJ´KROH) 7 ZKLOHFRQWWRGXVWXS 0:IURPSSJWRSSJDQGWKHQSSJGXHWRPRGHUDWHIORZDQGKLJKFRQQHFWLRQJDV*30633SVL'LIISVL53074. :2%.0D[JDVXQLWV(&'SSJ38.62.527.&RQWGXVWLQJXS0:WRSSJ*30633SVL53074.0D[ JDVXQLWV&UHZFKDQJHKHOG3760)LQLVKHGGXVWLQJXS0:WRSSJ6KXWGRZQWKHSXPSVIORZFKHFNHGZHOOKDGVOLJKWIORZ5HVXPHGFLUFXODWLQJ DQGGXVWLQJ0:XSWRSSJ+DGXQLWVRIJDVDW%82QFHZHKDGDSSJ0:DOOWKHZD\DURXQGVKXWGRZQSXPSV)ORZFKHFNHGZHOOVWLOOKDG VOLJKWIORZEXWKDGVORZHGGRZQLPPHQVHO\0DGHGHFLVLRQWREULQJ0:WRSSJUHVXPHGFLUFXODWLQJDQGZHLJKWLQJXSPXGV\VWHPWRSSJ6KXWGRZQ SXPSVIORZFKHFNHGZHOOVWDWLF*RW635 VSXOOHGVWGVZFRUUHFWKROHILOOEOHZGRZQ7'6322+RQHOHYDWRUV) WRFXUUHQWGHSWKRI 38. 62.+DGWRZDVKUHDPWKURXJKWLJKWVSRWDW &RDO'LVWDQFHWRZHOOSODQ /RZ5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV $W LQVLGHFDVLQJVHUYLFHGULJDQGWRSGULYHDGMXVWHGOLQNWLOWWREHWWHUFOHDUVWXPSZLWKHOHYDWRUV7,+RQHOHYDWRUVIURP WR ZLWKQRLVVXH (PSWLHGWULSWDQNDQGILOOHGSLSHZKLOHVLWWLQJEHWZHHQWR FRDOV&RQW7,+GZQZW.QRLVVXHVDW ZKHUHLWZDVWLJKWSXOOLQJXSKROHFRDO$W VHWGRZQWLPHVLQDFRDOFRDOIURP WR 8SZW.GZQZW.DEOHWRZRUNWKURXJKRQHOHYDWRUVGRZQWR 08WRSGULYHRQODVWVWDQG DQGILOOHGSLSHZDVKHGDQGUHDPHGGRZQVORZO\WRERWWRPDW VHHLQJLQFUHDVHGSXPSSUHVVXUHDQGWRUTXHVDQGZLWKFOD\PDWUL[PRVWOLNHO\ VZHOOLQJ3XPSHGDEEOKLYLVQXWSOXJVZHHSDURXQGDWJSPSVLUSPIWOEVRIIERWWRPWRUTXH6DZDPD[RIXQLWVJDVMXVWSULRUWR ERWWRPVXSKROHXQORDGHGZLWKLQFUHDVHLQVPDOOFRDOFKLSVDWERWWRPVXSIROORZHGZLWKDJRRGDPRXQWRIILQHKHDY\VDQGVLOW6ZHHSFDPHEDFNEEOV ODWHZLWKDLQFUHDVHLQFXWWLQJV%**DWXQLWVZKHQZHVKXWGRZQSXPSV&RQWFLUFXODWLQJZKLOHGLVFXVVLQJIRUZDUGSODQZLWK'ULOOLQJ(QJLQHHU'HFLVLRQ PDGHWR322+DQGUHWHVW%23(DWSVLGXHWRSRWHQWLDOERWWRPKROHSUHVVXUHGHHSHULQWKHZHOO0DGHSURSHUQRWLILFDWLRQVWR$2*&&VKXWGRZQDQGIORZ FKHFNHGZHOO6HHLQJVOLJKWIORZRYHUPLQXWHV&%8RQHPRUHWLPHZLWKDPD[RIXQLWVDWERWWRPVXS)ORZFKHFNHGZHOOPLQXWHVVHHLQJVOLJKWIORZ FRQWWRFLUFDWJSPSVLUSPIWOEVRIIERWWWRUTXHDQGLQFUHDVHG0:IURPWRSSJ(&' VDW%**DWXQLWVZLWKLQRXW VKXWGRZQDQGIORZFKHFNHGVWLOOVHHLQJVOLJKWIORZWKDWZHQWVWDWLFRYHUPLQXWHV1RWLILHG'ULOOLQJ(QJLQHHUGUDLQHG%23VWDFNDQGJRWIORZUDWHDWDQQXOXV YDOYH,QLWLDOUDWHDWESKPLQODWHUESKWKHQZHQWPLQXWHVWRJHWKDOIYLVFXS&%8DJDLQDWJSPSVLDQGKDGDPD[RIXQLWVDWERWWRPV XSZKLFKGURSSHGWRXQLWVDWVKXWGRZQ)ORZFKHFNHGZHOOKDGVDPHUHVXOWVVOLJKWIORZWKDWZHQWVWDWLFRYHUPLQXWHV1RWLILHGDQGGLVFXVVHGZLWK'ULOOLQJ (QJLQHHUGHFLVLRQPDGHWRSXOOXSKROHLQWRFDVLQJIORZFKHFNWKHQWHVW%23(DVSODQQHG3XOOHGXSKROHRQHOHYDWRUVIURP WR VKRHDW VORZO\ZLWKQRLVVXHVDWDOO+ROHLQJRRGVKDSH8SZWFRPLQJRIIERWWRP.&DOFXODWHGKROHILOO EEOVDFWXDOKROHILOO EEOV0RQLWRUZHOOIRUIORZ PLQXWHVQRIORZIOXLGGURSSHGDFRXSOHLQFKHVLQIORZULVHURYHUPLQXWHV08UHWULHYDOWRROLQVWULQJGUDLQDQGIOXVK%23VWDFN62DQGHQJDJHZHDU ULQJSXOOWRULJIORRUDQG/'VDPH08WHVWSOXJDQG;2 VLQVWULQJ62DQGODQGVDPHLQZHOOKHDGIORRGHGVWDFNDQGFKRNHPDQLIROGSXUJHGRXWDLUSHUIRUPHG VKHOOWHVWRN7HVWHG%23 VRQWHVWMWDVSHU$2*&&UHJXODWLRQVSVL/RZSVL+LJK$QQXODUSVLIRUPLQ:LWQHVVZDVZDLYHG $2*&&-LP5HJJ&UHZFKDQJHKHOG3760&RQWWHVWLQJ%23 V7HVW/35DQG7,:WHVWHGSVL/RZJRRGWHVWZHQWWRWHVWSVL+LJKWHVWUXEEHU IDLOHG0RYHGRQDQGWHVWHG.RRPH\GUDZGRZQWHVW3XOOHGWHVWSOXJUHSODFHGWHVWUXEEHUUHVHWSOXJ7HVWWHVWHGEOLQGVJRRGWHVW&XUUHQWO\UHWHVWLQJWHVW &XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV )LQLVKHGWHVWLQJ%23(DWSVLWRWDOWHVWWLPHKRXUVZLWKRQHIDLOSDVV5'WHVWHTXLSPHQWEOHZGRZQVXUIDFHOLQHVFKRNHPDQLIROGWRSGULYHWHVW SXPS3XOOHGWHVWSOXJWRULJIORRUDQGEURNHRIIVWULQJ5HLQVWDOOHGWRUXQZHDUULQJ62DQGODQGHGUHOHDVHGZHDUULQJ3XOOHGUXQWRROWRWDEOHEURNHRIIDQG/' KDUGZDUHDQGNHOO\MQW$GMXVWHGIORZULVHU&2JDXJHRQNRRPH\XQLWDQGUHHQHUJL]HGVDPHFKHFNHGFURZQVDYHU7,+IURP GZQZW.WR RQ HOHYDWRUVZLWKQRLVVXH3DUNHGEHWZHHQWKHWZR FRDOVHPSWLHGWULSWDQNDQGILOOHGSLSH&RQW7,+IURP GZQZW.WR 08WRSGULYHRQODVW VWDQGILOOHGSLSHZDVKHGGRZQWR VHHLQJ RIILOO1RLVVXHVWULSSLQJLQ&%8RQHWLPHDWJSPSVLUSPIWOEVRIIERWWWRUTXH+DGD PD[RIXQLWVDWERWWRPVXSLQFUHDVHLQVPDOOFRDOFKLSVDQGKHDY\ILQHV5HVXPHGGULOOLQJKROHIURP WR 5RWZRE.JSP SVLUSPIWOEVRQERWWWRUTXHWRIWKU5236OLGLQJZRE.JSPSVLSVLGLIIIWKU5230:YLV(&' VDW SSJ%**XQLWVPD[JDVXQLWVDW &RQWGLUHFWLRQDOGULOOLQJSURGXFWLRQKROH) 7 *30633SVL'LIISVL530 74.:2%.0D[JDVXQLWV(&'SSJ38.62.527./RVWWXUERRQIORRUPRWRUOHDNLQJRLOUDFNHGEDFNVWG087'6VSDFHG RXWFLUFXODWHGPRYHGSLSHDQGURWDWHGHYHU\VRRIWHQZKLOHFKDQJLQJRXWWXUER7HVWHGWXUERIORRUPRWRURN5HVXPHGGLUHFWLRQDOGULOOLQJSURGXFWLRQ KROH) 7 *30633SVL'LIISVL53074.:2%.0D[JDVXQLWV(&'SSJ38.62.527.&UHZ FKDQJHKHOG3760&RQWGLUHFWLRQDOGULOOLQJSURGXFWLRQKROH) WR7'# PG WYG*30633SVL'LIISVL53074 .:2%.0D[JDVXQLWV(&'SSJ38.62.527.&%8*30633SVL53074.0D[JDVXQLWV&RQW FLUFWLOOVKDNHUVFOHDQHGXS*RWRQERWWRPVXUYH\DQG635 V)ORZFKHFNHGZHOOVWDWLF3HUIRUPHGZLSHUWULS) WRFXUUHQWGHSWK 38.62 .'LVWDQFHWRZHOOSODQDW7' /RZ 5LJKW&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV J S SSJ S WRSSJ6KXWGRZQWKHSXPSVIORZFKHFNHGZHOOKDGVOLJKW IORZJJ JS DQGGXVWLQJ0:XSWRSSJ+DGXQLWVRIJDVDW%82QFHZHKDGDSSJ0:DOOWKHZD\DURXQGVKXWGRZQSXPSV)ORZFKHFNHGZHOOVWLOOKDG SSJ S S J J S SSJ VOLJKWIORZEXWKDGVORZHGGRZQLPPHQVHO\ GXVWLQJXS0:WRSSJJ S SSJ ,QFUHDVHG0:WRSSJZKLOHGULOOLQJDKHDG SJ J 7HVWHG%23 VRQWHVWMWDVSHU$2*&&UHJXODWLRQV J SS J PDGHWR322+DQGUHWHVW%23(DWSVLGXHWRSRWHQWLDOERWW \VWHPWRSSJ JJ 0:IURPSSJWRSSJDQGWKHQSSJGXHWRPRGHUDWHIORZDQGKLJKFRQQHFWLRQJDVJ SSJ J JS JJ 0DGHSURSHUQRWLILFDWLRQV WR$2*&&VKXWGRZQDQGIORZ SS J WRPKROHSUHVVXUHGHHSHULQWKHZHOO FKHFNHGZHOO6HHLQJVOLJKWIORZRYHUPLQXWHV& S IORZFKHFNHGZHOOVWDWLF &RQWSXOOLQJZLSHUWULSXSKROHIURP¶WR¶XSZW.5,+WR¶GRZQZW.WR 08WRSGULYHRQODVWVWDQGDQGILOOHGSLSH:DVKHGGRZQ DQGWDJJHG RIILOO&%8DWJSPSVLUSPIWOEVRIIERWWWRUTXHVDZDPD[RIXQLWVDWERWWRPVXS0:YLVLQFUHDVHLQ VPDOOFRDOFKLSVDQGVLOW3XPSHGDEEOKLYLVQXWSOXJVZHHSDURXQGEDFNEEOVODWHLQFUHDVHLQVPDOOFRDOFKLSVDQGVLOW3XOOHGXSKROHWR UDFNHGEDFNVWDQGWRSSHGRIIKROHDQGPRQLWRUHGZHOOIRUPLQXWHV6OLJKWVHHSDJHDWESK%OHZGRZQWRSGULYHDQGPXGOLQH3XOOHGXSKROHRQHOHYDWRUV IURP WR MXVWLQVLGHFDVLQJ+DGRQH.RYHUSXOODW )ORZFKHFNVHHLQJVOLJKWVHHSDJH08WRSGULYHDQG&%8ZLWKDPD[RIXQLWVDW ERWWRPVXSQRFXWWLQJVIORZFKHFNHGIRUPLQXWHVZHOOVWDWLFEOHZGRZQWRSGULYHDQGPXGOLQH3XOOHGRXWRIKROH/'MQWV'3IURP WR &&,YDF LQJZLSHUEDOOVWKURXJKMRLQWVRQSLSHUDFN&RQW322+UDFNLQJEDFNLQGHUULFNIURP WR+:'3DW )ORZFKHFNHGZHOOPLQXWHV5DFNEDFN +:'3MDUVDQG10IOH[FROODUV3-60UHPRYHGVRXUFHVSOXJJHGLQDQGGRZQORDGHG0:'GDWD/'UHPDLQGHURI6SHUU\WRROV%LWJUDGHGDLQJDXJH FOHDQHGDQGFOHDUHGIORRUEORZGRZQPXGOLQHVDJDLQWRYHULI\FOHDU6SRWLQ+DOOLEXUWRQ(/LQHXQLWEULQJWRROVDQGHTXLSPHQWWRWKHULJIORRUKDQJVKHDYHVDQG PDNHXS'LSROH6RQLF,PDJHUDQG&%/ WRROVWULQJ5,+PDNLQJXSFRQQHFWLRQVFKHFNRSHUDWLRQVRIWRROVWULQJ5,+W :LWK'LSROH6RQLF,PDJHU ORJJLQJWRROVRQ(/LQHVHHQEREEOHVUXQQLQJLQWKHKROHDEOHWRZRNWKURXJKDOOVHWGRZQ# QRRYHUSXOOZRUNVWULQJIRUPLQQRWPDNLQJDQ\KROH GLVFXVVRSWLRQVZLWKHQJLQHHUGHFLVLRQPDGHWRORJRXWRIKROHISPWR FDVLQJVKRH&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWRSHQKROHORJUXQRQHOLQHIURP¶WR´FDVLQJVKRHDW¶7RROKXQJXSDW¶EXWZDVDEOHWREHMDUUHGIUHH,QFDQGLQFOD\VWRQH WUDQVLWLRQLQJLQWRFRDO2QFHLQVLGH´FDVLQJHOLQHSHUIRUPHG&%/VHHLQJJRRGERQGXSWR¶322+DQG/'¶WRROVWULQJ,PDJLQJWRROKDGORVWWZR RIVL[66SDGV´[´[´LQVL]H+ROHILQGHURQERWWRPRIWRROVWULQJDOVRGDPDJHGEHQWLQWRDVOLJKW³6´VKDSHDQGVSOLWUXEEHUIURPVHWWLQJGRZQSUHYLRXVO\DW ¶5'DQGUHOHDVHG+DOOLEXUWRQHOLQH08RSHQKROHFOHDQRXW%+$DVIROORZV+'%6*7'.55ELWVXE,%610IOH['& V;2 +:'3;2MDUV;2+:'3WR &RQW7,+RQVWDQGVIURP WR &RQW7,+IURP WR ZLWKQRLVVXHVILOOLQJSLSHHYHU\VWDQGVWRRNZHLJKW DWWHPSWWRZRUNGRZQXQDEOHWRNHOO\XSDQGILOOSLSHZDVKDQGUHDPUHPDLQLQJVWDQGVWRERWWRPJSPUSP3XPS+L9LV6ZHHSDURXQGLQFUHDVHLQ FXWWLQJVRQERWWRPVXSFRDOFKLSV DQGKHDY\ILQHVDQGVZHHSZDVEDFNEEOVODWHDQGLQFUHDVHLQFXWWLQJVPD[JDVXQLWVREVHUYHGIORZ FKHFNZHOOVWDWLFVOLJKWORVVFLUFXODWHERWWRPXSXQLWVJDVEORZGRZQWRSGULYH322+I W ZRUNHGWKURXJKWLJKWVSRWNRYHUSXOO# ZRUNHGWKURXJKXQWLOFOHDQIORZFKHFNHGZHOODWVKRHVWDWLFFRQWLQXH322+UDFNLQJEDFN'3W &XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWWR322+IURP WR UDFNLQJEDFNLQGHUULFN$W WXUQHGHOHYDWRUVFRQW322+/''3WR WKHQ/'+:'3MDUV10IOH['& VVWDE DQGELW5HUXQELWJUDGHGDLQJDXJH0RQLWRUZHOORQWULSWDQNFOHDQHGDQGFOHDUHGULJIORRUDQGFDWZDON6WDJHG%DNHUFHPHQWKHDG;2 VDQG&'6 SXSV38FHPHQWKHDGEURNHRII,);2 VDQGSXS08,);2 VDQG&'6SXSV RQWRS RQERWWRP/'FHPHQWKHDG58:HDWKHUIRUG WRQJVDQGKDQGOLQJHTXLSPHQW58ILOOXSOLQH08576;2RQ7,:ORDGSLSHUDFNVZLWKVKRHWUDFNDQG576MRLQWV6WDJHIORDWVKRHSXSDQG576E\ ':&;2+HOG3-60ZLWKULJFUHZ:HDWKHUIRUGDQG%DNHU5HSV%DNHU/RNDQG08SXSRQIORDWFROODUMRLQW08VKRHILOODQGFKHFNIORDWHTXLSPHQWRN %DNHU/RNDQG08ODQGLQJFROODUMRLQWDQG576;2&RQW38VLQJOHLQKROHZLWK$3,37ZR6WHS+3OLQHUWRSILOORQWKHIO\WRSRIIHYHU\ MQWVWR 7RUTXHGWRIWOEV08/LQHUKDQJHUDVSHU%DNHUUHSFKDQJHRXWHOHYDWRUVDQG/':HDWKHUIRUGFDVLQJWRQJV08VWDQGRI'3DQG &LUFXODWHSLSHYROXPHVSPSVLEORZGRZQWRSGULYH5,+Z /LQHURQ'3I W )LOOLQJSLSHHYHU\VWDQGV&LUFXODWHERWWRPVVSP SVLXQLWVRIJDVRQERWWRPVXSXSREWDLQSDUDPHWHUV38:N62:N527NUSPNUSPNUSPN5,+Z /LQHURQ'3I W ILOOLQJSLSHHYHU\VWDQGV1RKROHLVVXHVVHHQWRWKLVSRLQWFXUUHQWO\ILOOLQJSLSH&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQW7,+ZLWKOLQHUDQG%DNHUKDQJHUDVVHPEO\RQ'3IURP¶WR¶VDZQRILOORQERWWRP'RZQZW.08WRSGULYHILOOHGSLSHFLUFXODWHGDQG UHFLSURFDWHGDWJSPSVL8SZW.GZQZW.VKXWGRZQSXPSEURNHRIIWRSGULYHEOHZGRZQWRSGULYH38%DNHUFHPHQWKHDGDQG08LQVWULQJ 08FHPHQWKRVHYDOYHDQGVZLQJ5HVXPHGFLUFXODWLQJURWDWLQJDQGUHFLSURFDWLQJVWDJLQJSXPSUDWHXSWRJSPSVLUSPWRIWOEV WRUTXHKDGDPD[RIXQLWVJDVDWERWWRPVXSWKDWGURSSHGGRZQWRXQLWVIDLUDPRXQWRIVPDOOFRDOFKLSVDQGVLOWVDQGDWERWWRPVXS+HOG3-60ZLWKULJ FUHZ%DNHUDQGFHPHQW5HSVVKXWGRZQULJSXPSDQGEOHZGRZQPXGOLQHWRSXPS+DOOLEXUWRQSXPSHGEEOVZDWHUWRIOXVKOLQHVWRFXWWLQJVER[WKHQEEOV WRILOOOLQHV6KXWLQDW%DNHUFHPHQWKHDGDQG37OLQHVDWSVLORZSVLKLJK*RRGWHVWV/LQHGXS%DNHUFHPHQWKHDGWR+DOOLEXUWRQSXPSHGEEOV SSJ7XQHG3ULPH6SDFHUDWESPSVLIROORZHGZLWKEEOVV[SSJ7\SH,,,/HDGFHPHQWDWESPWRSVLIROORZHGZLWKEEOV V[SSJ7\SH,,,7DLOFHPHQWDWESPSVL+DGSSVRI%ULGJH0DNHU/&0LQOHDGQRQHLQWDLO%DNHUUHOHDVHGGDUW+DOOLEXUWRQWKHQGLVSODFHG ZLWKEEOVZDWHUIROORZHGZLWKSSJ.&/PXGDWESPSVL,&36DZGDUWODWFKZLSHUSOXJEEOVLQWRGLVSODFHPHQW:LWKEEOVWRJRUHGXFHG UDWHWRESPSVLVHWRQGHSWKDQGVWRSSHGURWDWLQJVWULQJ%XPSHGZLSHUSOXJODQGLQJFROODUEEOVLQWRGLVSODFHPHQWFDOFXODWHGDWEEOV)&3 SVL&,3DWRQ1RORVVHVGXULQJFHPHQWMRE5HFLSURFDWHGDQGURWDWHGVWULQJULJKWXSWRUHGXFLQJSXPSUDWHWREXPSSOXJ+DOOLEXUWRQ LQFUHDVHGWRDQGKHOGSVLSVLRYHU)&3IRUPLQXWH3UHVVXUHGXSWRSVLDQGKHOGPLQXWHWRVHWDQFKRUWKHQEOHGRIIEEOVWRWUXFNIORDWV KHOG6ODFNHGRIIRQEORFNVIURP.WR.JLYLQJXVDJRRGLQGLFDWLRQKDQJHUZDVVHW3UHVVXUHGXSWRWRVHWSDFNHUZLWKSXVKWRROWKHQXSWRSVL WRUHOHDVHUXQWRROFROOHWDQGQHXWUDOL]HSXVKHUWRROKHOGPLQXWHDQGEOHGRII38¶WRFOHDUGRJVIURPKDQJHUWRSXSZW.DQGKDGJRRGLQGLFDWLRQZH UHOHDVHGOLQHUVWULQJ62DQGVHWGRZQRQOLQHUWRS38¶URWDWHGDWUSPIWOEVWRUTXH62DQGVHWGRZQRQOLQHUWRSWR.WRHQVXUHZHLJKWWUDQVIHU WRVHWSDFNHUQRLQGLFDWLRQRIVKHDU7RSRIOLQHUKDQJHUDW¶WRSRIODQGLQJFROODUDW¶&ORVHGXSSHUUDPVDQGSXPSHGGRZQNLOOOLQHWRSVLDQG KHOGPLQXWHVWRWHVWSDFNHUVHDO*RRGWHVW%OHGRIIRSHQHGUDPV/'FHPHQWKHDGDQGSXSV08WRSGULYHOLQHGXSWRSXPSGRZQGULOOVWULQJ$SSOLHGSVL DQGVWDUW38RQGULOOVWULQJXQWLOSUHVVXUHGURSSHG3XPSHG%8DWJSPSVL+DGEEOVVSDFHUDQGEEOVFHPHQWDWWKHVKDNHUV6KXWGRZQSXPS EURNHRIIWRSGULYH/'SXSMRLQWDQGVLQJOHMRLQWLQVWDOOHGZLSHUEDOOLQGULOOVWULQJ08WRSGULYHDQGSXPSHGVHFRQGFLUFXODWLRQDWJSPSVL5'DQG UHOHDVHG+DOOLEXUWRQFHPHQWHUV6KXWGRZQSXPSVEOHZGRZQWRSGULYHDQGPXGOLQHEURNHGRZQFHPHQWPDQLIROGDQGEOHZGRZQVDPH322+RQHOHYDWRUV IURP UDFNLQJ'3LQGHUULFN/'UXQQLQJWRRODQGFOHDUIORRU08VWDFNZDVKHUDQGIOXVKVWDFNZLWKEODFNZDWHU5'VWDFNZDVKLQJWRROFOHDU IORRU08SROLVKPLOO5,+W ZDVKODVWVWDQGGRZQWDJOLQHUWRS# ZDVKDQGUHDPW UHDPXSDQGGRZQWKURXJKOLQHUWRS[QRLVVXHV&%8 58WRGLVSODFHZHOO&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV SS S S S S +DGEEOVVSDFHUDQGEEOVFHPHQWDWWKHVKDNHUV SSJ S SS IROORZHGZLWKEEOVV[SSJ7\SH,,,/HDGFHPHQWDWESPWRSVLIROORZHGZLWKEEOVSSJ S V[SSJ7\SH,,,7DLOFHPHQW SS J QEOHGRIIEEOVWRWUXFNIORDWV KHOG6 ,+ZLWKOLQHUDQG%DNHUKDQJHUDVVHPEO\RQ'3IURP¶WR¶ SS J J 1RORVVHVGXULQJFHPHQWMRE 6DZGDUWODWFKZLSHUSOXJEEOVLQWRGLVSODFHPHQW:S J %XPSHGZLSHUSOXJODQGLQJFROODUEEOVLQWRGLVSODFHPHQWFDOFXODWHGDWEEOV SSJ S $FWLYLW\'DWH 2SV6XPPDU\ 3XPSHGEEOKLYLVVSDFHUIROORZHGZLWK.&/LQKLELWHGEULQHDQGGLVSODFHGZHOOIURP¶WRVXUIDFHDWJSPSVLUSPIWOEVWRUTXH &LUFXODWHGXQWLOJRRGFOHDQUHWXUQV6HQW$2*&&KUQRWLILFDWLRQIRUZLWQHVVLQJ0,7,$%OHZGRZQWRSGULYHDQGPXGOLQHPRQLWRUHGIRUIORZQRIORZFRQW FOHDQLQJWULSWDQNDQGVKDNHUV6XUIDFHFHPHQWVDPSOHVVWLOOIDLUO\VRIWGHFLVLRQPDGHWR322+WKHQWHVW´[JLYLQJFHPHQWPRUHWLPHWRVHWXS322+ /''3IURP¶WR¶DQGKROHILOOSXPSGLHG5,+VWDQGVIURPGHUULFNZKLOHHOHFWULFLDQZRUNHGRQKROHILOOSXPSWRQRDYDLO58DLUSRZHUHGWUDVKSXPS RQIORZULVHUFRQW322+/''3&&,ORDGHGDQGUHPRYHG6SHUU\WRROVDQGEDVNHWVIURPORFDWLRQ5HPRYHGFHPHQWVLORFRPSUHVVRUDQGXSULJKWZDWHUWDQN 3ROLVKPLOOKDGJRRGVLJQRIOLQHUWRSGUHVVLQJ58DQG7HVW&DVLQJWSVLIPLQ3XPSHGEEOVLQJRWEDFNEEOVEDFN5'WHVWHTXLSPHQWDQG EORZGRZQOLQHV58:HDWKHUIRUGFDVLQJHTXLSPHQWFKDQJHRXWKDQGOLQJHTXLSPHQW/RDG5DFNVZWXELQJ3-6008VHDODVVHPEO\5,+Z 3 5767XELQJIVXUIDFHW 08&KHPLFDO,QMHFWLRQ0DQGUHO08FRQWUROOLQHVDQGWHVWWSVLIPLQ&RQWLQXH5,+LQVWDOOLQJVWDLQOHVVVWHHO EDQGVW &XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWWR38VLQJOHLQKROHZLWKWLHEDFNVWULQJIURP¶WR¶PXOHVKRHGHSWKUXQQLQJDQGEDQGLQJFRQWUROOLQH38H[WUDMRLQW62DQGWDJJHGQR JRPXOHVKRHDW¶3XOOHGXSKROHDQG/'H[WUDMRLQW08¶VSDFHRXWSXSKDQJHUZLWKSXSDQGODQGLQJMRLQW7HUPLQDWHGFRQWUROOLQHWKURXJKKDQJHU GUDLQHGVWDFNRSHQHGDQQXOXVYDOYH62VHHLQJVHDOVHQWHU6%5DQGODQGHGKDQJHUZLWKQRJRVXE¶RIIVHDW8SZW.GZQZW.,QVWDOOHGWRWDO66 EDQGVIURPLQMHFWLRQPDQGUHOWRWXELQJKDQJHU5,/'¶V/'ODQGLQJMQWIORRGHGVWDFNDQGVXUIDFHOLQHV58FKDUWUHFRUGHUSXUJHGDLUFORVHGEOLQGV3XPSHG EEOVGRZQNLOOOLQHDQGWKURXJKKDQJHUWRDFKLHYHSVLRQWLHEDFNDQGOLQHUVWULQJVDQQXOXVRSHQWRDWPRVSKHUHKHOGPLQJRRGWHVW%OHGEDFN EEOV58RQ´[DQQXOXVSXPSHGEEOVWRDFKLHYHSVLWXELQJRSHQWRDWPRVSKHUHKHOGPLQJRRGWHVW%OHGEDFNEEOVDQGLQVWDOOHG ZD\FKHFN)OXVKHGWKURXJKDOOVXUIDFHHTXLSPHQWSXPSVSRRUER\GHJDVVHUXQXVHGFKRNHPDQLIROGWRSGULYHZLWKEDUDNOHDQVROXWLRQEOHZHYHU\WKLQJ GRZQ6KXWGRZQNRRPH\XQLWDQGEOHGRIIRSHQHGDOOUDPGRRUVRQ%23VWDFNSUHVVXUHZDVKHGFDYLWLHVDQGLQVSHFWHGVDPHFKHFNHGHQGSOD\RQ WRSGULYH&KDQJHRLOLQWRSGULYHEXWWRQXSUDPGRRUVSXOOIORZOLQHDQGIORZER[1'VWDFNDQGKDQJRQEULGJHFUDQHVFOHDQDQGLQVSHFWULQJJURYHEULQJGU\ KROHWUHHLQWRFHOODU18GU\KROHWUHHWHUPLQDWHFRQWUROOLQHWKURXJKWUHHEROWXSDGDSWRUIODQJHWHVWKDQJHUQHFNWRSVLIPLQDQGYRLGWRSVLI PLQVHFXUHZHOOKHDG5LJGRZQULJIORRUHTXLSPHQWSUHVVXUHZDVKLURQURXJKQHFNDQGIORRULQVWDOOVKLSSLQJSLQVLQURXJKQHFNDQG5'VDPH/'KDQGOLQJ HTXLSPHQWDQGVXEVIULJIORRUFORFNVHUYLFHORRSVRQWRSGULYHIRUEHWWHUFOHDUDQFH&RQWLQXHULJJLQJGRZQIORRUHTXLSPHQWDQG/'VXEVGUHVVPXGSXPSVZ /LQHUVIQH[WZHOOPRYHWKLUGSDUW\VKDFNVFOHDUORFDWLRQILQLVKFOHDQLQJSLWVDQGEHJLQ5'DQGEORZLQJGRZQOLQHVUHPRYHVHUYLFHORRSDQGNHOO\KRVH XQSLQWRUTXHEXVKLQJDQG/'SLQWRSGULYHLQVKLSSLQJFUDGOHDQG/'3UHVVXUHZDVKFHOODUDUHD&XWWLQJVLQ'UDJRQ%R[HVEEOV 7RWDO&XWWLQJVEEOV &XWWLQJV7RWHVEEO 7RWDO&XWWLQJVWRWHVEEOV ,627DQNV/RDGHGEEOV 7RWDO,627DQNVEEOV 'DLO\/RVVHV'RZQKROHEEOV 7RWDO/RVVHV'RZQKROHEEOV &RQWULJJLQJGRZQMXPSHUVIURPSXPSVDQGSLWVFHQWULIXJHYDFGHJDVVHU,QVWDOOHGVKDNHUVKLSSLQJEORFNV5'SRRUER\DQGOD\RYHU58EULGOHOLQHV5'PXG ODEFUDGOHWRSGULYHDQGUHPRYHGIURPIORRU5HPRYHG³7´EDUIURPWRUTXHWXEHUHPRYHGWXUQEXFNOHV5'PXGSXPSVDQGSLWVSUHSGHUULFNIRUVFRSHGRZQ UHPRYHGULJIORRUWDUSVDQGIUDPHV&&,PRYHGSRRUER\DQGFXWWLQJVER[IURPORFDWLRQORDGDYDLODEOHULJPDWVDQG%DNHUOLQHUUXQWRROVVFRSHGGHUULFN GRZQ/'ORZHUWRUTXHWXEHVHFWLRQSUHSWROD\RYHUGHUULFNVSRROHGRIIGULOOOLQHIURPGUXPFXW RIGULOOLQJOLQHVKLSSHGPXGODERIIORFDWLRQEORZGRZQ ZDWHUOLQHVDQGHPSW\ZDWHUWDQNUHPRYHVWHDPKHDWHUVIURPULJIORRUIROGXSGHUULFNERDUGDQGSLQ3UHSDQG/D\RYHUGHUULFNSUHSGHUULFNWRUHPRYHRIIVXE SXOOVWDLUDQGEDFNKDQGUDLOGLVFRQQHFWSRZHUDQGZDWHUWRPRGXOHVEORZGRZQPRGXOHVDQGUHDG\WRPRYHGLVFRQQHFWPRGXOHVDQGUHDG\IRUULJPRYHUV &RQGXFW-6$DQGDSSURYH37: 'HPREHTXLSPHQWIURP,SDGDQGPRELOL]HWR.SDG .OXEULFDWRUHTXLSPHQWDUULYHGRQEDUJHDQGPRELOL]HWR.SDG6SRWVXSSO\WDQNDQGUHWXUQWDQNVRYHUSLWOLQHUDQGEHUP )LOOVXSSO\WDQNZLWKEEOVRISURGXFHGZDWHU5XQJURXQGWKDZOLQHVWKURXJKRXWWDQN6SRWIOXLGSXPS1XQLWDQG58KDUGOLQH 6ZDSRXWNSVLOXEULFDWRUVWULSSHUZLWKNSVLOXEULFDWRUVWULSSHU 08%23(RQWHVWVWDQGDQGFRQQHFWK\GUDXOLFKRVHV6HFXUHORFDWLRQDQGSODFHKHDWHUVRQHTXLSPHQWIRUQLJKW 6')1 Q/$7/21* HYDWLRQ5.% $3, :HOO1DPH )LHOG &RXQW\6WDWH %58 %HOXJD5LYHU +LOFRUS(QHUJ\&RPSDQ\&RPSRVLWH5HSRUW $ODVND &RQWUDFWRU $)( $)( -RE1DPH%58&RPSOHWLRQ+$.RQO\ 6SXG'DWH SXPSHGEEOVWRDFKLHYHSVLWXELQJRSHQWRDWPRVSKHUHKHOGPLQJRRGWHVW% JS S J TS DQGOLQJHTXLSPHQW/RDG5DFNVZWXELQJ3-6008VHDODVVHPEO\5,+Z 3JTS J 5767XELQJIVXUIDFHW 08&KHPLFDO,QMHFWLRQ0DQGUHO J JM S J DFKLHYHSVLRQWLHEDFNDQGOLQHUVWULQJVDQQXOXVRSHQWRDWPRVSKHUHKHOGPLQJRRGWHVWS JSS &RQGXFW-6$DQGDSSURYH37: :DUPXSHTXLSPHQWDQGPRELOL]HPDQOLIWWRORFDWLRQ 0RELOL]H1WDQNVDQGRIIORDG0H2+LQWRSXPSGLVSODFHPHQWWDQNV18%23(WRWHVWVWDQGDQGVWDUW%23(7HVW$2*&&ZDLYHGZLWQHVVE\-LP5HJJRQ DWSP 7HVW4XDG%23 VIORZFURVVORZHUEOLQGVKHDUUDPWRSVLORZSVLKLJK18%23 VRQWUHHVZDEIODQJH 08&7&DQGSXOOWHVWWRN 080+$DQG37WRSVL 08PLOOLQJ%+$ZLWKFRQFDYHPLOO &7&[ ')&9%L'LMDUV[ GLVFREDOO[ FLUFVXEEDOO[ PRWRU[ EODGHFRQFDYH PLOO[ 2$/ 0D[2' *RWRWKHZHOODQG08OXEULFDWRURQWRSRI%23V 37RXWWRFKRNHVNLGWRSVLORZSVLKLJK %OHHGRIISUHVVXUHDQGRSHQZHOOVZDE809/09 WXUQV5,+ZLWKPLOODQGPRWRUDVVHPEO\ 3XPSGRZQFRLODWESPRQFHEHORZOLQHUKDQJHUDW WDNLQJUHWXUQVWRRSHQWRS7DJDW FWPG38DQGVWDUWSXPSLQJDWESPWRJHWIUHHVSLQRI SVL 0LOOSDVWREVWUXFWLRQDQG5,+DQGWDJDJDLQDW FWPG $WWHPSWWRPLOOSDVWEXWFDQQRWJHWDQ\GHHSHUPLOOLQJ 6HWGRZQ.EXWFDQQRWJHWPRWRUWRVWDOO&73LQFUHDVHVWRSVL$WWHPSWWRUXQLQWRREVWUXFWLRQZKLOHSXPSLQJQRPRWRUVWDOODQGOLWWOHPRWRUZRUN ,QFUHDVHSXPSUDWHWRESPDQGVHWGRZQNQRPRWRUVWDOO 8QDEOHWRJHWPRWRUWRVWDOO&KDVHPXGRXWRIOLQHUWRVXUIDFHZKLOH322+DQGSXPSLQJZDWHUGRZQFRLO&RLODWVXUIDFH6KXWLQVZDE OD\GRZQWRROV 0RWRUVSXQIUHHO\E\KDQG%DGPRWRU VPDOODPRXQWRIFXWWLQJVXUIDFHRQERWWRPRIPLOOZRUQ6WDEEDFNRQZHOODQG5,+WR 3XPS1WRGLVSODFHIOXLGIURPFRLODQGGRZQ LQZHOO /D\GRZQOXEULFDWRUDQGVHWLQMHFWRURQEDFNGHFN 08;2IRU(OLQH0,58(OLQH 08ERQGORJWRROVWULQJ 08OXEULFDWRUZLUHOLQHYDOYHVRQWRSRIFRLO%23 V 37ORZSVLKLJK 2SHQZHOODQG5,+/RJIURPOLQHUGRZQDQGWDJDW XQFRUUHFWHG'HHSHUWKDQFRLOE\ /RJXSIURPWDJ $.(OLQH322+ZLWK&%/WRROVWULQJ /D\GRZQWRROVWULQJDQGOXEULFDWRU080+$DQG37WRSVL 08PLOOLQJ%+$ZLWKEODGHMXQNPLOO &7&[ ')&9%L'LMDUV[ GLVFREDOO[ FLUFVXEEDOO[ PRWRU[ EODGHMXQNPLOO [ 2$/ 0D[2' 5,+SXPSLQJPLQLPXPUDWHWDNLQJUHWXUQVWRRSHQWRSWDQN 7DJDW HOHFWURQLFFWPG PHFKDQLFDOFWPG GLVFUHSHQF\2QOLQHZLWKSXPSDWESPIUHHVSLQRISVL 0LOODKHDGVHHLQJaSVLRIPRWRUZRUN 0LOOIURP FWPG PLOOHGWKHQVWDOO 3LFNXSDQG5,+VORZHUVWDOODW H P 7LPHPLOODQGVWDOODW H P 7LPHPLOODQGVWDOODW HP3DLQWIODJDW H PFWPG 322+SXPSLQJGRZQFRLOWDNLQJUHWXUQVWRVXUIDFH *HWVRPHVDQG\ZLWKEODFNVSHFUHWXUQV/D\GRZQPLOOLQJ%+$0LVVLQJVRPHPLOOLQJWHHWKRQRXWVLGHRIPLOO&HQWHURIPLOOLVFOHDQDQGQRZHDU 6WDEEDFNRQZHOODQG5,+WR DQGEORZGRZQFRLODQGZHOOWR /D\GRZQOXEULFDWRUDQGVHWLQMHFWRURQEDFNGHFN ZUDSFRLOLQSDUDFKXWHZLWKKHDW0,58$.(OLQH 3LFNXSWRROVDQGOXEULFDWRU &DOLEUDWHERQGWRROLQDLU 6WDEOXEULFDWRUZLUHOLQHYDOYHVRQWRSRIFRLO%23V 37OXEULFDWRUWRSVLORZSVLKLJK&DOLEUDWHERQGWRROLQIUHHSLSHDW *5VWDUWVWRDFWHUUDWLFDWa 7DJDW (/0'XQFRUUHFWHG/LQHUKDQJHUZDV VKDOORZZKHQUXQQLQJLQKROH (VWLPDWHG3%7' /RJXSDWIWPLQIURPWDJGHSWKWRDERYHOLQHUDW *5&&/QRWUHDGLQJFRUUHFWO\6DPHDVSUHYLRXVGD\ZLWKGLIIHUHQW*5&&/WRRO *HWIUHHSLSHUHDGLQJDERYHOLQHUKDQJHU322+&ORVHVZDE /D\GRZQWRROVWULQJDQGOXEULFDWRU5'02 &DOLEUDWHERQGWRROLQIUHHSLSHDW JJ J (VWLPDWHG3%7' /RJXSDWIWPLQIURPWDJGHSWKWRDERYHOLQHUDW 6WDUWDQGZDUPXSFRLOHTXLSPHQW)XHOHTXLSPHQW &RLOFUHZFKDQJHRXW &KHFNLQWRFDPS )LHOGRULHQWDWLRQIRUQHZSHRSOHWR%HOXJD &RQGXFW-6$DQGDSSURYH37:3LFNXSLQMHFWRUDQG08OXEULFDWRU 6WDERQWRZHOODQG37SVLORZSVLKLJK5,+ZLWK&7&')&9 V'LVFR;2QR]]OH &RROGRZQ1XQLW 6WDUWSXPSLQJ1DWVFIPLQFUHDVHUDWHWRVFIPDW ,QFUHDVHUDWHWRVFIPDW VWDUWLQJWRJHW1DWVXUIDFH7DJDW HOHFWURQLF PHFKDQLFDO :DLWRQERWWRPaPLQXWHVWKHQVWDUW322+ :KHQUHWXUQVDWVXUIDFHLVDOO1VWUDSVKRZVEEOVRI1UHFRYHUHG&ORVHFKRNHDQGVWDUWWRSXPS1GRZQEDFNVLGHRIFRLO 322+ZKLOHSXPSLQJGRZQ%6 3UHVVXUHXSWRSVLZLWK1 &ORVH6ZDE809%OHHGRIISUHVVXUHDERYHWUHHYDOYHV 3XPSWRWDORIVFIJDOORQV1/D\GRZQWRROVWULQJDQGOXEULFDWRU 6HWLQMHFWRURQEDFNGHFN 1'%23 VDQG18VZDEIODQJHZLWKWUHHFDS5'+DUGOLQHDQGNQRFNKRVHVORRVHIURPWDQNV 7UDQVIHU1IURPWDQNWRSXPSWUXFN 6')1 &UHZDVVHPEOHVDQGREWDLQVSHUPLW6SRWHOLQHHTXLSPHQWDQGULJXS3UHVVXUHWHVWOXEULFDWRUWRSVLORZDQGSVLKLJK6,73LVSVL$UPDQG5,+ ZLWK +&JXQ&UDQHWUXFNDLUFRPSUHVVRUKDYLQJDKDUGWLPHNHHSLQJXSZLWKJUHDVHSXPSUHTXLUHPHQWV0RELOL]HDLUFRPSUHVVRUIURP%HOXJD\DUG DQGVZDSRYHU&RUUHODWHWRRSHQKROHORJDQGVHQGWRWRZQIRUFRUUHFWLRQ2QGHSWK3HUIRUDWH7VDQGIURP 3UHVVXUHEHIRUHVKRRWLQJZDV SVLDQGUHPDLQHGIODW/RJ*5&&/IURP3%7' WROLQHUKDQJHUDWa 322+%UHDNOXEULFDWRUDQGOD\GRZQJXQDOOVKRWVILUHG/D\GRZQOXEULFDWRU SXWQLJKWFDSRQZHOODQGKDGRYHUWRSURGXFWLRQ6HFXUHHTXLSPHQWDQGSUHSDUHWRPRELOL]HWR6WHHOKHDG &UHZDVVHPEOHVDQGREWDLQVSHUPLW7*60:DUPXSHOLQHHTXLSPHQWDQGFDOORXW1(OLQHWUXFNZLOOQRWVWDUWVXVSHFWEDGVWDUWHU8QLWJHQHUDWRUIDLOVVKRUWO\ WKHUHDIWHU7URXEOHVKRRWDQGILQGEXUQWRXWPDVWHUSRZHUVZLWFK%\SDVVVZLWFKHQJLQHDQGJHQHUDWRUVWDUW5LJXSDQG5,+ZLWK*37WRRO)OXLGOHYHOIRXQGDW %HJLQWRZDUPXS1$SSO\SVLRI1SUHVVXUHDQGIOXLGRQO\PRYHVDEXW 5,+DQGWDJILOODW ZKLFKLV DERYHWRSSHUIRUDWHGLQWHUYDO $SSO\SVLRI1SUHVVXUHDQGIOXLGFROXPQUHPDLQVVWDWLF&RQWDFWWRZQDQGGHFLGHWRVHWSOXJDERYHILOO322+EOHHGLQJSUHVVXUHGRZQWRSVL%UHDN RIIOXEULFDWRUDQGOD\GRZQ*37WRRO$UPDQG5,+ZLWKVHWWLQJWRRODQG2'&,%3*HWKXQJXSLQOLQHUWRSSDFNHU#a *HQWO\ZRUNWRROVFDPHIUHH DQGGURSSHGWKURXJKOLQHUWRS6HWSOXJDW 322+5LJGRZQDQGVHFXUHZHOO6')1 &UHZDVVHPEOHVDQGREWDLQVSHUPLW7*60:DUPXSHOLQHHTXLSPHQW%OHHG6,73GRZQIURPWRSVL$UPDQG5,+ZLWK +&JXQ&RUUHODWH WRRSHQKROHORJDQGVHQGWRWRZQIRUFRUUHFWLRQ2QGHSWK3HUIRUDWH7IURP ZLWKSVL6,733UHVVXUHEXLOGXSPLQSVLPLQ SVLPLQSVL322+%UHDNRIIOXEULFDWRUDQGOD\GRZQJXQDOOVKRWVILUHG$UPDQG5,+ZLWK +&JXQ&RUUHODWHWRRSHQKROHORJDQGVHQGWR WRZQIRUFRUUHFWLRQ2Q'HSWK3HUIRUDWH7IURP ZLWKSVL6,733UHVVXUHUHPDLQVIODWDWSVL322+%UHDNRIIOXEULFDWRUDQGOD\GRZQ JXQDOOVKRWVILUHG/D\GRZQOXEULFDWRUDQGWRSVKHDYH7XUQZHOORYHUWRSURGXFWLRQ $.(/FUHZDVVHPEOHVDQGREWDLQVSHUPLW7*60:DUPXSHOLQHHTXLSPHQW3UHSDUHEDLOHUHTXLSPHQWLQZHOGLQJVKRS0DNHXSDQG5,+ZLWKZHLJKWEDUV *37VDPSOHEDLOHU7DJIOXLGDW &RQWLQXHWR5,+DQGUXQSDVWSHUIVWR 322+%UHDNRIIOXEULFDWRUDQGUHWULHYHIOXLGVDPSOHIURPEDLOHU/D\GRZQ WRROVDQGEHJLQWRFRROGRZQ1:HOOKHDGSUHVVXUHLVSVL3XPSVFIRI1WRUDLVH:+3WRSVL6KXWGRZQ1DQGOHDYHZHOOVKXWLQ$UPDQG 5,+ZLWKVHWWLQJWRRODQG&,%3:+3KDVGURSSHGWRSVL7DJIOXLGDW %ULQJ1EDFNRQOLQHDQGSXPSPFIPFIWRWDOWRUDLVH:+3WR SVL)OXLGOHYHO DW3XPSPFIPFIWRWDO)OXLGOHYHO DW3XPSPFIPFIWRWDO)OXLGOHYHO DW)OXLG GHSUHVVLRQLVJHWWLQJVORZHUHYHU\F\FOH%OHHG:+3GRZQWRSVLVRWKDWHOLQHFDQ322+7KHUHLVVWLOOSVLRIZDWHUSVLRI1VRZHDUHVWLOO H[WUHPHO\RYHUEDODQFHG322+/D\GRZQWRROVGLVDUPVHWWLQJWRRODQGOD\GRZQOXEULFDWRU7UDSSVLRQZHOODQG6')1 &UHZDVVHPEOHVDQGREWDLQVSHUPLW7*60)LUHXS1XQLWDQGULJXSLURQ:+3LVSVL:DUPXS1DQGEHJLQSXPSLQJ7UDQVIHUUHPDLQLQJ1IURP WDQNHUWRSXPSHU3XPSPFIRIQLWURJHQWREULQJ:+3WRSVL6KXWLQZHOODQGULJGRZQ1XQLW6HFXUHORFDWLRQ $.(/FUHZDVVHPEOHVDQGDWWHQGVPRUQLQJSURGXFWLRQPHHWLQJ2EWDLQSHUPLWDQG7*600REHWRORFDWLRQDQGZDUPXSHTXLSPHQW5LJXSHOLQHDQGFKHFN ILUHWRROVWULQJ$UPDQG5,+ZLWKVHWWLQJWRRODQG&,%3)OXLGOHYHOIRXQGDW &RUUHODWHWRRSHQKROHORJDQGVHWSOXJDW 322+%UHDNRII OXEULFDWRUDQGOD\GRZQVHWWLQJWRRO$UPDQG5,+ZLWK +&JXQ&RUUHODWHWRRSHQKROHORJDQGVHQGWRWRZQIRUFRUUHFWLRQ2QGHSWK3HUIRUDWH7IURP 3UHVVXUHLQFUHDVHVVWHDGLO\IURPSVLWRSVL322+%UHDNRIIOXEULFDWRUDQGOD\GRZQJXQDOOVKRWVILUHG$UPDQG5,+ZLWK +& JXQ&RUUHODWHWRRSHQKROHORJDQGVHQGWRWRZQIRUFRUUHFWLRQ2QGHSWK6,73LVXSWRSVL3HUIRUDWH7IURP 3UHVVXUHUHPDLQVVWDWLFDW SVL322+%UHDNRIIOXEULFDWRUDQGOD\GRZQJXQDOOVKRWVILUHG/D\GRZQHOLQHHTXLSPHQWDQGKDQGZHOORYHUWRSURGXFWLRQIRUWHVWLQJ6')1 $.(/FUHZDVVHPEOHVDQGREWDLQVSHUPLW7*600RELOL]HWRORFDWLRQDQGZDUPXSHTXLSPHQW3HUIRUPPDLQWHQDQFHZKLOHSURGXFWLRQWHVWV7 ]RQH3URGXFWLRQFDOOVIRUIOXLGOHYHOWDJDQGVDPSOH3LFNXSOXEULFDWRUDQGOD\GRZQZHLJKWEDUV&DEOHKDVWRUTXHGDPDJHSRVVLEO\GXHWREDGOLQHZLSHU1HZ ZLSHULVRQZD\ZLWKGXPSEDLOHUDQGRWKHUHTXLSPHQW5HFHLYHVOLQJORDGFDUJRVKLSPHQWIURPKHOLFRSWHU5HSDLUOLQHZLSHUDQGUHKHDG6')1 $.(/&UHZDVVHPEOHVDWSURGXFWLRQRIILFHDQGREWDLQVSHUPLW7*600RELOL]HWRORFDWLRQDQGILUHXSHTXLSPHQW0DNHXS*37DVVHPEO\IRUIOXLGOHYHOFKHFN DQGWDJ$WWHPSWWR5,+GHWDLQHGE\LFHLQWKHZHOOKHDG)LQGKHDWHUVEXLOGKRRFKDURXQGZHOOPRELOL]HIUHH]HSURWHFWWUDLOHUDQGDWWHPSWWRWKDZZHOOKHDG $WWHPSWWRSXPS0H2+$WWHPSWWR5,+PDGHLWWKURXJKWKHWUHHEXWZHOOKHDGLVVWLOOIUR]HQ/'OXEULFDWRUVHFXUHZHOO:LOOUXQKHDWHUVDOOQLJKWWRWKDZWKH WUHH 3-60DQG37:0RELOL]HWRORFDWLRQDQGILUHXSHTXLSPHQW6,73SVL37/XEULFDWRUZLWK0H2+SVLSVL7HVWJRRG2SHQZHOODQGSXPSa JDOORQVRI0H2+DQGGLHVHOWRIUHH]HSURWHFW08DQG5,+ZLWK*37DQGGXPP\JXQWR QRILOOWDJJHGFOHDUWRSOXJVHWGHSWK322+# ) SVL3XPSaJDORI0H2+GLHVHOEOHQGIRUIUHH]HSURWHFW%XLOGSOXJVHWWLQJWRRO08DQG5,+&&/*DPPD/HJDF\RLOWRROV&,%3&RUUHODWHRQ GHSWKDQGVHW&,%3DW 322+5'DQGVHFXUHZHOOIRUWKHQLJKW5HEXLOGSOXJVHWWLQJWRRODQGEXLOGWXELQJSXQFK 3-60DQG37:0RELOL]HWRORFDWLRQDQGILUHXSHTXLSPHQW37OXEULFDWRUSVLSVL7HVWJRRG08DQG5,+ZLWK&&/DQG FHPHQWEDLOHU7DJSOXJ DW IRUFRQILUPDWLRQ'XPSJDOIWRIFHPHQW322+5HEXLOGDQGUHILOOFHPHQWEDLOHU08DQG5,+ZLWK&&/DQG FHPHQWEDLOHU'XPS JDOIWRIFHPHQW322+5HEXLOGDQGUHILOOFHPHQWEDLOHU08DQG5,+ZLWK&&/DQG FHPHQWEDLOHU'XPSJDOIWRIFHPHQW322+ 7RWDOIWRIFHPHQWGXPSHG72&DW /D\GRZQOXEULFDWRUDQGVHFXUHZHOOIRUWKHQLJKW STS 'XPSJDOIWRIFHPHQW STS VHWSOXJDW \J 3HUIRUDWH7IURP SJ VHW&,%3DW UHFWLRQ2QGHSWK3HUIRUDWH7IURP J \J 3UHVVXUHLQFUHDVHVVWHDGLO\IURPSVLWRSVL JSST 3HUIRUDWH7VDQGIURP 3-60DQG37:0RELOL]HWRORFDWLRQDQGILUHXSHTXLSPHQW)OXLGSDFNWXELQJIRUSUHVVXUHWHVW :LUHOLQHYDOYHVZHUHOHDNLQJRXWRIWKHGRRUUHPRYHYDOYHVIRUUHSDLU3UHVVXUHWHVW&,%3DQGFHPHQWDW 72& WRSVLIRUPLQ7HVWJRRG 7HVWSUHVVXUHV PLQSVL PLQSVL PLQSVL5HSDLUZLUHOLQHYDOYHRULQJLQWKHGRRU3UHVVXUHWHVWUHEXLOWZLUHOLQHYDOYHDQGWKHRULQJRQWKHRSSRVLWHGRRUIDLOHGFXSRIGLHVHOZDV OHDNHGRQWRORFDWLRQ/HDNZDVUHSRUWHGDQGFOHDQHGXS8QDEOHWRUHSDLUZLUHOLQHYDOYHV5HEXLOGNLWVFRPLQJLQWKHPRUQLQJ ,QYHQWRU\SHUIJXQVWRFNDW%HOXJD 3UHVVXUHGXS,$WRSVLIRUWXELQJSXQFKWRPRUURZ 3-60DQG37:)LUHXSHTXLSPHQW'LVDVVHPEOHZLUHOLQHYDOYHVVHDOVDUULYHGDW5HEXLOGZLUHOLQHGRRUVHDOV3UHVVXUHWHVW:/YDOYHV6WDERQZHOO 3UHVVXUHWHVWOXEULFDWRUWRSVLSVL7HVWJRRG08DQG5,+ZLWKJDPPD&&/DQG2'/HJDF\&,%3&RUUHODWHDQGVHW&,%3DW 7DJ&,%3 WRFRQILUPGHSWK322+08DQG5,+ZLWKJDPPD&&/DQGIWWXELQJSXQFKORDGHGZLWKVKRWV7DJ&,%3DW IRUFRQILUPDWLRQ&RUUHODWHDQG SXQFKWXELQJIURP ZLWKTXDUWHULQFKKROHV ,QLWLDOSUHVVXUHV7,$SVL )LQDOSUHVVXUHV7,$SVL*RRGSXQFK322+DOOVKRWVILUHG/D\GRZQOXEULFDWRUVHFXUHZHOO5LJGRZQIURPORFDWLRQ 6/%FRLODUULYHVJHWVVHWWOHGLQ3-60DQG37:)LUHXSHTXLSPHQWDQGPRELOL]HFRLOWXELQJHTXLSPHQWWRZHOOVLWH6SRWHTXLSPHQWRQZHOOVLWHEHJLQULJJLQJXS &UX]FUDQHLVQRWRSHUDWLRQDO&&,FUDQHZLOOEHXVHGIRUFRLOMRE 6')1 3-60DQG37:)LUHXSHTXLSPHQW&RQWLQXHVSRWWLQJDQGULJJLQJXSFRLOWXELQJHTXLSPHQW$GG%%/ZDWHUWRWKHUDLQIRUUHQWWDQNDQGULJXSWKHJURXQG WKDZXQLWWREHJLQKHDWLQJZDWHU &&,FUDQHRSHUDWRUDUULYHGDQGVSRWWHGWRQFUDQHRQORFDWLRQ +DOOLEXUWRQFHPHQWHUVDUULYHGLQVSHFWHGDQGILUHGXSHTXLSPHQW6SRWDX[LOLDU\6/%HTXLSPHQWZLWKWKHFUDQH 4XDGFRWRROKDQGLQVSHFWHGDOOFRLO%+$ 6/%LVXQDEOHWRSHUIRUPZHOOZRUN%23(ZRUNXQWLOWKH\UHYLHZDOOPDLQWHQDQFHSDSHUZRUNLQWRZQ0HHWLQJVWREHKHOGWRQLJKW 3-60DQG37::DUPXSHTXLSPHQWDQGILQLVKULJJLQJXS6/%FRLOHTXLSPHQW18%23(WRWHVWVWDQGDQGVWDUW%23(WHVW$2*&&ZDLYHGZLWQHVVE\-LP 5HJJRQDW$0YLDHPDLO 7HVWTXDG%23 VSHU$2*&&DQG+LOFRUSVWDQGDUGVWRSVLSVL$OOWHVWVSDVVHG6SRW+DOOLEXUWRQFHPHQWXQLWDQGULJXSKDUGOLQH5LJXSIORZEDFN LURQ6WDEFRLO7DUSDQGKHDWFRLOUHHO 6')1 3-60DQG37::DUPXSHTXLSPHQW)DPELHQWRQORFDWLRQ084XDFR2'FRLOWXELQJFRQQHFWRUDQGSXOOWHVWWR.+HDWDQGVWDUWDX[LOLDU\ HTXLSPHQW*UHDVHFKRNHVNLGYHULILHGKDUGOLQH7LHLQWRWKH,$:DUPXSFHPHQWXQLWDQGYHULI\DOOFRPSRQHQWVRSHUDWLRQDO%XLOG0H2+EOHQGLQFRLO WDQNV)OXLGSDFNKDUGOLQHVDQGWHVWZLWKPHWKDQROZDWHUEOHQGIRUIUHH]HSURWHFWLRQ7DUSDQGKHDWWUHH3UHVVXUHXS,$WRSVLDQGVDZJRRG FRPPXQLFDWLRQRQWKHWXELQJ /HDYHKHDWHUVRQHTXLSPHQW6')1 3-60DQG37::DUPXSHTXLSPHQW084XDGFR2'RQHWULSFHPHQWUHWDLQHUVHWWLQJWRROGLVFRQQHFWDQGMDU37WRSVL 08/XEULFDWRUDQG37RXWWRFKRNHVNLGSVLSVL %OHHGRIIWKHSUHVVXUHDQGRSHQZHOO5,+ZLWKFHPHQWUHWDLQHU3XPSLQJPLQUDWHWRDYRLGIUHH]LQJXS 3HULRGLFDOO\SXPS0H2+WRWKH%23(VWRDYRLGIUHH]LQJ7DJ&,%3DWIWSLFNXSWRQHXWUDOZHLJKW&RUUHFWFRLOWXELQJGHSWKWRPDWFK&7ZDVUHDGLQJ 322+WR 'URSEDOODQGVHWFHPHQWUHWDLQHU# SVLVHWSUHVVXUH6HWGRZQNWRYHULI\VHW377XELQJE\FRLODQQXOXVWRSVLWRYHULI\ VHW 3XPSDQGYHULI\JRRGUHWXUQVXSWKH,$ 3XPS%%/0H2+%%/'LHVHO%%/0H2+VOXJLQIURQWRIFHPHQWMREIRU,$IUHH]HSURWHFW+DOOLEXUWRQVWDUWEDWFKPL[LQJ 37+DOOLEXUWRQFHPHQWWRSVLSVL 3XPS%%/IUHVKZDWHUVSDFHU%%/FHPHQW%%/IUHVKZDWHUGLVSODFHPHQW3XOORXWRIFHPHQWUHWDLQHUDWNNRYHUVWULQJZHLJKW322+&RLO DWVXUIDFHVKXWLQVZDE /D\GRZQ4XDGFRWRROV7KHFHPHQWUHWDLQHUKDGDJRRGVHW /D\GRZQOXEULFDWRU %ORZGRZQOLQHVEHJLQULJGRZQ 7DUSDQGKHDWFRLOUHHO 6HFXUHZHOODQGVKXWGRZQIRUWKHQLJKW 3-60DQG37:5LJGRZQ6/%FRLOXQLW58$.(OLQHXQLW37SVLSVL 5,+ZLWK&%/WRROVXLWH/RJZDVSRRUTXDOLW\DW 322+IRXQGDSLHFHRIFHPHQWGXPSEDLOHUZLUHRQWKH&%/WRRO &KHFNWRRODQG5,+/RJIURP WR 72&DW 322+ 5LJGRZQ$.(OLQH 6HFXUHZHOODQG6')1 6OLFNOLQH58ZLUH5,+Z*5LQJWDJ# .%322+58VZDEPDQGUHOZFXSV6ZDEUXQVIURP .%WR .% 6HFXUHZHOOKHDG6')1 6/VZDEEHGZLWKZLUHIURPWRZLWKUXQV6')1 6/6ZDEEHGZHOOZLWKZLUHIURPWRZLWKUXQV5'02ZHOO S %%/FHPHQW J SS 5,+ZLWK&%/WRROVXLWH/RJZDVSRRUTXDOLW\DW 322+IRXQGDSLHFHRIFHPHQWGXPSEDLOHUZLUHRQWKH&% 3UHVVXUHWHVW&,%3DQGFHPHQWDW 72& WRSVLIRUPLQ7HVWJRRG VHWFHPHQWUHWDLQHU# J FRQILUPDWLRQ&RUUHODWHDQGS SXQFKWXELQJIURP Z /RJIURP WR 72&DW JST\ &RUUHODWHDQGVHW&,%3DW 3-60DQG37:0RELOL]H(OLQHWRORFDWLRQ6SRWHTXLSPHQW58(OLQH 08OXEULFDWRUDQG37WRSVLSVL5HSODFHRQHOHDNLQJRULQJLQWKHWRSRIWKHOXEULFDWRU 37WRSVLSVL7HVWJRRG*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOO FRUUHODWLRQSDVVDQGVHQGWRWRZQ2QGHSWK 8VLQJDIWJXQILUVWWRDYRLGJHWWLQJEORZQXSKROH6KRRWRQWKHIO\%HOXJD,VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQGVHQG WRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD,VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQGVHQG WRWRZQ2QGHSWK IWJXQLVWKHERWWRPRIDIWLQWHUYDOLQWKH%HOXJD,3XOORQGHSWKDQGSHUIRUDWH%HOXJD,VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL/D\GRZQWKHOXEULFDWRUDQGVHFXUHZHOO 6')1 3-60DQG37::DUPXSHTXLSPHQW*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOO FRUUHODWLRQSDVVDQGVHQGWRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD,VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQGVHQG WRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD,VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQG VHQGWRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD+VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQG VHQGWRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD+VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQG VHQGWRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD+VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL*XQ08JDPPDFFODQGIW63)JUDP*HRG\QDPLFVJXQ&&/WRWRSVKRW DQG5,+3XOOFRUUHODWLRQSDVVDQG VHQGWRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD+VDQGVIURP 322+$OOVKRWVILUHG PLQSVL PLQSVL PLQSVL PLQSVL5LJ'RZQ(OLQH 7XUQZHOORYHUWRSURGXFWLRQ J\ SHUIRUDWH%HOXJD+VDQGVIURP J\ SHUIRUDWH%HOXJD+VDQGVIURP J SHUIRUDWH%HOXJD,VDQGV IURP SHUIRUDWH%HOXJD,VDQGVIURP J HUIRUDWH%HOXJD,VDQGVIURP See attached email for additional perf intervals and passing MITIA on 1/3/22. -bjm SJ J\ VHQGWRWRZQ2QGHSWK3XOORQGHSWKDQGSHUIRUDWH%HOXJD+VDQGVIURP J\ HUIRUDWH%HOXJD+VDQGVIURP J\ GSHUIRUDWH%HOXJD,VDQGVIURP %HOX 6KRRWRQWKHIO\%HOXJD,VDQGVIURP 3 ! "#$%& "'$( )*'*' %+, , $& , -. , , /, /, !!"!# !!"!# 01&,$%% !!"!#&'!(')*+#,- !,!!"!#,./01 . 0 ,!!"!#&'!(')*+#,- 1 , 2!!"!# 0 0 , 2 , %+ 03, , +'!,*34 - . +'!,*. /./.- 5)# $ 2 / /% ! &, &, 4!, 1!, 546$/ 56$ %" 2 &, !!"!# )()) )()) ! 6"" 78,(,! "!" !'8(6# ,#(#)/1&4,)(7) 6+9+!:+6(#876. +7+9):6('8+'2 / 789 :& !1 7-9 ! 789 !!"!# 0&0! +);+7;!)!+ +7("7 ,"('' 77 !'!()))))))) %1,., &, !!!"!# +() 0 . , 1:7-.9 7 9 56$ 7 9 789 546$/ 7 9 -;1,+8(7) +!6()#)()))())+8(7) : 7 9 %! - 7/9 - 7 9 ++;';!)!+ "<$21 =1 ))#$>;?#@AA$B 4 1 (+6'(,) " !)"(,7 $21 =1 *+-*!!"!#-+);+';!)!+ "<$21 =1 ))#$>;?#@AA$B 4 1 (" !!,()7 , +68('8 $21 =1 *!-*!!"!#-+);!6;!)!+ "<$21 =1 ))#$>;?#@AA$B 4 1 (, !6)("! ' '6!(8, $21 =1 *"-*!!"!#-++;)7;!)!+ 0 7 9 < 789 = 789 546$/ 7 9 56$ 7 9 -. 7 9 -. 7 9 0 1! 79 0 4! 79 . 79 786>9 - +8(7) )()) )()) +8(7) )()) )()),#(#) ! 6"" 78,(,! "!" !'8(6# )()) )()) .3C?.3 +6'(,) )()" #+(87 +6'(,) )()" )()",6(8) ! 6"" 78,(,7 "!" !'8(6, )()! )()) "<$21 =1 *+- !"+('7 )(+# "!,(88 !"+('7 )(++ )())+"'()7 ! 6"" 78,(8" "!" !'8(6# )(!+ )()6 "<$21 =1 *+- !')(,' )()6 +8("7 !')(,' )(+' )()"+',(8' ! 6"" 78,('! "!" !'8(6+ )(+' )(+# "<$21 =1 *+- "7+()6 )(+! 7,(#! "7+()6 )(!6 )()"!78(+6 ! 6"" 78,('8 "!" !'8(68 )(+# )(+" "<$21 =1 *+- #+,("+ )(!' 6+()# #+,("+ )("8 )(!#"!#(#+ ! 6"" 788()' "!" !'8(88 )(!6 )()" "<$21 =1 *+- #,'(+7 )("! ##('! #,'(+7 )(7, )(7)"86(!7 ! 6"" 788(!' "!" !''(+# )(+# )()6 "<$21 =1 *+- 7#)(,, )()+ !'"(87 7#)(,, )(,) )(6+##,(8, ! 6"" 788(#+ "!" !''(!6 )(7! )()8 "<$21 =1 *+- 6)+(66 )()6 !+,(') 6)+(66 )(68 )(787)8(,6 ! 6"" 788("' "!" !''(!" )(+) )(), "<$21 =1 *+- 66"(+' )()6 !!,(,# 66"(+' )(6" )(7#7,)(!' ! 6"" 788("# "!" !''(+' )()! )(), "<$21 =1 *+- ,!7(!6 )(!, "7,(66 ,!7(!6 )(,7 )(7+6"!("6 ! 6"" 788(#, "!" !''(+6 )(7) )()" "<$21 =1 *+- ,86(68 )(!) 68("! ,86(68 )('# )(6)6'"(,8 ! 6"" 788(67 "!" !''(!6 )(#7 )()6 "<$21 =1 *+- %+, , $& , -. , , /, /, !!"!# !!"!# 01&,$%% !!"!#&'!(')*+#,- !,!!"!#,./01 . 0 ,!!"!#&'!(')*+#,- 1 , 2!!"!# 0 0 7 9 < 789 = 789 546$/ 7 9 56$ 7 9 -. 7 9 -. 7 9 0 1! 79 0 4! 79 . 79 786>9 - 8#8(7+ )(!" 6'(,) 8#8(7) +()! )(8!,77(6) ! 6"" 788(," "!" !''(#, )()7 )()6 "<$21 =1 *+- '+)("! )(#" 7()! '+)("! +(!' )('68+,(#! ! 6"" 78'()) "!" !''(6! )(6" )()+ "<$21 =1 *+- ',!(#7 )()' "77(7+ ',!(## +(7, )(',8,'(7# ! 6"" 78'(!8 "!" !''(6# )(7# )(+# "<$21 =1 *+- + )"7(+, )(## 7)(#" + )"7(+, +(,, +(+7'#!(!, ! 6"" 78'(#8 "!" !''(8! )(6" )(++ "<$21 =1 *+- + )'6(), )("7 +7(+# + )'6()6 !(+) +("8+ ))"(+6 ! 6"" 78'(8) "!" "))()6 )(#! )(+! "<$21 =1 *+- + +78(!) )(#" 67(7" + +78(+' !("8 +(67+ )67(!' ! 6"" 7')()8 "!" "))("! )(77 )(), "<$21 =1 *+- + !+'("8 )("+ +#(+6 + !+'(", !(6# +(')+ +!6(#, ! 6"" 7')("" "!" "))(78 )(76 )()! "<$21 =1 *+- + !8+(76 )(#7 !)(+! + !8+(77 "()! !()!+ +88(67 ! 6"" 7')(,+ "!" "))(,+ )(!# )(+7 "<$21 =1 *+- + "#!('# )(!8 8(7) + "#!('! "(#) !(+"+ !7)()! ! 6"" 7'+()' "!" "))(8! )(!' )(!8 "<$21 =1 *+- + #)6(8' )(#" !6(+" + #)6(88 "(,, !(!6+ "+"('8 ! 6"" 7'+(#6 "!" "))('7 )(!' )(#) "<$21 =1 *+- + #68("' )(6" 7)(,8 + #68("8 #(!) !(6!+ ",7(#8 ! 6"" 7'+(88 "!" ")+("" )(#' )("7 "<$21 =1 *+- + 7!'('6 )(7' 6"('" + 7!'('# #(77 "(+,+ #",()# ! 6"" 7'!(!! "!" ")+(88 )(!# )(+! "<$21 =1 *+- + 7'!(#7 )(6" "+('' + 7'!(#" #('8 "(6#+ #''(7" ! 6"" 7'!(67 "!" ")!("7 )(7# )()+ "<$21 =1 *+- + 67#(!' +(", +)"(,' + 67#(!6 7(+) #(7#+ 76+("6 ! 6"" 7'!(,7 "!" ")"(!6 !(+" )(6, "<$21 =1 *+- + ,+6(,8 !(6) +++(7' + ,+6(,! #(#) 6(78+ 6!"(8! ! 6"" 7'!()! "!" ")7(!' !()) !(," "<$21 =1 *+- + ,,8(,, #('! +!6(") + ,,8(76 !("+ +)()"+ 687(66 ! 6"" 78'(8, "!" ")8(,) #()" 6(,7 "<$21 =1 *+- + 8#)(", ,(+# +")(8, + 8"'(8! +(,6 +7()7+ ,#6('! ! 6"" 787(," "!" "+"(66 "(6, +"(!+ "<$21 =1 *+- + ')!(," 8(7' +"7("# + ')+(6) ,(6+ !+(!6+ 8)8(,) ! 6"" 7,'(,8 "!" "+'(,8 !(7# !+(6, "<$21 =1 *+- + '6#(#6 +)(," +"7()' + '6!(## +#('6 !8(76+ 86'(7# ! 6"" 7,!("! "!" "!6('6 "(#7 "+(8' "<$21 =1 *+- ! )!6(8+ +"("7 +"#()' ! )!"(#! !#()8 ",(8!+ '")(7! ! 6"" 76"()6 "!" ""6()' #(!! ##(,7 "<$21 =1 *+- ! )88(!' +6()) +""(68 ! )8!(8' "#(8, #'()7+ '8'('' ! 6"" 77!(+) "!" "#,(+7 #("" 6)(+8 "<$21 =1 *+- ! +#'('# +,()" +"!(6! ! +#+('' #6(87 6+(8#! )#'()' ! 6"" 7"'('" "!" "7'(,7 +(," ,,(7, "<$21 =1 *+- ! !++(66 +6("' +""(+" ! !)+(++ 78('" ,#(87! +)8(!+ ! 6"" 7!,(67 "!" ",!(7, +()6 '7(+' "<$21 =1 *+- ! !,#(8' +8(+" +"+(7' ! !6+(#' ,+(76 88(,!! +68(7' ! 6"" 7+#(8+ "!" "86(!7 !(8# ++"(8# "<$21 =1 *+- ! ""7(78 +,(7, +"+(," ! "+'(!6 8"('" +)!(6!! !!6("6 ! 6"" 7)!(!" "!" "''('6 )('! +"!("6 "<$21 =1 *+- ! "'8(8! +'(76 +")(8, ! ",'(!) ',(!+ ++,(,7! !86(") ! 6"" #88(,! "!" #+#(88 "(+6 +7!(#+ "<$21 =1 *+- ! #6+(8+ +'(+' +")(77 ! #"8(6" ++)(8# +""(7'! "#7(," ! 6"" #,#(87 "!" #")(7+ )(6) +,"(!# "<$21 =1 *+- ! 7!!(+) +8(76 +")(7) ! #'7(6, +!"(7! +#8(#!! #)!(,, ! 6"" #6+('7 "!" ##7(+# +()6 +'!(68 "<$21 =1 *+- ! 78"(,) +'()8 +"+(8, ! 77"('8 +"6(6) +6"(",! #6+()8 ! 6"" ##8(6# "!" #7'(88 +(+! !+!(#, "<$21 =1 *+- ! 6#7(+# +8(,+ +"!()# ! 6+!(+) +#'(') +,8(+6! 7+'(!) ! 6"" #"7(++ "!" #,#(#, )(6! !"!(!6 "<$21 =1 *+- ! ,),(7' +'(+' +"+(6+ ! 6,+(+, +6"(#" +'"(!8! 7,8(!, ! 6"" #!+("6 "!" #8'("8 )(8+ !7!(## "<$21 =1 *+- ! ,6'(+) +'('! +"!()' ! ,!'(+" +,,(+, !)8(6+! 6"6(!" ! 6"" #),("' "!" 7)#(7) +(!! !,!('! "<$21 =1 *+- ! 8"!(+7 +'()6 +"+(#, ! ,88(7, +'+(+8 !!#(")! 6'7(6, ! 6"" "'"(+" "!" 7+'(', +(#+ !'"(87 "<$21 =1 *+- ! 8'"(78 +8(,) +!'("# ! 8#6(,) !)#(), !"'(#"! ,7"(8) ! 6"" "8)()! "!" 7"#(') +(!, "+"(6, "<$21 =1 *+- ! '77()! +'(7+ +!8(76 ! ')#(,7 !+6(,) !77(),! 8++(87 ! 6"" "6,(+7 "!" 77)("# +("8 """(,7 "<$21 =1 *+- " )+8()7 +'()7 +"+()7 ! '6#(!# !")()! !,+()7! 8,+("# ! 6"" "7"(7' "!" 766(+! +(7) "7#(7+ "<$21 =1 *+- " ),'('# +'(,+ +")(6, " )!!(6" !#"(#7 !86(7'! '!'(," ! 6"" ""'('! "!" 78+(## +()' ",#(', "<$21 =1 *+- " +#!(6' +8(#' +"+('+ " )8+('! !7,()) ")!()!! '8'()! ! 6"" "!6(+# "!" 7'6(6, !()7 "'7(#! "<$21 =1 *+- " !!,()7 +'("! +"+("6 " +6+(," !,7(+6 "!!(#7" )68(8" ! 6"" "),(6, "!" 6+6(8! +()) #!!(6! "<$21 =1 *!- " !'#(78 +'(## +"+(7, " !!7(## !')()) ""'(!#" +"!(7# ! 6"" !'!(78 "!" 6""("8 )(!+ ###('" "<$21 =1 *!- %+, , $& , -. , , /, /, !!"!# !!"!# 01&,$%% !!"!#&'!(')*+#,- !,!!"!#,./01 . 0 ,!!"!#&'!(')*+#,- 1 , 2!!"!# 0 0 7 9 < 789 = 789 546$/ 7 9 56$ 7 9 -. 7 9 -. 7 9 0 1! 79 0 4! 79 . 79 786>9 - " "7,(7' +'("' +"+(76 " !8#(86 ")"(8' "7#('+" +'+('6 ! 6"" !,8(## "!" 6#8(8" )()8 #67(,8 "<$21 =1 *!- " #!)(," +8(+, +")(## " "##(6# "+,(!" ",)(!7" !7+(,# ! 6"" !6#(8, "!" 66"('6 !()+ #86()" "<$21 =1 *!- " #8!(#! +,(', +")(+, " #)"(!' "!'(6+ "8#(8#" "+)("' ! 6"" !7!(!, "!" 6,8("6 )("7 7)7(++ "<$21 =1 *!- " 7##(77 +,(6+ +")(!# " #6!(#7 "#+(86 "''("#" "6'(77 ! 6"" !"'(8) "!" 6'!(6, )(78 7!#()# "<$21 =1 *!- " 6)7(#) +,(#, +")()) " 7!)(#, "7"(68 #+"("6" #!,(7, ! 6"" !!,(,, "!" ,)6(7+ )(!6 7#!("# "<$21 =1 *!- " 66,(7, +,(7) +")(+, " 7,'(,6 "67(,+ #!,(67" #86(86 ! 6"" !+7(7" "!" ,!)(6+ )(+) 76)(', "<$21 =1 *!- " ,!'('8 +,(!, +")(#) " 6"'("! ",,(,, ##+(88" 7#6(#! ! 6"" !)"(!7 "!" ,"#(67 )("8 7,'(76 "<$21 =1 *!- " ,'!(!+ +,(6, +")("7 " 6'8(68 "8'(8, #76(++" 6)7(,8 ! 6"" +')('" "!" ,#8(6' )(6# 7'8(+' "<$21 =1 *!- " 87#(7' +,(6" +")(!8 " ,78(+" #)!(+) #,)(7"" 667(!" ! 6"" +,8(#8 "!" ,6!('" )(), 6+,()7 "<$21 =1 *!- " '+7('8 +,(7! +!'('6 " 8+6(67 #+#()7 #8#(,+" ,!"(,7 ! 6"" +66("! "!" ,,6('! )(!# 6"7(7# "<$21 =1 *!- " ',8(#8 +6('7 +!'(8+ " 8,6("# #!7('! #'8('!" ,8"(## ! 6"" +7#(!" "!" ,')('# )('+ 67#()! "<$21 =1 *!- # )"'(,, +6(,' +!'(6" " '"7()) #",(!' 7+!(6)" 8#!(+) ! 6"" +#!(67 "!" 8)#(## )(!, 6,+(,, "<$21 =1 *!- # +)+(#6 +6(!, +!'(8+ " ''#(+# ##8(7+ 7!6(+)" ')+(!# ! 6"" +"+(!" "!" 8+,(,, )(87 68'(!' "<$21 =1 *!- # +6#('" +6(', +")(+, # )7#('6 #6)(+, 7#)()+" '6!()6 ! 6"" ++'("6 "!" 8"+(7) +(++ ,),(#) "<$21 =1 *!- # !!7(6" +6(,' +")(7) # ++"()# #,+(78 77"(### )!)(+# ! 6"" +),(,# "!" 8##(,6 )("# ,!#(', "<$21 =1 *!- # !88(!' +,(', +")(76 # +,!(8# #8"(,# 76,(6,# ),'('# ! 6"" )'7("6 "!" 878(,' +(88 ,#"(6" "<$21 =1 *!- # "#'(6! +,(87 +")(!8 # !"+(!) #'7(', 78!()"# +"8(") ! 6"" )8!('! "!" 8,!('6 )(!# ,6!(## "<$21 =1 *!- # #+!("+ +,(6) +!'(,+ # !')('+ 7)8(!# 7'6(67# +'8()+ ! 6"" ),)(#" "!" 88,("' )(#' ,8+(#8 "<$21 =1 *!- # #,#(+6 +8(!, +"+(7, # "#'(,7 7!)(67 6++()'# !76(87 ! 6"" )7,(8) "!" ')+(67 +(#" 8))(#6 "<$21 =1 *!- # 7"7(,! +8()! +"+(!) # #)8(!7 7""("! 6!7(#8# "+7("7 ! 6"" )##('+ "!" '+7(8" )(#7 8+'(77 "<$21 =1 *!- # 7'8(," +8(,) +"!(!7 # #68()6 7#6(7" 6#)(!'# ",7(+6 ! 6"" )"+(#, "!" '")(## +(!) 8"'(!' "<$21 =1 *!- # 66)(6) +8(,) +"+(', # 7!6(66 77'(8# 677())# #""(,6 ! 6"" )+,('7 "!" '##('7 )(+7 87'()! "<$21 =1 *!- # ,!+(') +8(7+ +"+(#" # 78#(,6 7,!(87 66'(6+# #'+(86 ! 6"" ))#(,! "!" '7'("7 )(#! 8,8(#8 "<$21 =1 *!- # ,8#("' +8(!" +")(,+ # 6##()6 787(,8 68#(#7# 77+(+6 ! 6"! ''+(77 "!" ',"('' )(78 8'8(+) "<$21 =1 *!- # 8#6(!) +'(8) +"+(!) # ,)!(7) 7'8('' 6''(66# 6)'(6) ! 6"! ',8(+! "!" '88('' !(77 '+8(+6 "<$21 =1 *!- # '),(8' +'(8) +"+(7+ # ,6)(7# 6+!(,' ,+7("## 66,(6# ! 6"! '6#()8 "!# ))#(#6 )(+, '"8(', "<$21 =1 *!- # '6'(67 +'(!' +"+("8 # 8+8(,# 6!6(#, ,")(8"# ,!7(8# ! 6"! '7)(+6 "!# )+'(,# )(8" '7'(7# "<$21 =1 *!- 7 )")('# +8('8 +")(8, # 8,6(67 6"'(68 ,#7('6# ,8"(,7 ! 6"! '"6(,! "!# )"#(6, )(7, ','(77 "<$21 =1 *!- 7 )'"(+! +8(#6 +")(+8 # '"7(7# 67!(67 ,6+(+"# 8#!(6# ! 6"! '!"(7! "!# )#'(6" )('+ '''(## "<$21 =1 *!- 7 +77("! +8(!! +!'(#+ # ''#(78 667(+8 ,,6(+,# ')+(68 ! 6"! '+)(,, "!# )6#(#8 )(77 + )+8(', "<$21 =1 *!- 7 !+,()6 +,('+ +!'(6! 7 )7"(!, 6,,("6 ,')('## '6)(", ! 6"! 8'8("6 "!# ),'()6 )(7+ + )"8()8 "<$21 =1 *!- 7 !,,('6 +,(,, +!'(#8 7 +++(!# 68'(!# 8)7(""7 )+8("# ! 6"! 886(!6 "!# )'"(!6 )(!# + )76(,+ "<$21 =1 *!- 7 "#+("! +,()' +!'(67 7 +,+(6' ,)+("" 8+'('67 ),8(,' ! 6"! 8,"('7 "!# +),(,) +()8 + ),7(67 "<$21 =1 *!- 7 #)"(#+ +,(!8 +")(), 7 !"+()+ ,+"()' 8"#()#7 +"8(++ ! 6"! 86+('8 "!# +!+(6) )(", + )'"('7 "<$21 =1 *!- 7 #67(86 +,(,6 +"+('' 7 !')(7, ,!7(#" 8#8(!!7 +',(6, ! 6"! 8#'(#! "!# +"7(78 +(!) + ++!(68 "<$21 =1 *!- 7 7!,(87 +8()! +""(+8 7 "#'(76 ,"8("! 86!(!"7 !76(66 ! 6"! 8"6("" "!# +#'(#) )(,! + +"+(6) "<$21 =1 *!- 7 78'(6# +,(,' +""()7 7 #)8("6 ,7+(") 8,6(+)7 "+7(#6 ! 6"! 8!"(+" "!# +6"(), )("8 + +7)(#7 "<$21 =1 *!- 7 67!(,6 +8(+' +"!("' 7 #68("' ,6#(7! 8')(#!7 ",7(#' ! 6"! 8)'(6' "!# +,,(+' )(,+ + +6'(8+ "<$21 =1 *!- 7 ,+#(86 +,('' +"!(78 7 7!,(#! ,,,(77 ')#(6#7 #"#(7! ! 6"! ,'6(#7 "!# +'+(!+ )("# + +88(', "<$21 =1 *!- 7 ,,6()6 +8(!7 +"!(8! 7 787(7' ,')(#7 '+8(6"7 #'!(6' ! 6"! ,8"("" "!# !)#('' )(## + !),(88 "<$21 =1 *!- %+, , $& , -. , , /, /, !!"!# !!"!# 01&,$%% !!"!#&'!(')*+#,- !,!!"!#,./01 . 0 ,!!"!#&'!(')*+#,- 1 , 2!!"!# 0 0 7 9 < 789 = 789 546$/ 7 9 56$ 7 9 -. 7 9 -. 7 9 0 1! 79 0 4! 79 . 79 786>9 - 7 8",(6+ +'(!# +"+(+, 7 6#"(8, 8)"(68 '""("#7 77)(', ! 6"! ,6'(88 "!# !+'(#' +(8! + !!,(77 "<$21 =1 *!- 7 8''(,+ +'(#7 +")(7) 7 ,)!(#6 8+,(+" '#8(')7 6)'(76 ! 6"! ,76(!) "!# !"#(87 )(#' + !#8()7 "<$21 =1 *!- 7 '6!(", +'("# +")(") 7 ,6+(7, 8")(6! '6#(,77 668(6, ! 6"! ,#!(#, "!# !7)(#8 )(!+ + !68(,' "<$21 =1 *!- 6 )!#(+8 +8(86 +!'(') 7 8+'('8 8#"(67 '8)(!!7 ,!,()8 ! 6"! ,!'(!+ "!# !67(,7 )(8) + !88(', "<$21 =1 *!- 6 )86(", +8(78 +!'(7) 7 8,8(88 876(#) ''7(7,7 ,87('8 ! 6"! ,+6(!! "!# !8)('+ )(7) + ")8(8' "<$21 =1 *!- 6 +#8(!' +8("8 +!'(#7 7 '",(6) 868(8, + )+)(,!7 8##(,) ! 6"! ,)"(7! "!# !'7(86 )("! + "!8(#8 "<$21 =1 *!- 6 !)'('7 +'("' +"+(", 7 ''7('# 88+(8! + )!7('+7 ')"()# ! 6"! 6')("# "!# "+)(87 +('! + "#8(", "<$21 =1 *!- 6 !,+(6# +'(,' +"+('# 6 )7#()6 8'7(76 + )#+("67 '6+(+6 ! 6"! 6,6("6 "!# "!6()' )(,! + "68('6 "<$21 =1 *!- 6 ""#()) +'(#) +"+("+ 6 ++!(8+ ')'(#6 + )7,())6 )+'('+ ! 6"! 66!(!" "!# "#+(7+ )(,+ + "8'(,, "<$21 =1 *!- 6 "'7(86 +'()' +"+(+6 6 +,+(!+ '!!(') + ),!(""6 ),8("+ ! 6"! 6#8(76 "!# "76(6" )(7+ + #+)()8 "<$21 =1 *!- 6 #7,(!# +8(88 +"+(!' 6 !!'(!6 '"6()6 + )8,("76 +"6("6 ! 6"! 6"7(+, "!# ",+(#7 )("7 + #!'(', "<$21 =1 *!- 6 7+'()+ +8(#' +"+(7# 6 !8,(,, '#'(+7 + +)!(+'6 +'#(8, ! 6"! 6!+(86 "!# "86()8 )(6# + ##'(6, "<$21 =1 *!- 6 78)(78 +8(+! +"+(,! 6 "#6(!! '6+('' + ++6(6#6 !7"("! ! 6"! 6)8(,' "!# #))("# )(6+ + #68('+ "<$21 =1 *!- 6 6#!(68 +,('" +"+(+# 6 #)7(!8 ',#(,+ + +"+()76 "+!("8 ! 6"! 7'7(86 "!# #+#(77 )(#! + #88()# "<$21 =1 *!- 6 ,)7('7 +,(6' +")(7' 6 #67(7+ '8,(", + +#7(686 ",!(6+ ! 6"! 78!(', "!# #!8('' )(#6 + 7),("" "<$21 =1 *!- 6 ,66(6! +,(!7 +!6(,# 6 7!"("' ''8(,7 + +7'(8'6 #")(#' ! 6"! 7,+("8 "!# ##"()! !()# + 7!7(7+ "<$21 =1 *!- 6 8!8(66 +6(7+ +!!(6, 6 78!(,6 + ))'()+ + +,#(6'6 #8'(86 ! 6"! 76)(8' "!# #7,(67 !(!7 + 7#"(7+ "<$21 =1 *!- 6 8')(#6 +7(!8 ++8(8, 6 6#!(+' + )+,(68 + +8'(!+6 7#'(!' ! 6"! 77!()) "!# #,!()# !(6+ + 76)("6 "<$21 =1 *!- 6 '7!(+! +#('8 ++,(,) 6 ,)+(,! + )!7("+ + !)"("86 6)8(8! ! 6"! 7##(+6 "!# #86()' )(6' + 7,6(") "<$21 =1 *!- , )+#(!) +#(7! ++,(,' 6 ,6+(,7 + )"!(6, + !+,(",6 668(87 ! 6"! 7"6(7' "!# #''('6 )(,# + 7'+('# "<$21 =1 *!- , ),6(7" +#("# ++6('6 6 8!!(++ + )"'(8+ + !"+(+66 ,!'(!+ ! 6"! 7!'(!" "!# 7+"(6# )(## + 6),(") "<$21 =1 *!- , +"8(6" +#(", ++8()' 6 88!(!8 + )#6('! + !##(8!6 ,8'("8 ! 6"! 7!+('+ "!# 7!,(+' )(#7 + 6!!(7! "<$21 =1 *!- , +68('8 +#(!! ++,(#7 6 '++(6' + )7)(#! + !7+(#76 8+8(,' ! 6"! 7+8("! "!# 7""(,6 )(,! + 6!'('# "<$21 =1 *!- , !6)("! +#(!7 ++"(,, , )))(!! + )6)(+! + !,+(6'6 '),("! ! 6"! 7)8("+ "!# 77"(87 )('' + 67!()! "<$21 =1 *"- , "!!(,# +#("# ++"(!, , )6)(,+ + )66(!, + !87(8!6 '6,(8+ ! 6"! 7)+('# "!# 76,(8' )(!# + 66,()6 "<$21 =1 *"- , "87(!# +6()7 +!)(8) , +!+()" + ),"(,7 + "))("6, )!8(+" ! 6"! #'#(!# "!# 78!("+ #(+, + 68"(!! "<$21 =1 *"- , ##,(#7 +6("+ +!+(++ , +8)(,, + )8!(6, + "+7(!!, )8,(8, ! 6"! #87()' "!# 7',()" )(## + ,))(#' "<$21 =1 *"- , 7)'()8 +6("# +!!(!+ , !"'('! + )'+(,6 + "!'(',, +#,()! ! 6"! #,7(,8 "!# 6++(6" )(7) + ,+,(,6 "<$21 =1 *"- , 7,+()) +7(6' +!!(7! , !''(## + +))('+ + "##(#), !)6(7# ! 6"! #66(#+ "!# 6!7('! +()6 + ,"#(8+ "<$21 =1 *"- , 6"!(88 +7(6' +!"(,' , "7'()+ + ++)()6 + "78(#), !66(++ ! 6"! #7,()7 "!# 6"'(,' )(76 + ,7+(7! "<$21 =1 *"- , 6'#(,+ +7("! +!#(77 , #+8(7' + ++'("# + ",!()8, "!7(6' ! 6"! ##,(76 "!# 67"("! )(68 + ,68()# "<$21 =1 *"- , ,7,()" +7("+ +!)(#' , #,8(,) + +!8(+8 + "87('7, "87(8) ! 6"! #"8(7) "!# 66,()7 +(,! + ,8#(#6 "<$21 =1 *"- , 8+'("# +6(!) ++#("8 , 7"8(6, + +"7('7 + #))('6, ##7(,, ! 6"! #")(7+ "!# 68+('# "()! + 8)+(+6 "<$21 =1 *"- , 88!(+" +7('" ++#()! , 7''()+ + +#"(), + #+6(8+, 7)6(++ ! 6"! #!"(+7 "!# 6',(6, )(#6 + 8+8(+6 "<$21 =1 *"- , '#!(#' +7(#, ++#(+" , 67,(+! + +#'(," + #"+(,!, 76#(!! ! 6"! #+6(!6 "!# ,+!(#8 )(,6 + 8"#(+# "<$21 =1 *"- 8 ))#(8+ +7(## ++7(,' , ,+,(+8 + +76(,# + ##6(,,, 6!#(!8 ! 6"! #)'()! "!# ,!,(#" )(,+ + 87)(## "<$21 =1 *"- 8 )6,("' +#('! ++7(,+ , ,,,(78 + +6"(86 + #6+(7", 68#(68 ! 6"! #)+(68 "!# ,#!(), )(8" + 866(76 "<$21 =1 *"- 8 +!8(6" +#(7, ++7("6 , 8"6(8) + +,)(78 + #,7(6), ,#"(') ! 6"! "'#(,# "!# ,76()" )(7' + 88+(8' "<$21 =1 *"- 8 +'+(## +"(8' ++6()" , 8',(6' + +,,(!, + #8'(7+, 8)#(,' ! 6"! "8,(8# "!# ,6'(8# +(++ + 8',(), "<$21 =1 *"- 8 !7#(+8 +#(88 +!#(#' , '78(#, + +87(+# + 7)!('!, 867(7, ! 6"! ",'(,, "!# ,8"(+! "(,) + '+!(77 "<$21 =1 *"- %+, , $& , -. , , /, /, !!"!# !!"!# 01&,$%% !!"!#&'!(')*+#,- !,!!"!#,./01 . 0 ,!!"!#&'!(')*+#,- 1 , 2!!"!# 0 0 7 9 < 789 = 789 546$/ 7 9 56$ 7 9 -. 7 9 -. 7 9 0 1! 79 0 4! 79 . 79 786>9 - 8 "+7(7, +#(67 +!7(#8 8 )+,(8" + +'#(++ + 7+7(,#, '!#('" ! 6"! ",)(6) "!# ,'7(8) )(76 + '!8(+' "<$21 =1 *"- 8 ",,(#7 +#(7! +!#(+, 8 ),,(,+ + !)"()+ + 7!8(7", '8#(8+ ! 6"! "6+(7+ "!# 8)8(#6 )(7, + '#"(,, "<$21 =1 *"- 8 #"'(,' +6()+ +!+("" 8 +",(87 + !++(8, + 7#!("#8 )##('7 ! 6"! "7!(## "!# 8!!(+" !(6, + '6)(+7 "<$21 =1 *"- 8 7)+(,6 +6(+8 +!)("7 8 +',(#) + !!)(6, + 77,()'8 +)#(7) ! 6"! "#"(#+ "!# 8"6(,# )(7! + ',,(!7 "<$21 =1 *"- 8 76"(") +7(76 +!)(+) 8 !76(7' + !!'(+# + 7,+(6"8 +6"(6' ! 6"! ""#(,! "!# 87+(+7 +()+ + ''#()) "<$21 =1 *"- 8 6!7(6" +7(!7 ++'(,+ 8 "+6(68 + !",(#) + 787('88 !!"(,8 ! 6"! "!6(!# "!# 867(", )(7! ! )+)(#6 "<$21 =1 *"- 8 688()! +#(6# +!)(#+ 8 ",6('6 + !#7(#6 + 7''('+8 !8#()6 ! 6"! "+,(', "!# 8,'(+, +()! ! )!6(#6 "<$21 =1 *"- 8 ,7)()# +#(!6 +!)(!' 8 #",()! + !7"(!8 + 6+"(!68 "##(+! ! 6"! ")'('7 "!# 8'!(#) )(6+ ! )#+(86 "<$21 =1 *"- 8 8+!(#! +7(," +!+(8' 8 #',(!, + !6+(6! + 6!,()88 #)#(", ! 6"! ")+(#) "!# ')6()' !(#7 ! )7,('# "<$21 =1 *"- 8 8,7(") +7(#6 +!+(+7 8 77,(8# + !,)(#6 + 6#+(#'8 #6#('# ! 6"! !'!("# "!# '!)("6 )(7" ! ),#(,' "<$21 =1 *"- 8 '"7()! +#(6! +!+(") 8 6+7(7+ + !,8(#' + 67#(,#8 7!!(6+ ! 6"! !8#(++ "!# '""(#' +(#+ ! )')(!" "<$21 =1 *"- 8 '',(+8 +"(68 +!+(!8 8 6,7(,8 + !86("8 + 66,(,!8 78!(88 ! 6"! !,6()! "!# '#6("7 +(7+ ! +)7("8 "<$21 =1 *"- ' )78(## +7()8 +!+(7, 8 ,"7(+! + !'#("! + 68)(,+8 6#!(!! ! 6"! !6,(88 "!# '7'(!+ !(!' ! +!)(7# "<$21 =1 *"- ' ++'(66 +#(+8 +!)(6! 8 ,'#("6 + ")!(") + 6'"('#8 ,)+(#6 ! 6"! !7'(6' "!# ',!("! +(7! ! +"7('# "<$21 =1 *"- ' +8!(#! +"(7" +!)(,) 8 877(!' + ")'(', + ,)6(8,8 ,6!("' ! 6"! !7+(8" "!# '87(+" +()# ! +7)('+ "<$21 =1 *"- ' !"8(,6 +#(8# +!+('+ 8 ')'('+ + "+,(+7 + ,+8(668 8+,()+ ! 6"! !##(#8 "!# ''6(8+ !("8 ! +6#(6, "<$21 =1 *"- ' ")7('7 +#(77 +!!(+) 8 ',#(') + "!6(+8 + ,""(+!8 88!()) ! 6"! !"7(!! "!7 )++(+! )(## ! +8+(6, "<$21 =1 *"- ' "68(#) +"(6" +!+(87 ' )"7(#8 + ""#(!" + ,#6()+8 '#!(78 ! 6"! !!6('8 "!7 )!"(8' +(#8 ! +'6(8" "<$21 =1 *"- ' #")(,6 +#(7, ++8(8) ' )'7('6 + "#+(8' + ,7'(+"' ))"()6 ! 6"! !+'(+! "!7 )"6(8' +('! ! !++('# "<$21 =1 *"- ' #'"("' +7("7 ++'(## ' +76(#6 + "#'(,6 + ,,"(!7' )6"(76 ! 6"! !++()" "!7 )7)(8' +(!, ! !!,('' "<$21 =1 *"- ' 777(#+ +#(!' ++8()! ' !+6(#! + "7,("' + ,8,(+6' +!"(7! ! 6"! !)"(+' "!7 )6#(6, +(8+ ! !#"(," "<$21 =1 *"- ' 6+,(#+ +!("' ++,()# ' !,6(,# + "6#()+ + ,''(8#' +8"(8# ! 6"! +'6("8 "!7 ),,(!7 "()' ! !7,(8, "<$21 =1 *"- ' 68)(!" +"()+ ++7(8" ' ""8()" + ",)(+7 + 8+!(!+' !#7(+" ! 6"! +')()7 "!7 )8'(7! +(), ! !,+(#' "<$21 =1 *"- ' ,#+(!' +"('" ++#(!7 ' "',(#+ + ",6(+, + 8!7()'' ")#(7+ ! 6"! +8"(8# "!7 +)!("+ +(6! ! !87(#7 "<$21 =1 *"- ' 8)"(## +#("' ++#()! ' #7,(6, + "8!("8 + 8"8(',' "6#(,, ! 6"! +,,(#+ "!7 ++6()' )(,7 ! "))("" "<$21 =1 *"- ' 86#(6+ +#(," ++7()# ' 7+6(8, + "88(,, + 87!('6' #!"(', ! 6"! +,)(8+ "!7 +!'('8 )(,) ! "+7("' "<$21 =1 *"- ' '!6(#7 +#(+8 ++7(77 ' 7,6(,6 + "'7("6 + 866('+' #8"(86 ! 6"! +6#()) "!7 +#"(8" )('+ ! "")(76 "<$21 =1 *"- ' '6!(8, +#(!+ ++6(88 ' 6+!()6 + "''("+ + 8,#('"' 7+'(+6 ! 6"! +7'('# "!7 +7+(,8 )(') ! ""'("6 "<$21 =1 *"- +) )))()) +#(!+ ++6(88 ' 6#8()6 + #)"(#" + 88"()6' 777(+6 ! 6"! +77(6' "!7 +7'(87 )()) ! "#8("6 /D3030 @E @ @ Benjamin Hand Digitally signed by Benjamin Hand Date: 2021.11.12 12:10:19 -09'00'Chelsea Wright Digitally signed by Chelsea Wright Date: 2021.11.15 08:33:53 -09'00' 7' 6KRH'HSWK 3%7' -WV Ϯ ϳϳ <HV ;1R ;<HV 1R )OXLG'HVFULSWLRQ /LQHUKDQJHU,QIR0DNH0RGHO/LQHUWRS3DFNHU" <HV 1R /LQHUKDQJHUWHVWSUHVVXUH;<HV 1R &HQWUDOL]HU3ODFHPHQW 3UHIOXVK6SDFHU 7\SH 'HQVLW\SSJ 9ROXPHSXPSHG%%/V /HDG6OXUU\ 7\SH6DFNV <LHOG 'HQVLW\SSJ 9ROXPHSXPSHG%%/V 0L[LQJ3XPSLQJ5DWHESP 7DLO6OXUU\ 7\SH6DFNV <LHOG 'HQVLW\SSJ 9ROXPHSXPSHG%%/V 0L[LQJ3XPSLQJ5DWHESP 3RVW)OXVK6SDFHU 7\SH 'HQVLW\SSJ 5DWHESP 9ROXPH 'LVSODFHPHQW 7\SH 'HQVLW\SSJ 5DWHESP 9ROXPHDFWXDOFDOFXODWHG )&3SVL 3XPSXVHGIRUGLVSy zĞƐ EŽ &DVLQJ5RWDWHG" <HV y 1R 5HFLSURFDWHG"y <HV 1R 5HWXUQVGXULQJMRE &HPHQWUHWXUQVWRVXUIDFH"y <HV 1R 6SDFHUUHWXUQV"y <HV 1R 9ROWR6XUI &HPHQW,Q3ODFH$W 'DWH (VWLPDWHG72& 0HWKRG8VHG7R'HWHUPLQH72& &DVLQJ2U/LQHU'HWDLO &ůŽĂƚ^ŚŽĞ ϭϬϯͬϰ 5RWDWH&VJ 5HFLS&VJ )W0LQ 33* 6KRH#)&# 7RSRI/LQHU )ORDWV+HOG 6SXG &$6,1*5(&25' &RXQW\ 6WDWH $ODVND 6XSY'<HVVDN-5LOH\ Hilcorp Energy Company &$6,1* &(0(17,1*5(3257 /HDVH :HOO1R%58'DWH5XQ 2FW 6HWWLQJ'HSWKV ŽŵƉŽŶĞŶƚ 6L]H :W *UDGH 7+' 0DNH /HQJWK %RWWRP 7RS t /ŶŶŽǀĞǆ ϭ͘ϲϬ ϯ͕Ϯϱϵ͘Ϯϵ ϯ͕Ϯϱϳ͘ϲϵ &VJ:W2Q+RRN 7\SH)ORDW&ROODU,QQRYH[1R+UVWR5XQ ),56767$*(7XQH3ULPHG6SDFHU ϮϯϴͬϮϰϬ͘ϱ ϭϱϭϬ ϵϬ +DOOLEXUWRQ %XPSSUHVV 9LVXDO %XPS3OXJ" &(0(17,1*5(3257 &VJ:W2Q6OLSV 6SXGPXG 7\SHRI6KRH,QQRYH[&DVLQJ&UHZ:HDWKHUIRUG ǁǁǁ͘ǁĞůůĞǌ͘ŶĞƚtĞůůǌ/ŶĨŽƌŵĂƚŝŽŶDĂŶĂŐĞŵĞŶƚ>>ǀĞƌͺϬϰϴϭϴďƌ ϵϱͬϴΖΖĂƐŝŶŐ:ƚƐ ϵϱͬϴ ϰϬ͘Ϭ >ͲϴϬ t ϴϮ͘Ϯϵ ϯ͕Ϯϱϳ͘ϲϵ ϯ͕ϭϳϱ͘ϰϬ &ůŽĂƚŽůůĂƌ ϭϬϯͬϰ t /ŶŶŽǀĞǆ ϭ͘ϯϴ ϯ͕ϭϳϱ͘ϰϬ ϯ͕ϭϳϰ͘ϬϮ ϵϱͬϴΖΖĂƐŝŶŐ:ƚƐ ϵϱͬϴ ϰϬ͘Ϭ >ͲϴϬ t ϯ͕ϭϰϳ͘ϰϵ ϯ͕ϭϳϰ͘ϬϮ Ϯϲ͘ϱϲ ϵϱͬϴΖΖĂƐŝŶŐWƵƉ:ƚ ϵϱͬϴ ϰϬ͘Ϭ >ͲϴϬ t Ϯ͘ϰϵ Ϯϲ͘ϱϲ Ϯϰ͘Ϭϳ ,ĂŶŐĞƌ ϭϲ Ϭ͘ϵϮ Ϯϰ͘Ϭϳ Ϯϯ͘ϭϱ ,,, ,,, 7' 6KRH'HSWK 3%7' -WV Ϯ ϭϬϮ ϳϮ <HV ;1R ;<HV 1R )OXLG'HVFULSWLRQ /LQHUKDQJHU,QIR0DNH0RGHO /LQHUWRS3DFNHU" <HV 1R /LQHUKDQJHUWHVWSUHVVXUH;<HV 1R &HQWUDOL]HU3ODFHPHQW 3UHIOXVK6SDFHU 7\SH 'HQVLW\SSJ 9ROXPHSXPSHG%%/V /HDG6OXUU\ 7\SH6DFNV <LHOG 'HQVLW\SSJ 9ROXPHSXPSHG%%/V 0L[LQJ3XPSLQJ5DWHESP 7DLO6OXUU\ 7\SH6DFNV <LHOG 'HQVLW\SSJ 9ROXPHSXPSHG%%/V 0L[LQJ3XPSLQJ5DWHESP 3RVW)OXVK6SDFHU 7\SH 'HQVLW\SSJ 5DWHESP 9ROXPH 'LVSODFHPHQW 7\SH 'HQVLW\SSJ 5DWHESP 9ROXPHDFWXDOFDOFXODWHG )&3SVL 3XPSXVHGIRUGLVSy zĞƐ EŽ &DVLQJ5RWDWHG" <HV y 1R 5HFLSURFDWHG"y <HV 1R 5HWXUQVGXULQJMRE &HPHQWUHWXUQVWRVXUIDFH" <HV y 1R 6SDFHUUHWXUQV" <HV y 1R 9ROWR6XUI &HPHQW,Q3ODFH$W 'DWH (VWLPDWHG72& 0HWKRG8VHG7R'HWHUPLQH72& &DVLQJ2U/LQHU'HWDLO ^ŚŽĞ ϴϱͬϴ 5RWDWH&VJ 5HFLS&VJ )W0LQ 33* 6KRH#)&# 7RSRI/LQHU )ORDWV+HOG .&/3+3$ &$6,1*5(&25' &RXQW\ 6WDWH $ODVND 6XSY'<HVVDN-5LFKDUGVRQ Hilcorp Energy Company &$6,1* &(0(17,1*5(3257 /HDVH :HOO1R%58'DWH5XQ 1RY 6HWWLQJ'HSWKV ŽŵƉŽŶĞŶƚ 6L]H :W *UDGH 7+' 0DNH /HQJWK %RWWRP 7RS d /ŶŶŽǀĞǆ ϭ͘ϰϰ ϳ͕ϮϬϱ͘ϯϲ ϳ͕ϮϬϯ͘ϵϮ &VJ:W2Q+RRN7\SH)ORDW&ROODU,QQRYH[1R+UVWR5XQ ),56767$*(7XQHG ϮϳϬͬϮϳϮ ϭϴϵϬ Ϭ +DOOLEXUWRQ %XPSSUHVV &%/ %XPS3OXJ" &(0(17,1*5(3257 &VJ:W2Q6OLSV .&/3+3$ 7\SHRI6KRH,QQRYH[&DVLQJ&UHZ:HDWKHUIRUG ǁǁǁ͘ǁĞůůĞǌ͘ŶĞƚtĞůůǌ/ŶĨŽƌŵĂƚŝŽŶDĂŶĂŐĞŵĞŶƚ>>ǀĞƌͺϬϰϴϭϴďƌ 5DQFHQWUDOL]HUV ĂƐŝŶŐ ϳ Ϯϲ͘Ϭ >ͲϴϬ tͬ sĂŵ ϴϬ͘ϱϵ ϳ͕ϮϬϯ͘ϵϮ ϳ͕ϭϮϯ͘ϯϯ &ůŽĂƚŽůůĂƌ ϴϱͬϴ d /ŶŶŽǀĞǆ ϭ͘ϯϮ ϳ͕ϭϮϯ͘ϯϯ ϳ͕ϭϮϮ͘Ϭϭ ĂƐŝŶŐ ϳ Ϯϲ͘Ϭ >ͲϴϬ tͬ sĂŵ ϰ͕Ϯϯϵ͘ϳϰ ϳ͕ϭϮϮ͘Ϭϭ Ϯ͕ϵϲϮ͘ϴϲ ^ǁĞůůWĂĐŬĞƌ ϴϯͬϰ tͬ sĂŵ ϵ͘ϯϬ Ϯ͕ϵϲϮ͘ϴϲ Ϯ͕ϵϱϯ͘ϴϲ ĂƐŝŶŐ ϳ Ϯϲ͘Ϭ >ͲϴϬ tͬ sĂŵ Ϯ͕ϵϯϭ͘ϲϲ Ϯ͕ϵϱϯ͘ϴϲ ϮϮ͘ϮϬ WƵƉ ϳ Ϯϲ͘Ϭ >ͲϴϬ d sĂŵ Ϯ͘ϰϱ ϮϮ͘ϮϬ ϭϵ͘ϳϱ ,ĂŶŐĞƌ ϭϬϯͬϰ d Ϭ͘ϰϯ ϭϵ͘ϳϱ ϭϵ͘ϯϮ 7\SH,,, 7\SH,,, 7' 6KRH'HSWK 3%7' -WV ϭ ϭ ϵϮ ;<HV 1R ;<HV 1R )OXLG'HVFULSWLRQ /LQHUKDQJHU,QIR0DNH0RGHO/LQHUWRS3DFNHU"y <HV 1R /LQHUKDQJHUWHVWSUHVVXUH;<HV 1R &HQWUDOL]HU3ODFHPHQW 3UHIOXVK6SDFHU 7\SH 'HQVLW\SSJ 9ROXPHSXPSHG%%/V /HDG6OXUU\ 7\SH6DFNV <LHOG 'HQVLW\SSJ 9ROXPHSXPSHG%%/V 0L[LQJ3XPSLQJ5DWHESP 7DLO6OXUU\ 7\SH6DFNV <LHOG 'HQVLW\SSJ 9ROXPHSXPSHG%%/V 0L[LQJ3XPSLQJ5DWHESP 3RVW)OXVK6SDFHU 7\SH 'HQVLW\SSJ5DWHESP9ROXPH 'LVSODFHPHQW 7\SH 'HQVLW\SSJ 5DWHESP 9ROXPHDFWXDOFDOFXODWHG )&3SVL 3XPSXVHGIRUGLVSy zĞƐ EŽ &DVLQJ5RWDWHG"y <HV 1R 5HFLSURFDWHG"y <HV 1R 5HWXUQVGXULQJMRE &HPHQWUHWXUQVWRVXUIDFH"<HV y 1R 6SDFHUUHWXUQV"<HV y 1R 9ROWR6XUI &HPHQW,Q3ODFH$W 'DWH (VWLPDWHG72& 0HWKRG8VHG7R'HWHUPLQH72& &DVLQJ2U/LQHU'HWDLO &ůŽĂƚ^ŚŽĞ ϱ 5RWDWH&VJ 5HFLS&VJ )W0LQ33* 6KRH#)&#7RSRI/LQHU )ORDWV+HOG .&/0XG &$6,1*5(&25' &RXQW\6WDWH $ODVND 6XSY53HGHUVRQ-5LOH\ Hilcorp Energy Company &$6,1* &(0(17,1*5(3257 /HDVH :HOO1R%58'DWH5XQ 1RY 6HWWLQJ'HSWKV ŽŵƉŽŶĞŶƚ 6L]H :W*UDGH 7+'0DNH /HQJWK %RWWRP 7RS dϭ͘ϴϭ ϭϬ͕ϬϬϬ͘ϬϬ ϵ͕ϵϵϴ͘ϭϵ &VJ:W2Q+RRN7\SH)ORDW&ROODU,QQRYH[1R+UVWR5XQ ),56767$*(3ULPH7XQHG ϭϰϮ͘ϴͬϭϰϱ ϭϲϴϯ Ϭ +DOOLEXUWRQ %XPSSUHVV &%/ %XPS3OXJ" &(0(17,1*5(3257 &VJ:W2Q6OLSV .&/3RO\PHU 7\SHRI6KRH&DVLQJ&UHZ-+REEV +5'(=;3 ǁǁǁ͘ǁĞůůĞǌ͘ŶĞƚtĞůůǌ/ŶĨŽƌŵĂƚŝŽŶDĂŶĂŐĞŵĞŶƚ>>ǀĞƌͺϬϰϴϭϴďƌ WƵƉ:ƚ ϰϭͬϮ ϭϮ͘ϲ >ͲϴϬ dϭ͘ϲϴ ϵ͕ϵϵϴ͘ϭϵ ϵ͕ϵϵϲ͘ϱϭ &ůŽĂƚŽůůĂƌ ϱ dϭ͘ϱϱ ϵ͕ϵϵϲ͘ϱϭ ϵ͕ϵϵϰ͘ϵϲ ϰ͘ϱΖΖ>ŝŶĞƌ:ƚ ϰϭͬϮ ϭϮ͘ϲ >ͲϴϬ dϰϭ͘ϲϬ ϵ͕ϵϵϰ͘ϵϲ ϵ͕ϵϱϯ͘ϯϲ >ĂŶĚŝŶŐŽůůĂƌ ϱ dϭ͘Ϭϵ ϵ͕ϵϱϯ͘ϯϲ ϵ͕ϵϱϮ͘Ϯϳ ϰ͘ϱΖΖ>ŝŶĞƌ:ƚ ϰϭͬϮ ϭϮ͘ϲ >ͲϴϬ dϰϭ͘ϬϮ ϵ͕ϵϱϮ͘Ϯϳ ϵ͕ϵϭϭ͘Ϯϱ ƌŽƐƐKǀĞƌ ϱϭͬϮ Zd^Ͳϴ ϭ͘ϳϬ ϵ͕ϵϭϭ͘Ϯϱ ϵ͕ϵϬϵ͘ϱϱ ϰ͘ϱΖΖ>ŝŶĞƌ:ƚƐ ϰϭͬϮ ϭϮ͘ϴ WͲϭϭϬ Zd^Ͳϴ Ϯ͕ϴϳϵ͘ϴϵ ϵ͕ϵϬϵ͘ϱϱ ϳ͕ϬϮϵ͘ϲϲ ƌŽƐƐKǀĞƌ ϱϭͬϮ dϭ͘ϴϱ ϳ͕ϬϮϵ͘ϲϲ ϳ͕ϬϮϳ͘ϴϭ >ŝŶĞƌ,ĂŶŐĞƌ ϲ ĂŬĞƌ Ϯϰ͘Ϯϭ ϳ͕ϬϮϳ͘ϴϭ ϲ͕ϵϵϳ͘Ϯϭ 7\SH,,, 7\SH,,, David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/10/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* WaveSonic (DIPOLE) Record: 11/10/2021 Processing Report: 11/15/2021 Please include current contact information if different from above. Received By: 01/10/2022 37' (6HW By Abby Bell at 3:30 pm, Jan 10, 2022 Kaitlyn Barcelona Hilcorp North Slope, LLC GeoTechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: 907 777-8337 E-mail: kaitlyn.barcelona@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/05/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* Plug Perf 12/08/2021 Please include current contact information if different from above. 37' (6HW ceived By: 01/07/2022 By Abby Bell at 4:48 pm, Jan 05, 2022 Kaitlyn Barcelona Hilcorp North Slope, LLC GeoTechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: 907 777-8337 E-mail: kaitlyn.barcelona@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 01/05/2022 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* CBL 11/30/2021 Please include current contact information if different from above. 37' (6HW Received By: 01/07/2022 By Abby Bell at 4:47 pm, Jan 05, 2022 David Douglas Hilcorp Alaska, LLC Sr. Geotechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: (907) 777-8337 E-mail: david.douglas@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 12/20/2021 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) *CONFIDENTIAL* MUDLOGS - EOW DRILLING REPORTS (10/19/2021 to 11/09/2021) 1. FINAL EOW REPORTS 2. DIGITAL DATA 3. MUDLOGS (2” and 5” MD and TVD COLOR PRINTS) Formation Evaluation Log Gas Ratio Log Drilling Evaluation Log SFTP Transfer - Data Folders: Please include current contact information if different from above. Received By: 12/20/2021 37' (6HW By Abby Bell at 11:36 am, Dec 20, 2021 7\SHRI5HTXHVW $EDQGRQ 3OXJ3HUIRUDWLRQV )UDFWXUH6WLPXODWH 5HSDLU:HOO &HPHQW$QQXOXV 6XVSHQG 3HUIRUDWH 2WKHU6WLPXODWH 3XOO7XELQJ &RLO7XELQJ 3OXJIRU5HGULOO 3HUIRUDWH1HZ3RRO 5HHQWHU6XVS:HOO $OWHU&DVLQJ 2SHUDWRU1DPH&XUUHQW:HOO&ODVV3HUPLWWR'ULOO1XPEHU ([SORUDWRU\'HYHORSPHQW $GGUHVV6WUDWLJUDSKLF 6HUYLFH $3,1XPEHU ,ISHUIRUDWLQJ:HOO1DPHDQG1XPEHU :KDW5HJXODWLRQRU&RQVHUYDWLRQ2UGHUJRYHUQVZHOOVSDFLQJLQWKLVSRRO" :LOOSODQQHGSHUIRUDWLRQVUHTXLUHDVSDFLQJH[FHSWLRQ"<HV1R 3URSHUW\'HVLJQDWLRQ/HDVH1XPEHU)LHOG3RROV 7RWDO'HSWK0'IW 7RWDO'HSWK79'IW (IIHFWLYH'HSWK0' (IIHFWLYH'HSWK79' 0363SVL3OXJV0'-XQN0' 1$ &DVLQJ &ROODSVH 6WUXFWXUDO &RQGXFWRU SVL 6XUIDFH SVL ,QWHUPHGLDWH SVL /LQHU SVL 3DFNHUVDQG66697\SH3DFNHUVDQG66690'IWDQG79'IW $WWDFKPHQWV 3URSRVDO6XPPDU\ :HOOERUHVFKHPDWLF :HOO&ODVVDIWHUSURSRVHGZRUN 'HWDLOHG2SHUDWLRQV3URJUDP %236NHWFK ([SORUDWRU\6WUDWLJUDSKLF 'HYHORSPHQW 6HUYLFH (VWLPDWHG'DWHIRU :HOO6WDWXVDIWHUSURSRVHGZRUN &RPPHQFLQJ2SHUDWLRQV2,/:,1-:'63/6XVSHQGHG 9HUEDO$SSURYDO'DWH*$6 :$**6725 63/8* $2*&&5HSUHVHQWDWLYH*,1-2S6KXWGRZQ $EDQGRQHG &RQWDFW1DPH -DNH)ORUD &RQWDFW(PDLO &RQWDFW3KRQH $XWKRUL]HG7LWOH &RQGLWLRQVRIDSSURYDO1RWLI\$2*&&VRWKDWDUHSUHVHQWDWLYHPD\ZLWQHVV 6XQGU\1XPEHU 3OXJ,QWHJULW\ %237HVW 0HFKDQLFDO,QWHJULW\7HVW /RFDWLRQ&OHDUDQFH 2WKHU 3RVW,QLWLDO,QMHFWLRQ0,75HT G"<HV 1R 6SDFLQJ([FHSWLRQ5HTXLUHG"<HV 1R 6XEVHTXHQW)RUP5HTXLUHG $33529('%< $SSURYHGE\ &200,66,21(5 7+($2*&& 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ aSVL 1$ ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEHGHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO $XWKRUL]HG1DPHDQG 'LJLWDO6LJQDWXUHZLWK'DWH $2*&&86(21/< 'DQ0DUORZH2SHUDWLRQV0DQDJHU MDNHIORUD#KLOFRUSFRP 7XELQJ*UDGH 7XELQJ0'IW3HUIRUDWLRQ'HSWK79'IW 7XELQJ6L]H %DNHU=;3/LQHU7RS3DFNHU 0' 79' 35(6(17:(//&21',7,216800$5< 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 $33/,&$7,21)25681'5<$33529$/6 $$& $'/ %58 %HOXJD5LYHU)LHOG8QGHILQHG%HOXJD*DV3RRO &2 $$& &HQWHUSRLQW'ULYH6XLWH $QFKRUDJH$. +LOFRUS$ODVND//& 2WKHU&%//RJ12SHUDWLRQV /HQJWK 6L]H SSI3 79'%XUVW SVL 0' SVL SVL SVL 3HUIRUDWLRQ'HSWK0'IW 3HUIRUDWH 5HSDLU:HSDLU:HOO ([SORUDWRU\6WUDWLJUDSKLF 'HYHORSPHQW 6HUYLFH %237HVW0HFKDQLFDO,QWHJULW\7HVW /RFDWLRQ&OHDUDQFH 1R 1R )RUP5HYLVHG$SSURYHGDSSOLFDWLRQLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDO By Samantha Carlisle at 12:36 pm, Dec 02, 2021 'LJLWDOO\VLJQHGE\'DQ0DUORZH '1FQ 'DQ0DUORZH RX 8VHUV 'DWH 'DQ0DUORZH ; '65 &7 %23 WHVW WR SVL 0,7,$ WR SVL ZLWKLQ GD\V RI UHWXUQ WR SURGXFWLRQ SRVW SHUIRUDWLRQV 3URYLGH KUV QRWLFH IRU $2*&& ZLWQHVV RI 0,7$ ; ; %-0 '/% dts 12/6/2021 JLC 12/6/2021 Jeremy Price Digitally signed by Jeremy Price Date: 2021.12.06 12:34:17 -09'00' RBDMS HEW 12/7/2021 tĞůůWƌŽŐŶŽƐŝƐ tĞůůEĂŵĞ͗ZhϮϮϯͲϮϰW/EƵŵďĞƌ͗ϱϬͲϮϴϯͲϮϬϭϴϯͲϬϬͲϬϬ ƵƌƌĞŶƚ^ƚĂƚƵƐ͗EĞǁ'ƌĂƐƐƌŽŽƚƐtĞůů>ĞŐ͗Eͬ ƐƚŝŵĂƚĞĚ^ƚĂƌƚĂƚĞ͗ϭϮͬϬϯͬϮϭZŝŐ͗ͲůŝŶĞ ZĞŐ͘ƉƉƌŽǀĂůZĞƋ͛Ě͍zĞƐĂƚĞZĞŐ͘ƉƉƌŽǀĂůZĞĐ͛ǀĚ͗ ZĞŐƵůĂƚŽƌǇŽŶƚĂĐƚ͗:ƵĂŶŝƚĂ>ŽǀĞƚƚWĞƌŵŝƚƚŽƌŝůůEƵŵďĞƌ͗ϮϮϭͲϬϳϮ &ŝƌƐƚĂůůŶŐŝŶĞĞƌ͗:ĂŬĞ&ůŽƌĂ;ϵϬϳͿϳϳϳͲϴϰϰϮ;KͿ;ϳϮϬͿϵϴϴͲϱϯϳϱ;Ϳ ^ĞĐŽŶĚĂůůŶŐŝŶĞĞƌ͗ZǇĂŶZƵƉĞƌƚ;ϵϬϳͿϳϳϳͲϴϱϬϯ;KͿ;ϵϬϳͿϯϬϭͲϭϳϯϲ;Ϳ &EƵŵďĞƌ͗ϮϭϭͲϬϬϬϲϭ 0D[LPXP([SHFWHG%+3SVL SVLIWJUDGLHQW¶79' 0D[3RWHQWLDO6XUIDFH3UHVVXUHSVL %+3PLQXVSVLIWJUDGLHQW ƌŝĞĨtĞůů^ƵŵŵĂƌǇ ZhϮϮϯͲϮϰŝƐĂϮϬϮϭŐƌĂƐƐƌŽŽƚƐǁĞůůƚĂƌŐĞƚŝŶŐƚŚĞdǇŽŶĞŬ͕ĞůƵŐĂ͕ĂŶĚ^ƚĞƌůŝŶŐŐĂƐƐĂŶĚƐ͘dŚĞdǇŽŶĞŬdͲϭϵΘ dͲϭϳƐĂŶĚƐŚĂǀĞďĞĞŶƚĞƐƚĞĚĂŶĚĚĞĞŵĞĚǁĞƚĂŶĚŶŽŶͲĐŽŵŵĞƌĐŝĂů͕ǁŚŝůĞƚŚĞdͲϴƐĂŶĚƐĂƌĞŝŶƚŚĞƉƌŽĐĞƐƐŽĨ ďĞŝŶŐƉĞƌĨŽƌĂƚĞĚĂŶĚƚĞƐƚĞĚ͘'ŝǀĞŶƚŚŝƐƚŚĞǇĂƌĞƐŚŽǁŶĂƐƌĞĚŽŶƚŚĞĂƚƚĂĐŚĞĚǁĞůůďŽƌĞĚŝĂŐƌĂŵƐ͘dŚĞĞůƵŐĂ ĂŶĚ^ƚĞƌůŝŶŐƐĂŶĚƐĂƌĞĐĞŵĞŶƚĞĚďĞŚŝŶĚƚŚĞϳ͟ŝŶƚĞƌŵĞĚŝĂƚĞĐĂƐŝŶŐǁŝƚŚϰͲϭͬϮ͟ƚƵďŝŶŐƚŽƐƵƌĨĂĐĞĂŶĚƚŚƵƐŶŽƚ ĐƵƌƌĞŶƚůǇŝƐŽůĂƚĞĚĨŽƌƉĞƌĨŽƌĂƚŝŶŐ͘ dŚĞƉƵƌƉŽƐĞŽĨƚŚŝƐǁŽƌŬͬƐƵŶĚƌǇŝƐƚŽŝƐŽůĂƚĞƚŚĞĞůƵŐĂĂŶĚ^ƚĞƌůŝŶŐƐĂŶĚƐďǇĐĞŵĞŶƚŝŶŐƚŚĞϰͲϭͬϮ͟ǆϳ͟ĂŶŶƵůƵƐ ƚŽĐƌĞĂƚĞĂϰͲϭͬϮ͟ŵŽŶŽͲďŽƌĞƚŽƚĞƐƚĂŶĚƉƌŽĚƵĐĞƚŚƌŽƵŐŚ͘ EŽƚĞƐZĞŐĂƌĚŝŶŐtĞůůďŽƌĞŽŶĚŝƚŝŽŶ xϳ͟>ƌĂŶŽŶϭϬͲϯϭͲϮϭ͕dKΛΕϯϮϲϬ͛ xϰͲϭͬϮ͟>ƌĂŶŽŶϭϭͲϮϰͲϮϭ͕dKΛΕϳϬϲϱ͛ WƌŽĐĞĚƵƌĞ;WƌĞ^ƵŶĚƌǇtŽƌŬͿ ϭ͘D/ZhͲůŝŶĞ͕WdůƵďƌŝĐĂƚŽƌĂďŽǀĞD^W Ϯ͘^Ğƚ/WĂƚϴϲϳϬ͛;Ϯϱ͛ĂďŽǀĞŚŝŐŚĞƐƚŽƉĞŶdǇŽŶĞŬƉĞƌĨŽƌĂƚŝŽŶƐͿ ϯ͘ƵŵƉďĂŝůϮϱ͛ĐĞŵĞŶƚŽŶƉůƵŐ ϰ͘>ŽĂĚǁĞůů͕ƉƌĞƐƐƵƌĞƚĞƐƚ/WƚŽϮϱϬϬƉƐŝĨŽƌϭϬŵŝŶƵƚĞƐ ϱ͘^Ğƚ/WĂƚΕϳϭϬϬ͛;ƚŚŝƐǁŝůůďĞƵƐĞĚĨŽƌĐŽŝůĚĞƉƚŚĐŽŶƚƌŽůǁŝƚŚŽŶĞͲƚƌŝƉĐĞŵĞŶƚƌĞƚĂŝŶĞƌͿ ϲ͘WƌĞƐƐƵƌĞƵƉ/ƚŽϱϬϬƉƐŝǁŝƚŚŵĞƚŚĂŶŽů ϳ͘dƵďŝŶŐƉƵŶĐŚΕϲϵϴϬͲϲϵϵϬ͛;Εϳ͛ĂďŽǀĞůŝŶĞƌƚŽƉƉĂĐŬĞƌͿ ϴ͘tĂƚĐŚƚƵďŝŶŐĂŶĚ/ƉƌĞƐƐƵƌĞƐƚŽĐŽŶĨŝƌŵĐŽŵŵƵŶŝĐĂƚŝŽŶ ϵ͘ZͲůŝŶĞ WƌŽĐĞĚƵƌĞ;^ƵŶĚƌǇtŽƌŬͿ ϭ͘D/ZhŽŝůĞĚdƵďŝŶŐ͕ŶŽƚŝĨǇK'ϰϴŚŽƵƌƐŝŶĂĚǀĂŶĐĞŽĨKWƚĞƐƚ͕WdKWĂďŽǀĞD^W Ϯ͘Z/,ǁŽŶĞƚƌŝƉĐĞŵĞŶƚƌĞƚĂŝŶĞƌ͕ƚĂŐ/WĂƚϳϭϬϬ͕͛ĐŽƌƌĞĐƚĚĞƉƚŚ͕ƐĞƚƌĞƚĂŝŶĞƌĂƚΕϲϵϯϬ;ϱϬ͛ĂďŽǀĞ ƚƵďŝŶŐƉƵŶĐŚŚŽůĞƐͿ ϯ͘ZhĐĞŵĞŶƚĞƌƐ͕ĞƐƚĂďůŝƐŚĐŝƌĐƵůĂƚŝŽŶ͕ƉƵŵƉϳϳďďůƐϭϱ͘ϯƉƉŐĐĞŵĞŶƚďĞůŽǁƌĞƚĂŝŶĞƌĂŶĚŝŶƚŽϰ͘ϱǆϳ ĂŶŶƵůƵƐ;WůĂŶŶĞĚdKŝƐϮϴϬϬ͛Ϳ ϰ͘ŝƐƉůĂĐĞĐĞŵĞŶƚƚŽƌĞƚĂŝŶĞƌ͕ƵŶͲƐƚŝŶŐ͕ĨůŽǁĐŚĞĐŬ͕dKK,͕ĨƌĞĞǌĞƉƌŽƚĞĐƚƚŽƉϱϬ͛ ϱ͘tK ϲ͘>ŽŐ>͕ƐĞŶĚƌĞƐƵůƚƐƚŽK' ϳ͘d/,ǁŝƚŚĨƵůů/ŶŽǌǌůĞƚŽƌĞƚĂŝŶĞƌ͕ďůŽǁǁĞůůĚƌǇǁŝƚŚŶŝƚƌŽŐĞŶ͕ƚƌĂƉϮϱϬϬƉƐŝŽŶǁĞůůďŽƌĞ *DYH YHUEDO DSSURYDO IRU WKLV 3UH 6XQGU\ :RUN VWHSV EMP tĞůůWƌŽŐŶŽƐŝƐ ϴ͘ZDKŽŝůĞĚdƵďŝŶŐ ϵ͘D/ZhͲůŝŶĞĂŶĚƉƌĞƐƐƵƌĞĐŽŶƚƌŽůĞƋƵŝƉŵĞŶƚ͕WdůƵďƌŝĐĂƚŽƌƚŽĂďŽǀĞD^W ϭϬ͘WĞƌĨŽƌĂƚĞĞůƵŐĂʹĞůƵŐĂ:ϰ^ĂŶĚƐĨƌŽŵďŽƚƚŽŵƵƉƉĞƌƉƌŽŐƌĂŵ͘;Εϯϵϭϴ͛ʹϲϴϯϬ͛DͿ &ƌĂĐƚƵƌĞ'ƌĂĚŝĞŶƚĂůĐƵůĂƚŝŽŶƐ͗ >KdΛϳ͟ĐĂƐŝŶŐƐŚŽĞ;ϳϮϬϱ͛Dͬϲϵϰϱ͛dsͿсϭϱ͘ϮƉƉŐDtсϬ͘ϳϵƉƐŝͬĨƚŐƌĂĚŝĞŶƚ &ŽƌŵĂƚŝŽŶŝŶƚĞŐƌŝƚǇĂƚŚŝŐŚĞƐƚƉƌŽƉŽƐĞĚƉĞƌĨсϬ͘ϳϵƉƐŝͬĨƚǆϯϴϭϲ͛dsсϯϬϭϲƉƐŝ DĂǆƉŽƌĞƉƌĞƐƐƵƌĞŽĨůŽǁĞƐƚƉĞƌĨсϬ͘ϰϱƉƐŝͬĨƚǆϲϱϴϰ͛dsсϮϵϲϮƉƐŝ DĂǆƉƌĞƐƐƵƌĞƵƉƉĞƌƉĞƌĨƐĐŽƵůĚƐĞĞǁŝƚŚůŽǁĞƐƚƉĞƌĨƐŽƉĞŶĂŶĚŐĂƐƚŽƐƵƌĨĂĐĞ сϮϯϬϰƉƐŝƐƵƌĨĂĐĞƉƌĞƐƐƵƌĞͬϮϲϴϲƉƐŝĂƚƵƉƉĞƌƉĞƌĨƐͬϮϵϲϮƉƐŝĂƚůŽǁĞƌƉĞƌĨƐ ΎΎ>ŽǁĞƐƚƉĞƌĨŽƌĂƚŝŽŶƐǁŝůůŶŽƚĨƌĂĐƚƵƌĞŚŝŐŚĞƐƚƉĞƌĨŽƌĂƚŝŽŶƐΎΎ ĂͿ$OOVDQGVOLHLQWKH%HOXJD5LYHU8QGHILQHG*DV3RRO D )LQDO3HUIVWLHLQVKHHWZLOOEHSURYLGHGLQWKHILHOGIRUH[DFWSHUILQWHUYDOV E &RUUHODWHXVLQJ2SHQ+ROH&RUUHODWLRQ/RJSURYLGHGE\*HRORJLVW6HQGWKHFRUUHODWLRQSDVV WRWKH2SHUDWLRQV(QJLQHHU5HVHUYRLU(QJLQHHUDQG*HRORJLVWIRUFRQILUPDWLRQ ϭϭ͘WKK, ϭϮ͘ZͲůŝŶĞ ϭϯ͘dƵƌŶǁĞůůŽǀĞƌƚŽƉƌŽĚƵĐƚŝŽŶƚŽƚĞƐƚ;dĞƐƚ^^sǁŝƚŚͲŝŶϱĚĂǇƐŽĨƐƚĂďůĞƉƌŽĚƵĐƚŝŽŶŽŶǁĞůůʹŶŽƚŝĨǇ K'ϰϴŚƌƐďĞĨŽƌĞƚĞƐƚŝŶŐͿ ϭϰ͘D/d/ƚŽD^WǁŝƚŚŝŶϭϰĚĂǇƐŽĨƐƚĂďůĞƉƌŽĚƵĐƚŝŽŶ ŽŝůdƵďŝŶŐWƌŽĐĞĚƵƌĞ;ŽŶƚŝŶŐĞŶĐǇŝĨĨŝůůŝƐĞŶĐŽƵŶƚĞƌĞĚĂĨƚĞƌƉĞƌĨŽƌĂƚŝŶŐ͕ŽƌĐĞŵĞŶƚƐƚƌŝŶŐĞƌƐĂĨƚĞƌ ĐĞŵĞŶƚŝŶŐͿ͗ ϭ͘D/ZhŽŝůĞĚdƵďŝŶŐ͕ŶŽƚŝĨǇK'ϰϴŚŽƵƌƐŝŶĂĚǀĂŶĐĞŽĨKWƚĞƐƚ͕WdKWĂďŽǀĞD^W Ϯ͘ůĞĂŶŽƵƚƚŽd ϯ͘ůŽǁĚŽǁŶǁĞůůǁŝƚŚŶŝƚƌŽŐĞŶ͕ƚƌĂƉƉƌĞƐƐƵƌĞĨŽƌƉĞƌĨŽƌĂƚŝŶŐ͕ZDKdh ͲůŝŶĞWƌŽĐĞĚƵƌĞ;ŽŶƚŝŶŐĞŶĐǇŝĨǁĂƚĞƌŝƐĞŶĐŽƵŶƚĞƌĞĚĂĨƚĞƌƉĞƌĨŽƌĂƚŝŶŐͿ͗ ϭ͘D/ZhͲ>ŝŶĞ͕WdůƵďƌŝĐĂƚŽƌĂďŽǀĞD^W Ϯ͘Z/,ĂŶĚƐĞƚƉůƵŐĂďŽǀĞƚŚĞƉĞƌĨŽƌĂƚŝŽŶƐKZƐĞƚƉĞƌŵĂŶĞŶƚƉĂƚĐŚŽǀĞƌƚŚĞǁĞƚƉĞƌĨŽƌĂƚŝŽŶƐ͘ ƚƚĂĐŚŵĞŶƚƐ͗ ϭ͘ƵƌƌĞŶƚtĞůů^ĐŚĞŵĂƚŝĐ Ϯ͘WƌŽƉŽƐĞĚtĞůů^ĐŚĞŵĂƚŝĐ ϯ͘ŽŝůƚƵďŝŶŐKW ϰ͘^ƚĂŶĚĂƌĚtĞůůWƌŽĐĞĚƵƌĞʹEϮKƉĞƌĂƚŝŽŶƐ 0,7,$ WR SVL SURYLGH $2*&& RSSRUWXQLW\ WR ZLWQHVV EMP $W WKH FVJ VKRH ),7 ZDV WR SSJ RU SVLIW IUDF JUDGLHQW 7KLV ZRXOG VWLOO SURYLGH WKH URFN VWUHQJWK WR DOORZ SHUIRUDWLQJ DW 79' SVLIW [ SVL IRUPDWLRQ LQWHJULW\ EMP BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB hƉĚĂƚĞĚǇ͗:D&ϭϭͬϯϬͬϮϭ ^ĐŚĞŵĂƚŝĐ tĞůů͗ZhϮϮϯͲϮϰ Wd͗ϮϮϭͲϬϳϮ W/͗ϱϬͲϮϴϯͲϮϬϭϴϯͲϬϬͲϬϬ ŽŵƉůĞƚĞĚ͗&hdhZ ŽŶĞ dŽƉ;DͿ ƚŵ;DͿ dŽƉ;dsͿ ƚŵ;dsͿ &d ĂƚĞ ^ƚĂƚƵƐ dͲϴ цϴ͕ϲϵϱ͛цϴ͕ϳϭϱ͛цϴ͕ϯϴϰ͛цϴ͕ϰϬϯ͛ϮϬ WƌŽƉŽƐĞĚ d dͲϴ цϴ͕ϳϮϬ͛цϴ͕ϳϰϬ͛цϴ͕ϰϬϴ͛цϴ͕ϰϮϳ͛ϮϬ WƌŽƉŽƐĞĚ d dͲϭϳ ϵ͕ϲϲϳ͛ϵ͕ϲϴϳ͛ϵ͕ϯϮϱ͛ϵ͕ϯϰϱ͛ϮϬ ϭϭͲϮϵͲϮϭ KƉĞŶ dͲϭϳ ϵ͕ϳϬϬ͛ϵ͕ϳϮϬ͛ϵ͕ϯϱϳ͛ϵ͕ϯϳϳ͛ϮϬ ϭϭͲϮϵͲϮϭ KƉĞŶ dͲϭϵ ϵ͕ϵϬϲ͛ϵ͕ϵϮϲ͛ϵ͕ϱϱϳ͛ϵ͕ϲϰϲ͛ϮϬ ϭϭͲϮϲͲϮϭ /ƐŽůĂƚĞĚ DEdd/> ϵͲϱͬϴ͟dKΛ ^ƵƌĨĂĐĞ ;ϱϬйĞǆĐĞƐƐͿ ϳΗ dKΛϯϮϲϬ͛;>ϭϬͲϯϭͲϮϭͿ ϰͲϭͬϮ͟ >ŝŶĞƌ dKΛϳϬϲϱ͛;>ϭϭͲϮϰͲϮϭͿ ϭϲ͟ KƌŝŐ͘<ůĞǀ͗͘ϭϴ͘ϱ͛ͬ'>ůĞǀ͗͘ϳϰ͘ϰ͛ ϳ͟ ϵͲϱͬϴ͟ ϰͲϭͬϮ͟ ϲͲϭͬϴ͟,ŽůĞ ϴͲϭͬϮ͟,ŽůĞ ϭϮͲϭͬϰ͟,ŽůĞ dс цϭϬ͕ϬϬϬ͛;DͿ ͬdс yyyyy Wdс цϵϵϱϯ͛;DͿͬWdсцyyyy͛;dsͿ ^/E'Θdh/E'd/> ^ŝǌĞ dǇƉĞ tƚ 'ƌĂĚĞ ŽŶŶ͘ / dŽƉ ƚŵ ϭϲ͟ŽŶĚƵĐƚŽƌʹ ƌŝǀĞŶ ƚŽ^ĞƚĞƉƚŚϴϰ yͲϱϲtĞůĚ ϭϱ͘Ϭϭ͟^ƵƌĨ ϭϮϬ͛ ϵͲϱͬϴ͟^ƵƌĨƐŐ ϰϬ >ͲϴϬ tϴ͘ϴϯϱ͟^ƵƌĨ ϯ͕Ϯϱϵ͛ ϳΗ /Ŷƚ͘ƐŐ Ϯϲ >ͲϴϬ tϲ͘Ϯϳϲ͟^ƵƌĨ ϳ͕ϮϬϱ͛ ϰͲϭͬϮΗ WƌŽĚ >Ŷƌ ϭϮ͘ϳϱ WͲϭϭϬ d^Ͳ,W ϯ͘ϵϱϴ͟ϲ͕ϵϵϳ͛ϵ͕ϵϵϴ͛ ϰͲϭͬϮΗ dƵďŝŶŐ ϭϮ͘ϳϱ WͲϭϭϬ d^Ͳ,W ϯ͘ϵϱϴ͟^ƵƌĨ ϲ͕ϵϵϳ͛ :t>Zzd/> EŽ͘ĞƉƚŚ ;DͿ ĞƉƚŚ ;dsͿ/K /ƚĞŵ ϭ ϭ͕ϵϵϬ͛ϭ͕ϵϵϬ͛ϯ͘ϵϱϴ͟ϱ͘ϲϮϱ͟ŚĞŵŝĐĂů/ŶũĞĐƚŝŽŶ^Ƶď Ϯ Ϯ͕ϵϱϯ͛Ϯ͕ϵϬϮ͛ϲ͘Ϯϳϲ͟ϴ͘ϴϯϱ͟ϳ͟^ǁĞůů WĂĐŬĞƌ ϯ ϲ͕ϵϵϳ͛ϲ͕ϳϵϬ͛ϰ͘ϴϳϱ͟ϲ͘ϱϰϬ͟>ŝŶĞƌŚĂŶŐĞƌͬ>dW ƐƐĞŵďůǇ ϰ ϵ͕ϴϬϰ͛ϵ͕ϰϱϴ͛ϰͲϭͬϮ/W͕ƐĞƚ ϭϭͬϮϴͬϮϭ ;ƚŽƉŽĨĨŝůůĂƚϵϴϬϳ͛Ϳ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB hƉĚĂƚĞĚǇ͗:D&ϭϭͬϯϬͬϮϭ WZKWK^ tĞůů͗ZhϮϮϯͲϮϰ Wd͗ϮϮϭͲϬϳϮ W/͗ϱϬͲϮϴϯͲϮϬϭϴϯͲϬϬͲϬϬ ŽŵƉůĞƚĞĚ͗/ŶWƌŽŐƌĞƐƐ WZ&KZd/KEd/> ŽŶĞ dŽƉ;DͿ ƚŵ;DͿ dŽƉ;dsͿ ƚŵ;dsͿ &d ĂƚĞ ^ƚĂƚƵƐ ĞůƵŐĂ цϯ͕ϵϭϴ͛цϲ͕ϴϯϬ͛цϯ͕ϴϭϲ͛цϲ͕ϱϴϰ͛dWƌŽƉŽƐĞĚ d dͲϴ цϴ͕ϲϵϱ͛цϴ͕ϳϭϱ͛цϴ͕ϯϴϰ͛цϴ͕ϰϬϯ͛ϮϬ WƌŽƉŽƐĞĚ d dͲϴ цϴ͕ϳϮϬ͛цϴ͕ϳϰϬ͛цϴ͕ϰϬϴ͛цϴ͕ϰϮϳ͛ϮϬ WƌŽƉŽƐĞĚ d dͲϭϳ ϵ͕ϲϲϳ͛ϵ͕ϲϴϳ͛ϵ͕ϯϮϱ͛ϵ͕ϯϰϱ͛ϮϬ ϭϭͲϮϵͲϮϭ KƉĞŶ dͲϭϳ ϵ͕ϳϬϬ͛ϵ͕ϳϮϬ͛ϵ͕ϯϱϳ͛ϵ͕ϯϳϳ͛ϮϬ ϭϭͲϮϵͲϮϭ KƉĞŶ dͲϭϵ ϵ͕ϵϬϲ͛ϵ͕ϵϮϲ͛ϵ͕ϱϱϳ͛ϵ͕ϲϰϲ͛ϮϬ ϭϭͲϮϲͲϮϭ /ƐŽůĂƚĞĚ KWE,K>ͬDEdd/> ϵͲϱͬϴ͟dKΛ ^ƵƌĨĂĐĞ ;ϱϬйĞǆĐĞƐƐͿ ϳΗ dKΛϯϮϲϬ͛;>ϭϬͲϯϭͲϮϭͿ ϰͲϭͬϮ͟ >ŝŶĞƌ dKΛϳϬϲϱ͛;>ϭϭͲϮϰͲϮϭͿ ϰͲϭͬϮ͟ dƵďŝŶŐWůĂŶŶĞĚdKΛцϮϴϬϬ͛;ϳϳďďůƐĐĂůĐƵůĂƚĞĚĐĞŵĞŶƚǀŽůƵŵĞͿ dс ϭϬ͕ϬϬϬ͛;DͿ ͬdс ϵ͕ϲϰϴ͛;dsͿ ϭϲ͟ KƌŝŐ͘<ůĞǀ͗͘ϭϴ͘ϱ͛ͬ'>ůĞǀ͗͘ϳϰ͘ϰ͛ ϳ͟ ϵͲϱͬϴ͟ 7 Wdс ϴ͕ϲϳϬ͛;DͿͬWdсyyyy͛;dsͿ ϰͲϭͬϮ͟ WƌŽƉŽƐĞĚ ĞůƵŐĂ ϲͲϭͬϴ͟,ŽůĞ ϴͲϭͬϮ͟,ŽůĞ ϭϮͲϭͬϰ͟,ŽůĞ dͲϭϳ dͲϴ WEJSXQFKHV ^/E'Θdh/E'd/> ^ŝǌĞ dǇƉĞ tƚ 'ƌĂĚĞ ŽŶŶ͘ / dŽƉ ƚŵ ϭϲ͟ŽŶĚƵĐƚŽƌʹ ƌŝǀĞŶ ƚŽ^ĞƚĞƉƚŚϴϰ yͲϱϲtĞůĚ ϭϱ͘Ϭϭ͟^ƵƌĨ ϭϮϬ͛ ϵͲϱͬϴ͟^ƵƌĨƐŐ ϰϬ >ͲϴϬ tϴ͘ϴϯϱ͟^ƵƌĨ ϯ͕Ϯϱϵ͛ ϳΗ /Ŷƚ͘ƐŐ Ϯϲ >ͲϴϬ tϲ͘Ϯϳϲ͟^ƵƌĨ ϳ͕ϮϬϱ͛ ϰͲϭͬϮΗ WƌŽĚ >Ŷƌ ϭϮ͘ϳϱ WͲϭϭϬ d^Ͳ,W ϯ͘ϵϱϴ͟ϲ͕ϵϵϳ͛ϵ͕ϵϵϴ͛ ϰͲϭͬϮΗ dƵďŝŶŐ ϭϮ͘ϳϱ WͲϭϭϬ d^Ͳ,W ϯ͘ϵϱϴ͟^ƵƌĨ ϲ͕ϵϵϳ͛ :t>Zzd/> EŽ͘ĞƉƚŚ ;DͿ ĞƉƚŚ ;dsͿ/K /ƚĞŵ ϭ ϭ͕ϵϵϬ͛ϭ͕ϵϵϬ͛ϯ͘ϵϱϴ͟ϱ͘ϲϮϱ͟ŚĞŵŝĐĂů /ŶũĞĐƚŝŽŶ^Ƶď Ϯ Ϯ͕ϵϱϯ͛Ϯ͕ϵϬϮ͛ϲ͘Ϯϳϲ͟ϴ͘ϴϯϱ͟ϳ͟^ǁĞůů WĂĐŬĞƌ ϯ ϲ͕ϵϯϬ͛ϲ͕ϲϴϬ͛ĞŵĞŶƚ ZĞƚĂŝŶĞƌ;YƵĂĚĐŽ&,Ϳ ϰ ϲ͕ϵϵϳ͛ϲ͕ϳϵϬ͛ϰ͘ϴϳϱ͟ϲ͘ϱϰϬ͟>ŝŶĞƌŚĂŶŐĞƌͬ>dW ƐƐĞŵďůǇ ϱ цϳ͕ϭϬϬ͛цϲ͕ϵϰϱ͛/WĨŽƌĐŽŝůĚĞƉƚŚĐŽŶƚƌŽů ϲ цϴ͕ϲϳϬ͛цϴ͕ϯϲϬ͛/WǁϮϱ͛ĐĞŵĞŶƚ ϳ цϵ͕ϲϰϮ͛цϵ͕ϯϬϭ͛/W ϴ ϵ͕ϴϬϰ͛ϵ͕ϰϱϴ͛/W͕ƐĞƚ ϭϭͬϮϴͬϮϭ ;ƚŽƉŽĨĨŝůůĂƚϵϴϬϳ͛Ϳ &RLOHG7XELQJ%23 6:$%9$/9( 0$67(59$/9( ^dEZt>>WZKhZ E/dZK'EKWZd/KE^ ϭϮͬϬϴͬϮϬϭϱ &/E>ǀϭ WĂŐĞϭŽĨϭ ϭ͘Ϳ D/ZhEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚĂŶĚ>ŝƋƵŝĚEŝƚƌŽŐĞŶdƌĂŶƐƉŽƌƚ͘ Ϯ͘Ϳ EŽƚŝĨǇWĂĚKƉĞƌĂƚŽƌŽĨƵƉĐŽŵŝŶŐEŝƚƌŽŐĞŶŽƉĞƌĂƚŝŽŶƐ͘ ϯ͘Ϳ WĞƌĨŽƌŵWƌĞͲ:Žď^ĂĨĞƚǇDĞĞƚŝŶŐ͘ZĞǀŝĞǁEŝƚƌŽŐĞŶǀĞŶĚŽƌƐƚĂŶĚĂƌĚŽƉĞƌĂƚŝŶŐƉƌŽĐĞĚƵƌĞƐĂŶĚ ĂƉƉƌŽƉƌŝĂƚĞ^ĂĨĞƚǇĂƚĂ^ŚĞĞƚƐ;ĨŽƌŵĞƌůǇD^^Ϳ͘ ϰ͘Ϳ ŽĐƵŵĞŶƚ ŚĂǌĂƌĚƐ ĂŶĚ ŵŝƚŝŐĂƚŝŽŶ ŵĞĂƐƵƌĞƐ ĂŶĚ ĐŽŶĨŝƌŵ ĨůŽǁ ƉĂƚŚƐ͘ /ŶĐůƵĚĞ ƌĞǀŝĞǁ ŽŶ ĂƐƉŚǇǆŝĂƚŝŽŶ ĐĂƵƐĞĚ ďǇ ŶŝƚƌŽŐĞŶĚŝƐƉůĂĐŝŶŐŽǆǇŐĞŶ͘DŝƚŝŐĂƚŝŽŶ ŵĞĂƐƵƌĞƐ ŝŶĐůƵĚĞĂƉƉƌŽƉƌŝĂƚĞ ƌŽƵƚŝŶŐŽĨĨůŽǁůŝŶĞƐ͕ĂĚĞƋƵĂƚĞǀĞŶƚŝŶŐĂŶĚĂƚŵŽƐƉŚĞƌŝĐŵŽŶŝƚŽƌŝŶŐ͘ ϱ͘Ϳ ^ƉŽƚWƵŵƉŝŶŐhŶŝƚĂŶĚdƌĂŶƐƉŽƌƚ͘ŽŶĨŝƌŵůŝƋƵŝĚEϮǀŽůƵŵĞƐŝŶƚƌĂŶƐƉŽƌƚ͘ ϲ͘Ϳ ZŝŐƵƉůŝŶĞƐĨƌŽŵƚŚĞEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚƚŽƚŚĞǁĞůůĂŶĚƌĞƚƵƌŶƐƚĂŶŬ͘^ĞĐƵƌĞůŝŶĞƐǁŝƚŚǁŚŝƉ ĐŚĞĐŬƐ͘ ϳ͘Ϳ WůĂĐĞ ƐŝŐŶƐ ĂŶĚ ƉůĂĐĂƌĚƐ ǁĂƌŶŝŶŐ ŽĨ ŚŝŐŚ ƉƌĞƐƐƵƌĞ ĂŶĚ ŶŝƚƌŽŐĞŶ ŽƉĞƌĂƚŝŽŶƐ Ăƚ ĂƌĞĂƐ ǁŚĞƌĞ EŝƚƌŽŐĞŶŵĂǇĂĐĐƵŵƵůĂƚĞŽƌďĞƌĞůĞĂƐĞĚ͘ ϴ͘Ϳ WůĂĐĞƉƌĞƐƐƵƌĞŐĂƵŐĞƐĚŽǁŶƐƚƌĞĂŵŽĨůŝƋƵŝĚĂŶĚŶŝƚƌŽŐĞŶƉƵŵƉƐƚŽĂĚĞƋƵĂƚĞůǇŵĞĂƐƵƌĞƚƵďŝŶŐ ĂŶĚĐĂƐŝŶŐƉƌĞƐƐƵƌĞƐ͘ ϵ͘Ϳ WůĂĐĞƉƌĞƐƐƵƌĞŐĂƵŐĞƐƵƉƐƚƌĞĂŵĂŶĚĚŽǁŶƐƚƌĞĂŵŽĨĂŶǇĐŚĞĐŬǀĂůǀĞƐ͘ ϭϬ͘Ϳ tĞůůƐŝƚĞDĂŶĂŐĞƌƐŚĂůůǁĂůŬĚŽǁŶǀĂůǀĞĂůŝŐŶŵĞŶƚƐĂŶĚĞŶƐƵƌĞǀĂůǀĞƉŽƐŝƚŝŽŶŝƐĐŽƌƌĞĐƚ͘ ϭϭ͘Ϳ ŶƐƵƌĞƉŽƌƚĂďůĞϰͲŐĂƐĚĞƚĞĐƚŝŽŶĞƋƵŝƉŵĞŶƚŝƐŽŶƐŝƚĞ͕ĐĂůŝďƌĂƚĞĚ͕ĂŶĚďƵŵƉƚĞƐƚĞĚƉƌŽƉĞƌůǇƚŽ ĚĞƚĞĐƚ>>ͬ,Ϯ^ͬKϮͬKϮůĞǀĞůƐ͘ŶƐƵƌĞEŝƚƌŽŐĞŶǀĞŶĚŽƌŚĂƐĂǁŽƌŬŝŶŐĂŶĚĐĂůŝďƌĂƚĞĚĚĞƚĞĐƚŽƌĂƐ ǁĞůůƚŚĂƚŵĞĂƐƵƌĞƐKϮůĞǀĞůƐ͘ ϭϮ͘Ϳ WƌĞƐƐƵƌĞƚĞƐƚůŝŶĞƐƵƉƐƚƌĞĂŵŽĨǁĞůůƚŽĂƉƉƌŽǀĞĚƐƵŶĚƌǇƉƌĞƐƐƵƌĞŽƌDW^W;DĂǆŝŵƵŵWŽƚĞŶƚŝĂů ^ƵƌĨĂĐĞWƌĞƐƐƵƌĞͿ͕ǁŚŝĐŚĞǀĞƌŝƐŚŝŐŚĞƌ͘dĞƐƚůŝŶĞƐĚŽǁŶƐƚƌĞĂŵŽĨǁĞůů;ĨƌŽŵǁĞůůƚŽƌĞƚƵƌŶƐƚĂŶŬͿ ƚŽϭ͕ϱϬϬƉƐŝ͘WĞƌĨŽƌŵǀŝƐƵĂůŝŶƐƉĞĐƚŝŽŶĨŽƌĂŶǇůĞĂŬƐ͘ ϭϯ͘Ϳ ůĞĞĚŽĨĨƚĞƐƚƉƌĞƐƐƵƌĞĂŶĚƉƌĞƉĂƌĞĨŽƌƉƵŵƉŝŶŐŶŝƚƌŽŐĞŶ͘ ϭϰ͘Ϳ WƵŵƉŶŝƚƌŽŐĞŶĂƚĚĞƐŝƌĞĚƌĂƚĞ͕ŵŽŶŝƚŽƌŝŶŐƌĂƚĞ;^&DͿĂŶĚƉƌĞƐƐƵƌĞ;W^/Ϳ͘ůůŶŝƚƌŽŐĞŶƌĞƚƵƌŶƐ ĂƌĞƚŽďĞƌŽƵƚĞĚƚŽƚŚĞƌĞƚƵƌŶƐƚĂŶŬ͘ ϭϱ͘Ϳ tŚĞŶĨŝŶĂůŶŝƚƌŽŐĞŶǀŽůƵŵĞŚĂƐďĞĞŶĂĐŚŝĞǀĞĚ͕ŝƐŽůĂƚĞǁĞůůĨƌŽŵEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚĂŶĚ ďůĞĞĚĚŽǁŶůŝŶĞƐďĞƚǁĞĞŶǁĞůůĂŶĚEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚ͘ ϭϲ͘Ϳ KŶĐĞǇŽƵŚĂǀĞĐŽŶĨŝƌŵĞĚůŝŶĞƐĂƌĞďůĞĚĚŽǁŶ͕ŶŽƚƌĂƉƉĞĚƉƌĞƐƐƵƌĞĞǆŝƐƚƐ͕ĂŶĚŶŽŶŝƚƌŽŐĞŶŚĂƐ ĂĐĐƵŵƵůĂƚĞĚďĞŐŝŶƌŝŐĚŽǁŶŽĨůŝŶĞƐĨƌŽŵƚŚĞEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚ͘ ϭϳ͘Ϳ &ŝŶĂůŝǌĞũŽďůŽŐĂŶĚĚŝƐĐƵƐƐŽƉĞƌĂƚŝŽŶƐǁŝƚŚtĞůůƐŝƚĞDĂŶĂŐĞƌ͘ŽĐƵŵĞŶƚĂŶǇůĞƐƐŽŶƐůĞĂƌŶĞĚ ĂŶĚĐŽŶĨŝƌŵĨŝŶĂůƌĂƚĞƐͬƉƌĞƐƐƵƌĞͬǀŽůƵŵĞƐŽĨƚŚĞũŽďĂŶĚƌĞŵĂŝŶŝŶŐŶŝƚƌŽŐĞŶŝŶƚŚĞƚƌĂŶƐƉŽƌƚ͘ ϭϴ͘Ϳ ZDKEŝƚƌŽŐĞŶWƵŵƉŝŶŐhŶŝƚĂŶĚ>ŝƋƵŝĚEŝƚƌŽŐĞŶdƌĂŶƐƉŽƌƚ͘ &DUOLVOH6DPDQWKD-2*& )URP0F/HOODQ%U\DQ-2*& 6HQW)ULGD\'HFHPEHU$0 7R-DFRE)ORUD 6XEMHFW5(>(;7(51$/@5(%5837''UDIWRI6XQGU\EHLQJVXEPLWWHGWRGD\ :ĂŬĞ͕ /͛ŵŽŬǁŝƚŚƚŚĞƉůĂŶŝŶƚŚĞ^ƵŶĚƌǇĂĨƚĞƌ/ǀĞƌŝĨǇƚŚĞdKŽƵƚƐŝĚĞƚŚĞϳ͟ĐĂƐŝŶŐ͘ĂŶǇŽƵƐĞŶĚŵĞƚŚĞϳ͟>ĂŶĚƚŚĞ ĐĞŵĞŶƚŝŶŐƌĞƉŽƌƚĨŽƌƚŚĞϳ͟ĐĂƐŝŶŐ͍&ƌĂŶŬƐŚŽƵůĚďĞĂďůĞƚŽƉƌŽǀŝĚĞŝƚƚŽǇŽƵ͘ /ŶƚŚĞŵĞĂŶƚŝŵĞ͕ǇŽƵŚĂǀĞǀĞƌďĂůĂƉƉƌŽǀĂůƚŽƉƌŽĐĞĞĚǁŝƚŚƚŚĞǁŽƌŬƚŝƚůĞĚ͗WƌŽĐĞĚƵƌĞ;WƌĞͲ^ƵŶĚƌǇtŽƌŬͿ͕ǁŚŝĐŚ/͛ǀĞĐƵƚ ĂŶĚƉĂƐƚĞĚďĞůŽǁ͘ ϭ͘D/ZhͲůŝŶĞ͕WdůƵďƌŝĐĂƚŽƌĂďŽǀĞD^W Ϯ͘^Ğƚ/WĂƚϴϲϳϬ͛;Ϯϱ͛ĂďŽǀĞŚŝŐŚĞƐƚŽƉĞŶdǇŽŶĞŬƉĞƌĨŽƌĂƚŝŽŶƐͿ ϯ͘ƵŵƉďĂŝůϮϱ͛ĐĞŵĞŶƚŽŶƉůƵŐ ϰ͘>ŽĂĚǁĞůů͕ƉƌĞƐƐƵƌĞƚĞƐƚ/WƚŽϮϱϬϬƉƐŝĨŽƌϭϬŵŝŶƵƚĞƐ ϱ͘^Ğƚ/WĂƚΕϳϭϬϬ͛;ƚŚŝƐǁŝůůďĞƵƐĞĚĨŽƌĐŽŝůĚĞƉƚŚĐŽŶƚƌŽůǁŝƚŚŽŶĞͲƚƌŝƉĐĞŵĞŶƚƌĞƚĂŝŶĞƌͿ ϲ͘WƌĞƐƐƵƌĞƵƉ/ƚŽϱϬϬƉƐŝǁŝƚŚŵĞƚŚĂŶŽů ϳ͘dƵďŝŶŐƉƵŶĐŚΕϲϵϴϬͲϲϵϵϬ͛;Εϳ͛ĂďŽǀĞůŝŶĞƌƚŽƉƉĂĐŬĞƌͿ ϴ͘tĂƚĐŚƚƵďŝŶŐĂŶĚ/ƉƌĞƐƐƵƌĞƐƚŽĐŽŶĨŝƌŵĐŽŵŵƵŶŝĐĂƚŝŽŶ ϵ͘ZͲůŝŶĞ ƌǇĂŶDĐ>ĞůůĂŶ ^ĞŶŝŽƌWĞƚƌŽůĞƵŵŶŐŝŶĞĞƌ ůĂƐŬĂKŝůΘ'ĂƐŽŶƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶ ϯϯϯtϳƚŚǀĞ ŶĐŚŽƌĂŐĞ͕<ϵϵϱϬϭ ƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀ нϭ;ϵϬϳͿϮϱϬͲϵϭϵϯ &ƌŽŵ͗:ĂĐŽď&ůŽƌĂф:ĂŬĞ͘&ůŽƌĂΛŚŝůĐŽƌƉ͘ĐŽŵх ^ĞŶƚ͗dŚƵƌƐĚĂǇ͕ĞĐĞŵďĞƌϮ͕ϮϬϮϭϭ͗ϭϭWD dŽ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх Đ͗ĂŶDĂƌůŽǁĞфĚŵĂƌůŽǁĞΛŚŝůĐŽƌƉ͘ĐŽŵх ^ƵďũĞĐƚ͗Z͗΀ydZE>΁Z͗ZhϮϮϯͲϮϰ;Wd͗ϮϮϭͲϬϳϮͿƌĂĨƚŽĨ^ƵŶĚƌǇďĞŝŶŐƐƵďŵŝƚƚĞĚƚŽĚĂǇ;ϭϮͬϮͿ tĞĂƌĞƉĞƌĨŽƌĂƚŝŶŐƚŚĞdͲϴƚŽĚĂǇǁŝƚŚůŝƚƚůĞŽƉƚŝŵŝƐŵ͘tĞǁŽƵůĚƐƚĂƌƚƚŚĞƉůƵŐďĂĐŬ͕ƉƌĞƐƐƵƌĞƚĞƐƚŽĨƚŚĞƉůƵŐ͕ĂĚĚŝƚŝŽŶĂů/WĨŽƌ ĐŽŝůĚĞƉƚŚĐŽŶƚƌŽůĂŶĚƚƵďŝŶŐƉƵŶĐŚĞƐ&ƌŝͬ^Ăƚ &ƌŽŵ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх ^ĞŶƚ͗dŚƵƌƐĚĂǇ͕ĞĐĞŵďĞƌϮ͕ϮϬϮϭϭ͗ϬϳWD dŽ͗:ĂĐŽď&ůŽƌĂф:ĂŬĞ͘&ůŽƌĂΛŚŝůĐŽƌƉ͘ĐŽŵх ^ƵďũĞĐƚ͗΀ydZE>΁Z͗ZhϮϮϯͲϮϰ;Wd͗ϮϮϭͲϬϳϮͿƌĂĨƚŽĨ^ƵŶĚƌǇďĞŝŶŐƐƵďŵŝƚƚĞĚƚŽĚĂǇ;ϭϮͬϮͿ dŚĂŶŬƐ:ĂŬĞ͘ dŚŝƐůŽŽŬƐŐŽŽĚ͘tŚĞŶĚŽǇŽƵǁĂŶƚƚŽƐƚĂƌƚƚŚŝƐǁŽƌŬ͍ ƌǇĂŶDĐ>ĞůůĂŶ ^ĞŶŝŽƌWĞƚƌŽůĞƵŵŶŐŝŶĞĞƌ ůĂƐŬĂKŝůΘ'ĂƐŽŶƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶ ϯϯϯtϳƚŚǀĞ ŶĐŚŽƌĂŐĞ͕<ϵϵϱϬϭ ƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀ нϭ;ϵϬϳͿϮϱϬͲϵϭϵϯ &ƌŽŵ͗:ĂĐŽď&ůŽƌĂф:ĂŬĞ͘&ůŽƌĂΛŚŝůĐŽƌƉ͘ĐŽŵх ^ĞŶƚ͗dŚƵƌƐĚĂǇ͕ĞĐĞŵďĞƌϮ͕ϮϬϮϭϴ͗ϰϯD dŽ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх͖>ŽĞƉƉ͕sŝĐƚŽƌŝĂd;K'ͿфǀŝĐƚŽƌŝĂ͘ůŽĞƉƉΛĂůĂƐŬĂ͘ŐŽǀх ^ƵďũĞĐƚ͗ZhϮϮϯͲϮϰ;Wd͗ϮϮϭͲϬϳϮͿƌĂĨƚŽĨ^ƵŶĚƌǇďĞŝŶŐƐƵďŵŝƚƚĞĚƚŽĚĂǇ;ϭϮͬϮͿ ,ŝƌǇĂŶ͕ tĞǁŝůůďĞƐƵďŵŝƚƚŝŶŐƚŚĞĂƚƚĂĐŚĞĚƐƵŶĚƌǇƐŚŽƌƚůǇ͘/ƚĂĚĚƌĞƐƐĞƐƚĞƐƚŝŶŐƚŚĞ/W͕ůŽŐŐŝŶŐ>͕ĂŶĚŚĂƐƚŚĞĐƵƌƌĞŶƚ>ƌĞƐƵůƚƐ ŝŶĐůƵĚĞĚ;/ǁŝůůĨŽƌǁĂƌĚǇŽƵƚŚĞƐĞ>ƐͿ͘tĞƌĞŵŽǀĞĚƚŚĞ^ƚĞƌůŝŶŐƐĂŶĚƐĂŶĚĂƌĞũƵƐƚƚĂƌŐĞƚŝŶŐƚŚĞĞůƵŐĂ͘/͛ǀĞĂůƐŽŝŶĐůƵĚĞĚƚŚĞ ĨƌĂĐƚƵƌĞƉƌĞƐƐƵƌĞĐĂůĐƵůĂƚŝŽŶƐĨŽƌƚŚĞŚŝŐŚĞƐƚĂŶĚůŽǁĞƐƚƉĞƌĨǌŽŶĞƐ͘ /ŶŽƌŵĂůůǇǁŽƵůĚŶ͛ƚďŽƚŚĞƌǇŽƵǁŝƚŚĂĚƌĂĨƚ͕ŚŽǁĞǀĞƌǁĞĂƌĞŽŶĂƐŚŽƌƚƚŝŵĞůŝŶĞŐŝǀĞŶƚŚĞǁĞĂƚŚĞƌĂŶĚǁŝůůďĞĂƐŬŝŶŐĨŽƌĂŶ ĞǆƉĞĚŝƚĞĚƌĞǀŝĞǁĂŶĚ/ƚŚŽƵŐŚƚƚŚŝƐŵĂǇŚĞůƉǇŽƵŽƵƚ͘ 'ƌĞĂƚůǇĂƉƉƌĞĐŝĂƚĞĚ͕ :ĂŬĞ &ƌŽŵ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх ^ĞŶƚ͗dƵĞƐĚĂǇ͕EŽǀĞŵďĞƌϯϬ͕ϮϬϮϭϲ͗ϯϭD dŽ͗:ĂĐŽď&ůŽƌĂф:ĂŬĞ͘&ůŽƌĂΛŚŝůĐŽƌƉ͘ĐŽŵх͖>ŽĞƉƉ͕sŝĐƚŽƌŝĂd;K'ͿфǀŝĐƚŽƌŝĂ͘ůŽĞƉƉΛĂůĂƐŬĂ͘ŐŽǀх Đ͗:ŽƐŚůůĞůǇͲ;Ϳф:ŽƐŚ͘ůůĞůǇΛŚŝůĐŽƌƉ͘ĐŽŵх͖ĂŶDĂƌůŽǁĞфĚŵĂƌůŽǁĞΛŚŝůĐŽƌƉ͘ĐŽŵх ^ƵďũĞĐƚ͗΀ydZE>΁Z͗ZhϮϮϯͲϮϰ;Wd͗ϮϮϭͲϬϳϮͿ^ƵŶĚƌǇ͗ϯϮϭͲϱϲϭhWd :ĂŬĞ͕ /ƚƐŚŽƵůĚŶ͛ƚďĞĂƉƌŽďůĞŵƚŽƚƵƌŶĂƌŽƵŶĚǇŽƵƌƐƵŶĚƌǇƌĞƋƵĞƐƚƉƌĞƚƚǇƋƵŝĐŬůǇ͘ĐŽƵƉůĞŽĨĐŽŵŵĞŶƚƐͬƌĞƋƵĞƐƚƐĨŽƌƚŚĞ ƐƵŶĚƌǇƚŽŚĞůƉĞǆƉĞĚŝƚĞŝƚ͗ ϭ͘zŽƵ͛ůůŶĞĞĚƚŽƉƌĞƐƐƵƌĞƚĞƐƚĂŶĚƚĂŐƚŚĞ/WͬĐĞŵĞŶƚƉĞƌϮϱϮϬ͘ϭϭϮ;ŐͿ;ϮͿ Ϯ͘ZĞǀŝĞǁ>ƌĞƐƵůƚƐǁŝƚŚK'ďĞĨŽƌĞƉĞƌĨŝŶŐ͘ ϯ͘ŽǇŽƵŬŶŽǁǁŚĞƌĞǇŽƵƌdKŝŶƚŚĞϵͲϱͬϴ͟ǆϳ͟ĂŶŶƵůƵƐŝƐ͍ ϰ͘dŚĞƉƌŽƉŽƐĞĚƉĞƌĨŝŶƚĞƌǀĂůŝƐĂĐƌŽƐƐĂƉƉƌŽǆŝŵĂƚĞůǇϯϱϬϬ͛ds͘zŽƵŵĂǇŶĞĞĚƚŽƐĞƚĂƉůƵŐͬĐĞŵĞŶƚŽǀĞƌƚŚĞ ĚĞĞƉĞƌǌŽŶĞƐƉƌŝŽƌƚŽƉĞƌĨŽƌĂƚŝŶŐƚŚĞƐŚĂůůŽǁĞƐƚǌŽŶĞƐƚŽĞŶƐƵƌĞƚŚĞƉŽƌĞƉƌĞƐƐƵƌĞĨƌŽŵƚŚĞĚĞĞƉĞƐƚǌŽŶĞĐĂŶ ŶŽƚĞǆĐĞĞĚƚŚĞĨƌĂĐƉƌĞƐƐƵƌĞŽĨƚŚĞƐŚĂůůŽǁĞƐƚǌŽŶĞƐ͘WůĞĂƐĞƚĂŬĞƚŚŝƐŝŶƚŽĂĐĐŽƵŶƚŝŶǇŽƵƌ^ƵŶĚƌǇĂƉƉůŝĐĂƚŝŽŶ ĂŶĚŝŶĚŝĐĂƚĞƚŚĞƐŚĂůůŽǁĞƐƚĚĞƉƚŚǇŽƵĐĂŶƉĞƌĨŽƌĂƚĞǁŝƚŚŽƵƚƐĞƚƚŝŶŐĂƉůƵŐ͘zŽƵĐĂŶĂƐŬZǇĂŶZƵƉĞƌƚĨŽƌĚĞƚĂŝůƐ ƐŝŶĐĞŚĞ͛ƐŚĂĚƚŽĚŽŝƚŽŶĂĐŽƵƉůĞŽĨŚŝƐ^ĞĂǀŝĞǁǁĞůůƐ͘/ŶƚŚĞĞǆĂŵƉůĞWW&'ƉůŽƚďĞůŽǁ͕/͛ǀĞĂƐƐƵŵĞĚǇŽƵƌ ĚĞĞƉĞƐƚƉĞƌĨŝƐĂƚƚŚĞϳ͟ĐĂƐŝŶŐƐŚŽĞĂŶĚĚƌĂǁŶĂŐĂƐŐƌĂĚŝĞŶƚ;ďƌŽǁŶůŝŶĞͿŽĨϬ͘ϭƉƐŝͬĨƚƵƉĨƌŽŵƚŚĞƉŽƌĞ ƉƌĞƐƐƵƌĞĂƚƚŚĂƚĚĞƉƚŚ͘/ŶƌĞĂůŝƚǇ͕ǇŽƵǁŽƵůĚĚƌĂǁŝƚƐƚĂƌƚŝŶŐĂƚǇŽƵƌĚĞĞƉĞƐƚƉĞƌĨŝŶƚĞƌǀĂůĂŶĚƐĞĞǁŚĞƌĞŝƚ ŝŶƚĞƌƐĞĐƚƐǁŝƚŚƚŚĞĨƌĂĐŐƌĂĚŝĞŶƚůŝŶĞ͘zŽƵĐĂŶ͛ƚƉĞƌĨĂďŽǀĞƚŚŝƐŝŶƚĞƌƐĞĐƚŝŽŶǁŝƚŚŽƵƚƉůƵŐŐŝŶŐƚŚĞĚĞĞƉĞƌ ƉĞƌĨƐ͘EŽƚĞƚŚĂƚƚŚĞĐĂƐŝŶŐƐŚŽĞĚĞƉƚŚƐŝŶƚŚŝƐĞǆĂŵƉůĞĂƌĞĂƉƉƌŽǆŝŵĂƚĞƐŝŶĐĞ/͛ŵƵƐŝŶŐƚŚĞĞƐƚŝŵĂƚĞƐĨƌŽŵƚŚĞ ^ƵŶĚƌǇϯϮϭͲϱϲϭ͘,ĂƉƉǇƚŽĚŝƐĐƵƐƐƚŚŝƐŝĨŝƚ͛ƐŶŽƚĐůĞĂƌ͘ ZĞŐĂƌĚƐ ƌǇĂŶDĐ>ĞůůĂŶ ^ĞŶŝŽƌWĞƚƌŽůĞƵŵŶŐŝŶĞĞƌ ůĂƐŬĂKŝůΘ'ĂƐŽŶƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶ ϯϯϯtϳƚŚǀĞ ŶĐŚŽƌĂŐĞ͕<ϵϵϱϬϭ ƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀ нϭ;ϵϬϳͿϮϱϬͲϵϭϵϯ &ƌŽŵ͗:ĂĐŽď&ůŽƌĂф:ĂŬĞ͘&ůŽƌĂΛŚŝůĐŽƌƉ͘ĐŽŵх ^ĞŶƚ͗DŽŶĚĂǇ͕EŽǀĞŵďĞƌϮϵ͕ϮϬϮϭϰ͗ϯϬWD dŽ͗DĐ>ĞůůĂŶ͕ƌǇĂŶ:;K'ͿфďƌǇĂŶ͘ŵĐůĞůůĂŶΛĂůĂƐŬĂ͘ŐŽǀх͖>ŽĞƉƉ͕sŝĐƚŽƌŝĂd;K'ͿфǀŝĐƚŽƌŝĂ͘ůŽĞƉƉΛĂůĂƐŬĂ͘ŐŽǀх Đ͗:ŽƐŚůůĞůǇͲ;Ϳф:ŽƐŚ͘ůůĞůǇΛŚŝůĐŽƌƉ͘ĐŽŵх͖ĂŶDĂƌůŽǁĞфĚŵĂƌůŽǁĞΛŚŝůĐŽƌƉ͘ĐŽŵх ^ƵďũĞĐƚ͗ZhϮϮϯͲϮϰ;Wd͗ϮϮϭͲϬϳϮͿ^ƵŶĚƌǇ͗ϯϮϭͲϱϲϭhWd ,ĞůůŽƌǇĂŶĂŶĚsŝĐƚŽƌŝĂ͕ tĞ͛ǀĞƚĞƐƚĞĚƚǁŽŽĨƚŚĞdǇŽŶĞŬƐĂŶĚƐǁŝƚŚŽƵƚƐĞĞŝŶŐĐŽŵŵĞƌĐŝĂůŐĂƐ͘tĞŚĂǀĞŽŶĞŵŽƌĞdǇŽŶĞŬƐĂŶĚƚŽƚĞƐƚďĞĨŽƌĞŵŽǀŝŶŐ ĨŽƌǁĂƌĚǁŝƚŚŝƐŽůĂƚŝŶŐƚŚĞĞůƵŐĂĂŶĚ^ƚĞƌůŝŶŐƐĂŶĚƐĂƐĚƌĂǁŶŝŶƚŚĞĂƚƚĂĐŚĞĚWƌŽƉŽƐĞĚt͘/ǁĂŶƚĞĚƚŽŐĞƚŽŶǇŽƵƌƌĂĚĂƌĨŽƌĂ ĨĂƐƚƐƵŶĚƌǇĂƉƉƌŽǀĂůĚƵĞƚŽƚŚĞĐŽůĚǁĞĂƚŚĞƌĂŶĚŝĐĞĨŽƌŵĂƚŝŽŶŝŶƚŚĞŝŶůĞƚƐŚŽƌƚĞŶŝŶŐŽƵƌƚŝŵĞĨƌĂŵĞƚŽƵƐĞĐŽŝůƚƵďŝŶŐĂŶĚ ĐĞŵĞŶƚĞƌƐ͘ dŚĞŐĞŶĞƌĂůƉƌŽĐĞĚƵƌĞ͗ ϭ͘^ĞƚĂ/WǁϮϱ͛ĐĞŵĞŶƚƚŽƉŽǀĞƌƚŚĞŚŝŐŚĞƐƚdǇŽŶĞŬƐĂŶĚ Ϯ͘dƵďŝŶŐƉƵŶĐŚƚŚĞϰ͘ϱ͟ƚƵďŝŶŐũƵƐƚĂďŽǀĞƚŚĞůŝŶĞƌƚŽƉƉĂĐŬĞƌ ϯ͘ZhĐŽŝůƚƵďŝŶŐ ϰ͘DĞŵŽƌǇůŽŐƌƵŶ ϱ͘KŶĞƚƌŝƉĐĞŵĞŶƚƌĞƚĂŝŶĞƌϮϱ͛ŽǀĞƌƚŚĞƚƵďŝŶŐƉƵŶĐŚŚŽůĞƐ ϲ͘WƵŵƉΕϳϳďďůƐĐĞŵĞŶƚƐůƵƌƌǇŝŶƚŽƚŚĞϰͲϭͬϮǆϳĂŶŶƵůƵƐ;ƉůĂŶŶĞĚdKΛϮϴϬϬ͛Ϳ;ŚŝŐŚĞƐƚƐƚĞƌůŝŶŐƐĂŶĚŝƐΕϯϯϱϬ͛Ϳ ϳ͘tK ϴ͘>ŽŐ> ϵ͘:ĞƚĚƌǇǁEϮ ϭϬ͘WĞƌĨŽƌĂƚĞĂŶĚƚĞƐƚĞůƵŐĂƐĂŶĚƐ tĞƐŚŽƵůĚŬŶŽǁƚŚĞƉĂƚŚĨŽƌǁĂƌĚďǇtĞĚŶĞƐĚĂǇĂŶĚďĞƐƵďŵŝƚƚŝŶŐĂƐƵŶĚƌǇǁŝƚŚƚŚĞĂďŽǀĞƐƚĞƉƐƚŚĞŶ͘ 'ƌĞĂƚůǇĂƉƉƌĞĐŝĂƚĞĚ͕ :ĂŬĞ 7KHLQIRUPDWLRQFRQWDLQHGLQWKLVHPDLOPHVVDJHLVFRQILGHQWLDODQGPD\EHOHJDOO\SULYLOHJHGDQGLVLQWHQGHGRQO\IRUWKHXVHRIWKHLQGLYLGXDORUHQWLW\QDPHG DERYH,I\RXDUHQRWDQLQWHQGHGUHFLSLHQWRULI\RXKDYHUHFHLYHGWKLVPHVVDJHLQHUURU\RXDUHKHUHE\QRWLILHGWKDWDQ\GLVVHPLQDWLRQGLVWULEXWLRQRUFRS\RIWKLV HPDLOLVVWULFWO\SURKLELWHG,I\RXKDYHUHFHLYHGWKLVHPDLOLQHUURUSOHDVHLPPHGLDWHO\QRWLI\XVE\UHWXUQHPDLORUWHOHSKRQHLIWKHVHQGHU VSKRQHQXPEHULVOLVWHG DERYHWKHQSURPSWO\DQGSHUPDQHQWO\GHOHWHWKLVPHVVDJH :KLOHDOOUHDVRQDEOHFDUHKDVEHHQWDNHQWRDYRLGWKHWUDQVPLVVLRQRIYLUXVHVLWLVWKHUHVSRQVLELOLW\RIWKHUHFLSLHQWWRHQVXUHWKDWWKHRQZDUGWUDQVPLVVLRQ RSHQLQJRUXVHRIWKLVPHVVDJHDQGDQ\DWWDFKPHQWVZLOOQRWDGYHUVHO\DIIHFWLWVV\VWHPVRUGDWD1RUHVSRQVLELOLW\LVDFFHSWHGE\WKHFRPSDQ\LQWKLVUHJDUGDQG WKHUHFLSLHQWVKRXOGFDUU\RXWVXFKYLUXVDQGRWKHUFKHFNVDVLWFRQVLGHUVDSSURSULDWH 7KHLQIRUPDWLRQFRQWDLQHGLQWKLVHPDLOPHVVDJHLVFRQILGHQWLDODQGPD\EHOHJDOO\SULYLOHJHGDQGLVLQWHQGHGRQO\IRUWKHXVHRIWKHLQGLYLGXDORUHQWLW\QDPHG DERYH,I\RXDUHQRWDQLQWHQGHGUHFLSLHQWRULI\RXKDYHUHFHLYHGWKLVPHVVDJHLQHUURU\RXDUHKHUHE\QRWLILHGWKDWDQ\GLVVHPLQDWLRQGLVWULEXWLRQRUFRS\RIWKLV HPDLOLVVWULFWO\SURKLELWHG,I\RXKDYHUHFHLYHGWKLVHPDLOLQHUURUSOHDVHLPPHGLDWHO\QRWLI\XVE\UHWXUQHPDLORUWHOHSKRQHLIWKHVHQGHU VSKRQHQXPEHULVOLVWHG DERYHWKHQSURPSWO\DQGSHUPDQHQWO\GHOHWHWKLVPHVVDJH :KLOHDOOUHDVRQDEOHFDUHKDVEHHQWDNHQWRDYRLGWKHWUDQVPLVVLRQRIYLUXVHVLWLVWKHUHVSRQVLELOLW\RIWKHUHFLSLHQWWRHQVXUHWKDWWKHRQZDUGWUDQVPLVVLRQ RSHQLQJRUXVHRIWKLVPHVVDJHDQGDQ\DWWDFKPHQWVZLOOQRWDGYHUVHO\DIIHFWLWVV\VWHPVRUGDWD1RUHVSRQVLELOLW\LVDFFHSWHGE\WKHFRPSDQ\LQWKLVUHJDUGDQG WKHUHFLSLHQWVKRXOGFDUU\RXWVXFKYLUXVDQGRWKHUFKHFNVDVLWFRQVLGHUVDSSURSULDWH 7KHLQIRUPDWLRQFRQWDLQHGLQWKLVHPDLOPHVVDJHLVFRQILGHQWLDODQGPD\EHOHJDOO\SULYLOHJHGDQGLVLQWHQGHGRQO\IRUWKHXVHRIWKHLQGLYLGXDORUHQWLW\QDPHG DERYH,I\RXDUHQRWDQLQWHQGHGUHFLSLHQWRULI\RXKDYHUHFHLYHGWKLVPHVVDJHLQHUURU\RXDUHKHUHE\QRWLILHGWKDWDQ\GLVVHPLQDWLRQGLVWULEXWLRQRUFRS\RIWKLV HPDLOLVVWULFWO\SURKLELWHG,I\RXKDYHUHFHLYHGWKLVHPDLOLQHUURUSOHDVHLPPHGLDWHO\QRWLI\XVE\UHWXUQHPDLORUWHOHSKRQHLIWKHVHQGHU VSKRQHQXPEHULVOLVWHG DERYHWKHQSURPSWO\DQGSHUPDQHQWO\GHOHWHWKLVPHVVDJH :KLOHDOOUHDVRQDEOHFDUHKDVEHHQWDNHQWRDYRLGWKHWUDQVPLVVLRQRIYLUXVHVLWLVWKHUHVSRQVLELOLW\RIWKHUHFLSLHQWWRHQVXUHWKDWWKHRQZDUGWUDQVPLVVLRQ RSHQLQJRUXVHRIWKLVPHVVDJHDQGDQ\DWWDFKPHQWVZLOOQRWDGYHUVHO\DIIHFWLWVV\VWHPVRUGDWD1RUHVSRQVLELOLW\LVDFFHSWHGE\WKHFRPSDQ\LQWKLVUHJDUGDQG WKHUHFLSLHQWVKRXOGFDUU\RXWVXFKYLUXVDQGRWKHUFKHFNVDVLWFRQVLGHUVDSSURSULDWH Kaitlyn Barcelona Hilcorp North Slope, LLC GeoTechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: 907 777-8337 E-mail: kaitlyn.barcelona@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 12/02/2021 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) FINAL LWD FORMATION EVALUATION LOGS (10/19/2021 to 11/09/2021) x PCG, DRG, EWR, ADR, ALD, (2” & 5” Color Logs) x Final Definitive Directional Survey SFTP Transfer - Data Folders: Please include current contact information if different from above. eceived By: 12/02/2021 37' (6HW By Abby Bell at 1:48 pm, Dec 02, 2021 AOGCC Kaitlyn Barcelona Hilcorp North Slope, LLC GeoTechnician 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Tele: 907 777-8337 E-mail: kaitlyn.barcelona@hilcorp.com Please acknowledge receipt by signing and returning one copy of this transmittal Received By: Date: DATE: 11/15/2021 To: Alaska Oil & Gas Conservation Commission Natural Resource Technician 333 W 7th Ave Suite 100 Anchorage, AK 99501 DATA TRANSMITTAL BRU 223-24 (PTD 221-072) Wave Sonic Record 10/31/2021 Report 11/03/2021 Please include current contact information if different from above. Received By: d 11/17/2021 37' (6HW By Abby Bell at 4:02 pm, Nov 15, 2021 AOGCC STATE OF ALASKA _1C— P. Reviewed By: -,.!(� OIL AND GAS CONSERVATION COMMISSION P.1. Supry -6v-f BOPE Test Report for: BELUGA RIV UNIT 223-24 Comm Contractor/Rig No.: Hilcorp 147 PTD#: 2210720 DATE: 10/24/2021 ' Inspector Adam Earl - Insp Source Operator: Hilcorp Alaska, LLC Operator Rep: Yessak/ Riley Rig Rep: Davis/ Trick Inspector Type Operation: DRILL Sundry No: Test Pressures: Inspection No: bopAGE21 1028131455 Rams: Annular: Valves: NIASP: Type Test: INIT Related Insp No: P 250/5000 � 250/5000 - 250/5000 3684 TEST DATA MISC. INSPECTIONS: MUD SYSTEM: ACCUMULATOR SYSTEM: CHOKE MANIFOLD: P/F P/F Visual Alarm Time/Pressure P/F Location Gen.: P Trip Tank P ' — P - System Pressure _ _ _2950 - P Housekeeping: P-- Pit Level Indicators P P Pressure After Closure 1700 P PTD On Location P Flow Indicator P P 200 PSI Attained 15 P Standing Order Posted P " Meth Gas Detector - P P " Full Pressure Attained 80 P Well Sign P H2S Gas Detector P- P- Blind Switch Covers: All Stations P " Drl. Rig P MS Mise 0 NA Nitgn. Bottles (avg): 4 lea, 2575 - P Hazard Sec. P #4 Rams 0 ACC Mise 0 NA Misc NA #5 Rams 0 NA FLOOR SAFTY VALVES: BOP STACK: CHOKE MANIFOLD: Quantity P/F Quantity Size P/F Quantity P/F Upper Kelly 1 P Stripper 0 NA No. Valves 15 P Lower Kelly 1 P Annular Preventer 1 11 P Manual Chokes l P " Ball Type 1 FP '� #1 Rams 1 " 41/2 P--- Hydraulic Chokes 1 P Inside BOP 1 - P 42 Rams 1 blind -P CH Misc 0 NA FSV Misc 0 NA #3 Rams 1 4 1/2 FP #4 Rams 0 NA_ #5 Rams 0 NA INSIDE REEL VALVES: #6 Rams 0 NA (Valid for Coil Rigs Only) Choke Ln. Valves 1 -3 1/8 FP v Quantity P/F HCR Valves 2 " 2 1/16 X_3. 118_ FP Inside Reel Valves 0 NA Kill Line Valves 2 ' 2 1/16 P Check Valve 0 NA- A-BOP BOPMisc 1" drilling spool FP ✓ Number of Failures: 5 ' / Test Results Test Time 24 Remarks: Long test. Lower rams had to be opened up and cleaned, spool flange leaked, TIW valve, manual (inside) Choke failed and replaced, HCR choke had to be cycled. Gas detection equipment tested 10/23/21. STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION Reviewed By:r P.1. S u p r v ' DIVERTER Test Report for: BELUGA RIV UNIT 223-24 Comm Contractor/Rig No.: Hilcorp 147 PTD#: 2210720 - DATE: 10/18/2021 ' Inspector Adam Earl Lisp Source Operator: Hilcorp Alaska.. LLC Operator Rep: Rance Peterson Rig Rep: Brandon Davis Inspector Well Class: EXP Inspection No: divAGE21 1 028130145 Related Insp No: MISC. INSPECTIONS: GAS DETECTORS: Visual Alarm Methane: P _ P _ Hydrogen Sulfide: P P " Gas Detectors Misc: 0 NA TEST DATA MUD SYSTEM: P/F Location Gen.: P_ Housekeeping: P " Warning Sign P__ 24 hr Notice: P Well Sign: P " Drlg. Rig. P Misc: NA GAS DETECTORS: Visual Alarm Methane: P _ P _ Hydrogen Sulfide: P P " Gas Detectors Misc: 0 NA TEST DATA MUD SYSTEM: P/F Visual Alarm Trip Tank: _P P Mud Pits: P P Flow Monitor: P P Mud System Misr. 0 NA_ ACCUMULATOR SYSTEM: P/F Time/Pressure P/F Systems Pressure: 2975 P Pressure After Closure: 1975 P 200 psi Recharge Time:_ 18 —P - _Full Full Recharge Time: 55 P Nitrogen Bottles (Number of):_4_ P Avg. Pressure_2638 P Accumulator Misc:0 NA DIVERTER SYSTEM: Size P/F Designed to Avoid Freeze-up? _ _ _ P Remote Operated Diverter? P No Threaded Connections? P " Vent line Below Diverter? P Diverter Size: 21.25 P Hole Size: 12.25 P Vent Line(s) Size: 16 P Vent Line(s) Length: 87 - P ' Closest Ignition Source: 80 P ' Outlet from Rig Substructure: 76 - P " Vent Line(s) Anchored: P Turns Targeted / Long Radius: NA' Divert Valve(s) Full Opening: P ' Valve(s) Auto & Simultaneous: Annular Closed Time: 30 P ' Knife Valve Open Time: 26 - P ' Diverter Misc: 0 NA Number of Failures: 0 Test Time: 1 Remarks 1. Type of Request:Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: ___________________ 2. Operator Name:4. Current Well Class:5. Permit to Drill Number: Exploratory Development 3. Address: Stratigraphic Service 6. API Number: 7. If perforating:8. Well Name and Number: W hat Regulation or Conservation Order governs well spacing in this pool? W ill planned perforations require a spacing exception?Yes No 9. Property Designation (Lease Number): 10. Field/Pool(s): 11. Total Depth MD (ft):Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: MPSP (psi): Plugs (MD): Junk (MD): 10,000'N/A Casing Collapse Structural Conductor Surface 3080 Intermediate 5410 Production Liner Packers and SSSV Type:Packers and SSSV MD (ft) and TVD (ft): 12. Attachments:Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations:OIL WINJ WDSPL Suspended 16. Verbal Approval:Yes Date:GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Contact Email: Contact Phone: Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other: Post Initial Injection MIT Req'd? Yes No Spacing Exception Required? Yes No Subsequent Form Required: APPROVED BY Approved by: COMMISSIONER THE AOGCC Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: AOGCC USE ONLY Frank Roach frank.roach@hilcorp.com 907-777-8413 Drilling Manager Bryan McLellan 11/7/2021 Tubing Grade:Tubing MD (ft): N/A Perforation Depth TVD (ft):Tubing Size: PRESENT WELL CONDITION SUMMARY STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 ADL 21128 221-072 3800 Centerpoint Drive, Suite 1400, Acnhorage, AK 99503 50-283-20183-00-00 Hilcorp Alaska, LLC BRU 223-24 Beluga River Field / Undefined Tyonek Gas Pool N/A Length Size N/A TVD Burst N/A MD 7240 5750 120' 3,233' 6,942' 120' 3,259' 7" 16" 9-5/8" 120' 7,205' 3,259' Perforation Depth MD (ft): 7,205' N/A N/A 11/7/2021 N/A N/A 9,648'10,000'9,648'4720 N/A m n R t _ 66 Form 10-403 Revised 10/2021 Approved application is valid for 12 months from the date of approval. 11.9.2021 By Samantha Carlisle at 3:19 pm, Nov 09, 2021 321-572 Digitally signed by Monty M Myers DN: cn=Monty M Myers, c=US, o=Hilcorp Alaska, LLC, ou=Technical Services - AK Drilling, email=mmyers@hilcorp.com Reason: I am approving this document Date: 2021.11.09 12:24:16 -09'00' Monty M Myers BJM 11/9/21 DSR-11/10/21 10-407 BOP test to 5000 psi. DLB 11/10/2021 X dts 11/12/2021 11/12/21 Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2021.11.12 08:25:55 -10'00' RBDMS HEW 11/15/2021 Well: BRU 223-24 Change to Approved Program Well Name:BRU 223-24 API Number:50-283-20183-00-00 Current Status:Well TD’d (Wiper Trip)Leg:N/A Estimated Start Date:11/7/21 Rig:Rig 147 Reg. Approval Req’d?403 Date Reg. Approval Rec’vd:11/7/21 Regulatory Contact:Cody Dinger (8389)Permit to Drill Number:221-072 First Call Engineer:Frank Roach (907) 777-8413 (O)(907) 584-2321 (M) Second Call Engineer:Monty Myers (907) 777-8431 (O)(907) 538-1168 (M) Brief Well Summary BRU 223-24 was permitted with a MASP of 3684 psi (8.5 ppg EMW). While drilling the 6-1/8” hole section in the Tyonek sands with a 9.8 ppg MW the connection gas became significant. The mud was weighted up to 10.8 ppg to help minimize the connections gas. It is possible that a 9.8 ppg MW was near the BHP equivalent. If this is the case the MASP of the sidetrack is higher than the permitted value. The current well data and an expectation that the pressure could increase with depth merits a revised estimated BHP as high as 10.3 ppg. At TD (10,835’ TVD) this results in a BHP of 5803 psi and a MASP of 4720 psi. As such, all subsequent BOPE tests will be to 5000 psi. STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION Mechanical Integrity Test Submit to: Ilm.re04(flialaska.COV: AOGCC.Insoectors(o).alaska.00v; phoebe.brooksCa)alaska.00v OPERATOR: Hilcorp Alaska, LLC FIELD / UNIT / PAD: Beluga Field / Beluga River Unit / K Pad DATE: 11/14/21 OPERATOR REP: Rance Pederson AOGCC REP: ch ris.wa I lace(ciia laska. gov Well BRU 223-24 Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD 2210720 Type Inj N Tubing 0 4125 4115 4115 Type Test P Packer TVD BBLPump 2.5 IA Interval I Test psi 4000 BBL Return 1 2.5 OA Result P Notes: drilled as gas producer;witness waived J. Regg Well BRU 223-24 Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD 2210720 Type Inj N Tubing Type Test P Packer TVD 6751 BBLPump 1.9 IA 0 2510 2505 2504 Interval I Test psi 2500 BBL Return 1 1.9 OA Result P Notes: drilled as gas producer; witness waived J. Regg Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBLPump IA Interval Test psi BBL Return OA Result Notes: Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBLPump IA Interval Test psi BBL Return OA Result Notes: Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Notes: Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Notes: Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBLPump IA Interval Test psi BBL Return OA Result Notes: Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Notes: TYPE INJ Codes W = Water G = Gas S = Slurry I = Industrial Wastewater N = Not Injecting TYPE TEST Codes INTERVAL Codes P = Pressure Test I = Initial Test O = Other (describe in Notes) 4 = Four Year Cycle V = Required by Variance O = Other (describe in notes) Result Codes P = Pass F = Fail I = Inconclusive Form 10-426 (Revised 01/2017) MIT BRI1223-24 revised 11-15-2021 (003) �a - -- 5500 ---5000 J. i $ _ 4000 - i 3500 — 3000 's 250 - 2000 loon - = +fCHART N0. MC MP-6Qp0-4H ,-_ CACA 1 r cl t p �. (� CHART PZJT ON r _ +' i 1 r , , a� o o cn _ Lo m.01 1. oo of-_ f T oogi 0402"-- lb 0002 0092-7 ol { 00Ub 00917 f{. -.. 000S. �, 00S9--� From:Jacob Flora To:McLellan, Bryan J (CED) Cc:Brad Gathman - (C); Cole Bartlewski Subject:RE: [EXTERNAL] BRU 223-24 (PTD 221-072) CT BOP test pressure Date:Monday, November 15, 2021 10:25:32 AM Bryan, Noted, we will test to 5000 psi, I will advise the supervisors. thanks From: McLellan, Bryan J (CED) <bryan.mclellan@alaska.gov> Sent: Monday, November 15, 2021 9:10 AM To: Jacob Flora <Jake.Flora@hilcorp.com> Cc: Frank Roach <Frank.Roach@hilcorp.com>; Regg, James B (CED) <jim.regg@alaska.gov> Subject: [EXTERNAL] BRU 223-24 (PTD 221-072) CT BOP test pressure Jake, Hilcorp experienced higher than expected BHP during the drilling operations, resulting in higher MPSP and an extra trip out of hole to test BOP’s to 5000 psi. The CT BOP and wireline pressure control equipment should both be tested to 5000 psi for the work planned under Sundry 321-561. This test pressure is higher than what was originally called for in the Sundry. Regards Bryan McLellan Senior Petroleum Engineer Alaska Oil & Gas Conservation Commission 333 W 7th Ave Anchorage, AK 99501 Bryan.mclellan@alaska.gov +1 (907) 250-9193 The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are herebynotified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. From:McLellan, Bryan J (CED) To:Sean Mclaughlin Cc:Rance Pederson - (C) Subject:RE: BRU 223-24 (PTD 221-072) Intermediate LOT Date:Thursday, November 4, 2021 4:31:00 PM Sean, I agree with the 15.2 ppg EMW LOT pressure. Hilcorp has approval to drill ahead. Regards Bryan McLellan Senior Petroleum Engineer Alaska Oil & Gas Conservation Commission 333 W 7th Ave Anchorage, AK 99501 Bryan.mclellan@alaska.gov +1 (907) 250-9193 From: Sean Mclaughlin <Sean.Mclaughlin@hilcorp.com> Sent: Thursday, November 4, 2021 4:23 PM To: McLellan, Bryan J (CED) <bryan.mclellan@alaska.gov> Cc: Rance Pederson - (C) <rpederson@hilcorp.com> Subject: BRU 223-24 (PTD 221-072) Intermediate LOT Bryan, The results of the casing test and LOT after drilling out of the 7” shoe are attached for your review. I called the LOT at 35 strokes in and 1986 psi (15.2 ppg). Please let me know if you concur and we have permission to drill ahead. Regards, sean Sean McLaughlin Hilcorp Alaska, LLC Drilling Engineer Sean.McLaughlin@hilcorp.com Cell: 907-223-6784 The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. CASING AND LEAK-OFF FRACTURE TESTS Well Name:BRU 223-24 Date:11/4/2021 Csg Size/Wt/Grade:7" / 26# / L-80 Supervisor:Rance Csg Setting Depth:7,205 TMD 6,950 TVD Mud Weight:9.75 ppg LOT / FIT Press =1986 psi LOT / FIT =15.25 ppg Hole Depth =7233 md Fluid Pumped=2.1 Bbls Volume Back =1.2 bbls Estimated Pump Output:0.026 Barrels/Stroke LOT / FIT DATA CASING TEST DATA Enter Strokes Enter Pressure Enter Strokes Enter Pressure Here Here Here Here ->0 0 ->0 0 ->5 367 ->5 400 ->10 604 ->10 643 ->15 875 ->15 861 ->20 1141 ->20 1181 ->25 1433 ->25 1490 ->30 1702 ->30 1806 ->35 1986 ->35 2130 ->40 2242 ->40 2455 ->45 ->45 2802 ->50 ->50 3180 ->55 ->55 3449 ->60 ->60 3849 ->65 ->63 4040 Enter Holding Enter Holding Enter Holding Enter Holding Time Here Pressure Here Time Here Pressure Here ->0 2242 ->0 4010 ->15 sec 2206 ->5 4000 ->30 sec 2197 ->10 4000 ->1 2182 ->15 4000 ->2 2174 ->20 3995 ->3 2159 ->25 3995 ->4 2146 ->30 3990 ->5 2122 -> ->6 2104 -> ->7 2077 -> ->8 2065 -> ->9 2054 -> ->10 2044 -> -> -> 0 5 10 15 20 25 30 35 40 0 5 10 15 20 25 30 35 40 45 50 55 60 63 0 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1500 1600 1700 1800 1900 2000 2100 2200 2300 2400 2500 2600 2700 2800 2900 3000 3100 3200 3300 3400 3500 3600 3700 3800 3900 4000 4100 0 10203040506070Pressure (psi)Strokes (# of) LOT / FIT DATA CASING TEST DATA 0 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1500 1600 1700 1800 1900 2000 2100 2200 2300 2400 2500 2600 2700 2800 2900 3000 3100 3200 3300 3400 3500 3600 3700 3800 3900 4000 4100 4200 4300 0 5 10 15 20 25 30 35 LOT / FIT DATA CASING TEST DATA CASING AND FIT TESTS Well Name:BRU 223-24 FIT #2 Date:10/25/2021 Csg Size/Wt/Grade:9.625"40#, L-80 Supervisor:Yessak/Riley Csg Setting Depth:3259 TMD 3192 TVD Mud Weight:9.0 ppg LOT / FIT Press =906 psi LOT / FIT =14.46 ppg Hole Depth =3288 md Fluid Pumped=1.1 bbls Volume Back =0.8 Gals Est. Test Pump Output:0.063 bbl/stk LOT DATA (test pump) CASING TEST DATA (test pump) Enter Strokes Enter Pressure Enter Strokes Enter Pressure Here Here Here Here ->0.0 0 ->0.0 0 ->1.0 24 ->5.0 277 ->2.0 81 ->10.0 521 ->3.0 145 ->15.0 797 ->4.0 218 ->20.0 1122 ->5.0 272 ->25.0 1467 ->6.0 346 ->30.0 1820 ->7.0 395 ->35.0 2180 ->8.0 443 ->40.0 2254 ->9.0 486 ->45.0 2943 ->10.0 531 ->47.0 3030 ->11.0 592 -> ->12.0 653 -> ->13.0 705 -> ->14.0 751 -> ->15.0 785 -> ->16.0 851 -> ->17.0 906 -> -> -> -> -> -> -> Enter Holding Enter Holding Enter Holding Enter Holding Time Here Pressure Here Time Here Pressure Here ->0 834 ->0 3060 ->1 751 ->5 3057 ->2 707 ->10 3055 ->3 677 ->15 3054 ->4 654 ->20 3053 ->5 635 ->25 3053 ->6 620 ->30 3053 ->7 605 -> ->8 592 -> ->9 581 -> ->10 571 -> -> -> -> -> -> -> -> -> -> -> 0.01.0 2.0 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 12.0 13.0 14.015.0 16.0 17.0 0.0 5.0 10.0 15.0 20.0 25.0 30.0 35.0 40.0 45.0 47.0 0 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1500 1600 1700 1800 1900 2000 2100 2200 2300 2400 2500 2600 2700 2800 2900 3000 3100 3200 0.0 10.0 20.0 30.0 40.0 50.0Pressure (psi)Gallons (# of) LOT DATA (test pump)CASING TEST DATA 834 751 707677654635620605592581571 3060 3057 3055 3054 3053 3053 3053 0 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1500 1600 1700 1800 1900 2000 2100 2200 2300 2400 2500 2600 2700 2800 2900 3000 3100 3200 3300 0 5 10 15 20 25 30 35Pressure (psi)Time (Minutes) LOT DATA (test pump) 1. Type of Request: Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing 2.Operator Name:4.Current Well Class:5.Permit to Drill Number: Exploratory Development 3.Address:Stratigraphic Service 6. API Number: 7. If perforating:8.Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Will planned perforations require a spacing exception?Yes No 9.Property Designation (Lease Number): 10.Field/Pool(s): 11. Total Depth MD (ft): Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: MPSP (psi):Plugs (MD):Junk (MD): ±11,203' Proposed N/A Casing Collapse Structural Conductor 1,410psi Surface 3,090psi Intermediate 5,410psi Liner 7,500psi Tie-Back 7,500psi Packers and SSSV Type:Packers and SSSV MD (ft) and TVD (ft): 12. Attachments: Proposal Summary Wellbore schematic 13.Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14.Estimated Date for 15. Well Status after proposed work: Commencing Operations:OIL WINJ WDSPL Suspended 16.Verbal Approval:Date:GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Jake Flora Contact Email: Contact Phone: Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other: Post Initial Injection MIT Req'd? Yes No Spacing Exception Required? Yes No Subsequent Form Required: APPROVED BY Approved by:COMMISSIONER THE AOGCC Date: Comm.Comm.Sr Pet Eng Sr Pet Geo Sr Res Eng ±10,837' Proposed ±11,123' Proposed ±10,757' Proposed 3,684 N/A 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: AOGCC USE ONLY Dan Marlowe, Operations Manager jake.flora@hilcorp.com (907) 777-8442 8,430psi Tubing Grade: Tubing MD (ft):Perforation Depth TVD (ft): Tubing Size: N/A N/A N/A N/A 11/10/2021 N/A ±6,790' Proposed PRESENT WELL CONDITION SUMMARY STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 ADL0021128 221-072 50-283-20183-00-00 BRU 223-24 Beluga River Field / Undefined Tyonek Gas Pool CO 794 & 20 AAC 25.055 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Hilcorp Alaska, LLC Other: CBL Log / N2 Operations Length Size N/A TVD Burst N/A 8,430psi MD 7,240psi 2,980psi 5,750psi ±120' Proposed ±3,198' Proposed ±6,982' Proposed ±120' Proposed ±3,259' Proposed ±10,837' Proposed4-1/2" 7" 16" 9-5/8" ±120' Proposed ±7,230' Proposed ±3,259' Proposed ±11,203' Proposed Perforation Depth MD (ft): ±7,230' Proposed ±4,173' Proposed 4-1/2"±7,030' Proposed±7,030' Proposed ry Statu Form 10-403 Revised 10/2021 Approved application is valid for 12 months from the date of approval. By Meredith Guhl at 9:50 am, Oct 29, 2021 321-561 Digitally signed by Dan Marlowe (1267) DN: cn=Dan Marlowe (1267), ou=Users Date: 2021.10.28 16:39:15 -08'00' Dan Marlowe (1267) Granted on 10/22/21. DLB 10-407 DSR-10/29/21DLB 10/29/2021 X X DLB X BJM 11/1/21 Approval to perforate is contingent on passing MIT-IA and MIT-T (part of PTD procedure not yet completed at the time of sundry approval). CT BOP test to 4000 psi. dts 11/2/2021 JLC 11/2/2021 Jeremy Price Digitally signed by Jeremy Price Date: 2021.11.02 09:43:30 -08'00' RBDMS HEW 11/3/2021 Well Prognosis Well Name:BRU 223-24 API Number:50-283-20183-00-00 Current Status:New Grassroots Well Leg:N/A Estimated Start Date:11/10/21 Rig:E-line Reg. Approval Req’d?Yes Date Reg. Approval Rec’vd: Regulatory Contact:Juanita Lovett Permit to Drill Number:221-072 First Call Engineer:Jake Flora (907) 777-8442 (O) (720) 988-5375 (C) Second Call Engineer:Ryan Rupert (907) 777-8503 (O) (907) 301-1736 (C) AFE Number:211-00061 Maximum Expected BHP:4767 psi 0.44 psi/ft gradient (10,835’ TVD) Max. Potential Surface Pressure:3684 psi BHP minus 0.1 psi/ft gradient Brief Well Summary BRU 223-24 is a grass roots well targeting the Tyonek and Beluga Sands. A spacing exception was granted 10/22/21 to allow testing and production of the well within the Beluga River Undefined Gas Pool and the Beluga River Undefined Tyonek Gas Pool. The purpose of this work/sundry is to log a CBL to evaluate cement of the 4-1/2” liner, jet the well dry with CT, and perforate Tyonek Sands. This Sundry is for the Tyonek Sands only, the Beluga Sands will need to be isolated prior to perforating. Notes Regarding Wellbore Condition x 4-1/2” tieback and annulus will be filled with 6% KCL from ~7030’ to surface. x 4-1/2” liner will be filled with drilling mud from ~7030’ to ~11203’ (PBTD). x E-line will complete CBL prior to starting sundry work. Electronic copy of CBL to be sent to AOGCC when completed. Pre-Sundry E-line Work 1. MIRU E-line unit. PT lubricator. PU CBL. TIH to PBTD. Run CBL log from PBTD to above top of 4-1/2” liner (~7030’). RDMO E-line unit. Send CBL to AOGCC. Coiled Tubing Procedure (Start of Sundry work) 1. MIRU Coiled Tubing, PT BOPE to 4,000 psi Hi 250 Low. Notify AOGCC 48 hrs. in advance of BOP test. 2. RU N2 pumping unit. 3. RIH, wash and displace drilling mud to water from 4-1/2” liner. 4. At PBTD drop ball and come online with N2 and jet well dry. a) Estimated volume of drilling mud in liner is ~ 65 bbls. b) Estimated volume of water to recover is ~ 170 bbls. 5. Once well is dry, leave ~2000 psi. on the well for first perforation interval. 6. POOH w/ coil. LD BHA. 7. RDMO Coiled Tubing. E-Line Procedure 8. MIRU e-line and pressure control equipment. PT lubricator to 3,800 psi Hi 250 Low. Note that the well is pressurized with nitrogen. 9. Perforate Tyonek Unconformity - T25 Sands from bottom up per program. (~7558’ – 10836’ TVD) a.Proposed perfs. also shown on the proposed schematic in red font. b. Final Perfs tie-in sheet will be provided in the field for exact perf intervals. prior to perforating.DLB Send CBL to AOGCC. River Undefined Tyonek Gas Pool. BRU 223-24 is a grass roots well targeting the Tyonek and Beluga Sands. A spacing exception was granted 10/22/21 to allow testing and production of the well within the Beluga River Undefined Gas Pool and the Beluga yg j y This Sundry is for the Tyonek Sands only, the Beluga Sands will need to be isolated DLB Well Prognosis c. Correlate using Open Hole Correlation Log provided by Geologist. Send the correlation pass to the Operations Engineer, Reservoir Engineer, and Geologist for confirmation. d. Use Gamma/CCL to correlate. e. Install Crystal gauges (or verify PTs are open to SCADA) before perforating. Record tubing pressures before and after each perforating run at 5 min., 10 min. and 15 min intervals post shot. f. Sand intervals may be grouped or shot one at a time and flow tested to the system. If a sand makes water, then a plug or an isolation patch may be set prior to moving up to the next sand interval. 10. POOH. 11. RD e-line. 12.Turn well over to production to test.(Test SSV with-in 5 days of stable production on well – notify AOGCC 48hrs before testing) Attachments: 1. Current Well Schematic 2. Proposed Well Schematic 3. Coil tubing BOPE 4. Standard Well Procedure – N2 Operations _____________________________________________________________________________________ Edited By: FVR 10-27-2021 Proposed Schematic Well: BRU 223-24 PTD: 221-072 API: 50-283-201183-00-00 TD =±11,203’ (MD) /TD =±10,835’ (TVD) 16” Orig. KB Elev.: 18.5’ / GL Elev.: 74.4’ 7” 16 9-5/8” 17 PBTD =±11,123’ (MD) / PBTD =±10,756’ (TVD) 4-1/2” 2 6-1/8” Hole 8-1/2” Hole 12-1/4” Hole 1 3 CASING DETAIL Size Type Wt Grade Conn. ID Top Btm 16”Conductor – Driven to Set Depth 84 X-56 Weld 15.01” Surf 120’ 9-5/8” Surf Csg 40 L-80 DWC 8.835” Surf 3,259’ 7" Int. Csg 26 L-80 DWC 6.276” Surf 7,230’ 4-1/2" Prod Lnr 12.75 P-110 TS-HP 3.958” 7,030’ 11,203’ 4-1/2" Prod Tieback 12.75 P-110 TS-HP 3.958” Surf 7,030’ JEWELRY DETAIL No. Depth ID OD Item 1 3,026’ 6.276” 8.835” 7” Swell Packer 2 7,030’ 4.875” 6.540” Liner hanger / LTP Assembly 3 1,000’ 3.833” 5.625” Injection Sub OPEN HOLE / CEMENT DETAIL 9-5/8” TOC @ Surface (50% excess) 7" Est. TOC @ 2,776’ (40% excess) 4-1/2” Est. TOC @ TOL (40% excess) _____________________________________________________________________________________ Updated By: JLL 10/28/21 PROPOSED Well: BRU 223-24 PTD: 221-072 API: 50-283-20183-00-00 Completed: FUTURE OPEN HOLE / CEMENT DETAIL 9-5/8” TOC @ Surface (50% excess) 7" Est. TOC @ 2,776’ (40% excess) 4-1/2” Est. TOC @ TOL (40% excess) TD =±11,203’ (MD)/TD =±10,835’ (TVD) 16” Orig. KB Elev.: 18.5’ / GL Elev.: 74.4’ 7” 9-5/8 ” Tyonek Sands Unconformity – T-25 Sands PBTD =±11,123’ (MD) / PBTD =±10,756’ (TVD) 4-1/2” 2 6-1/8” Hole 8-1/2” Hole 12-1/4” Hole 1 3 CASING DETAIL Size Type Wt Grade Conn. ID Top Btm 16”Conductor – Driven to Set Depth 84 X-56 Weld 15.01” Surf ±120’ 9-5/8” Surf Csg 40 L-80 DWC 8.835” Surf ±3,259’ 7" Int. Csg 26 L-80 DWC 6.276” Surf ±7,230’ 4-1/2" Prod Lnr 12.75 P-110 TS-HP 3.958” ±7,030’ ±11,203’ 4-1/2" Prod Tieback 12.75 P-110 TS-HP 3.958” Surf ±7,030’ JEWELRY DETAIL No.Depth (MD) Depth (TVD)ID OD Item 1 ±1,000’ ±1,000’ 3.958” 5.625” Chemical Injection Sub 2 ±3,026’ ±2,977’ 6.276” 8.835” 7” Swell Packer 3 ±7,030’ ±6,790’ 4.875” 6.540” Liner hanger / LTP Assembly PERFORATION DETAIL Zone Top (MD) Btm (MD) Top (TVD) Btm (TVD) FT Date Status Tyonek Sands ±7,829' ±11,202’ ±7,558' ±10,836' ±3,373’ Future Proposed STANDARD WELL PROCEDURE NITROGEN OPERATIONS 12/08/2015 FINAL v1 Page 1 of 1 1.) MIRU Nitrogen Pumping Unit and Liquid Nitrogen Transport. 2.) Notify Pad Operator of upcoming Nitrogen operations. 3.) Perform Pre-Job Safety Meeting. Review Nitrogen vendor standard operating procedures and appropriate Safety Data Sheets (formerly MSDS). 4.) Document hazards and mitigation measures and confirm flow paths. Include review on asphyxiation caused by nitrogen displacing oxygen. Mitigation measures include appropriate routing of flowlines, adequate venting and atmospheric monitoring. 5.) Spot Pumping Unit and Transport. Confirm liquid N2 volumes in transport. 6.) Rig up lines from the Nitrogen Pumping Unit to the well and returns tank. Secure lines with whip checks. 7.) Place signs and placards warning of high pressure and nitrogen operations at areas where Nitrogen may accumulate or be released. 8.) Place pressure gauges downstream of liquid and nitrogen pumps to adequately measure tubing and casing pressures. 9.) Place pressure gauges upstream and downstream of any check valves. 10.) Wellsite Manager shall walk down valve alignments and ensure valve position is correct. 11.) Ensure portable 4-gas detection equipment is onsite, calibrated, and bump tested properly to detect LEL/H2S/CO2/O2 levels. Ensure Nitrogen vendor has a working and calibrated detector as well that measures O2 levels. 12.) Pressure test lines upstream of well to approved sundry pressure or MPSP (Maximum Potential Surface Pressure), whichever is higher. Test lines downstream of well (from well to returns tank) to 1,500 psi. Perform visual inspection for any leaks. 13.) Bleed off test pressure and prepare for pumping nitrogen. 14.) Pump nitrogen at desired rate, monitoring rate (SCFM) and pressure (PSI). All nitrogen returns are to be routed to the returns tank. 15.) When final nitrogen volume has been achieved, isolate well from Nitrogen Pumping Unit and bleed down lines between well and Nitrogen Pumping Unit. 16.) Once you have confirmed lines are bled down, no trapped pressure exists, and no nitrogen has accumulated begin rig down of lines from the Nitrogen Pumping Unit. 17.) Finalize job log and discuss operations with Wellsite Manager. Document any lessons learned and confirm final rates/pressure/volumes of the job and remaining nitrogen in the transport. 18.) RDMO Nitrogen Pumping Unit and Liquid Nitrogen Transport. STATE OF ALASKA Reviewed By:� OIL AND GAS CONSERVATION COMMISSION P.I. Supry BOPE Test Report for: BELUGA RIV UNIT 223-24 Comm Contractor/Rig No.: Hilcorp 147 PTD#: 2210720 DATE: 10/24/2021 ' Inspector Adam Earl - Insp Source Operator: Hilcorp Alaska, LLC Operator Rep: Yessak/ Riley Rig Rep: Davis/ Trick Inspector Type Operation: EXPL Sundry No: Test Pressures: Inspection No: bopAGE211028131455 Rams: Annular: Valves: MASP: Type Test: INIT 250/5000 250/5000 ' 250/5000- 3684 / Related Insp No: MIND. IINJYEC:1 IUINJ: Misc P/F Location Gen.: P Housekeeping: P - PTD On Location P Standing Order Posted P Well Sign P Drl. Rig _ P Hazard Sec P TEST DATA MUD SYSTEM: Visual Alarm Trip Tank P_ -P_ Pit Level Indicators _ P _P Flow Indicator P P M th G D t t D v I as a ec or 142S Gas Detector MS Misc U_ _ NA ACCUMULATOR SYSTEM: Misc Time/Pressure P/F System Pressure 2950 - _ P _ Pressure After Closure _1700 _ P__ 200 PSI Attained 15 _P Full Pressure Attained 80 P Blind Switch Covers: All Stations - P Nitgn. Bottles (avg): x_2575_ - P AC` ' Mice n NA CHOKE MANIFOLD: Quantity P/F No. Valves 15 - P Manual Chokes 1 P Hydraulic Chokes 1 _ P CH Misc 0 NA #5 Rams Misc NA INSIDE REEL VALVES: #6 Rams FLOOR SAFTY VALVES: BOP STACK: (Valid for Coil Rigs Only) Choke Ln. Valves Quantity P/F Quantity Size P/F Upper Kelly 1 P Stripper 0 _ NA Lower Kelly 1 P Annular Preventer 1, 11 P Ball Type - 1 FP '� - #1 Rams 1 4.1/2 - - __ P Inside BOP 1 _ _ P, #2 Rams 1 - blind _ _ P FSV Misc 0 NA #3 Rams 1 41/2 FP #4 R 0 NA CHOKE MANIFOLD: Quantity P/F No. Valves 15 - P Manual Chokes 1 P Hydraulic Chokes 1 _ P CH Misc 0 NA #5 Rams 0 NA INSIDE REEL VALVES: #6 Rams 0 NA (Valid for Coil Rigs Only) Choke Ln. Valves 1 - _ 3 1/8 FP ✓' Quantity HCR Valves 2 - 2 1/16 X 3 1/8 FP Inside Reel Valves _ 0 ___ Kill Line Valves 2 - 2 1/16 P Check Valve 0 NA BOP Misc - I drilling -_spool FP P/F NA Number of Failures: 5 Test Results Test Time 24 Remarks: Long test. Lower rams had to be opened up and cleaned, spool flange leaked, TIW valve, manual (inside) Choke failed and replaced, HCR choke had to be cycled. Gas detection equipment tested 10/23/21. Alaska Oil and Gas Conservation Commission 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov Monty M Myers Drilling Manager Hilcorp Alaska, LLC 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Re: Beluga River Field, Undefined Tyonek Gas Pool, BRU 223-24 Hilcorp Alaska, LLC Permit to Drill Number: 221-072 Surface Location: 2050’ FNL, 35’ FEL, Sec 23, T13N R10W, SM, AK Bottomhole Location: 1740’ FSL, 2016’ FWL, Sec 24, T13N, R10W, SM, AK Dear Mr. Myers: Enclosed is the approved application for the permit to drill the above referenced well. The permit is approved subject to full compliance with 20 AAC 25.055. As planned, well BRU 223- 24 conforms to statewide well spacing requirements for reservoirs that lie deeper than 8,500 feet true vertical depth (TVD). Approval to test, complete, or produce reservoirs shallower than 8,500 feet TVD is contingent upon issuance of a conservation order approving a spacing exception. Hilcorp Alaska, LLC as Operator assumes the liability of any protest to the spacing exception that may occur. All dry ditch sample sets submitted to the AOGCC must be in no greater than 30' sample intervals from below the permafrost or from where samples are first caught and 10' sample intervals through target zones. This permit to drill does not exempt you from obtaining additional permits or an approval required by law from other governmental agencies and does not authorize conducting drilling operations until all other required permits and approvals have been issued. In addition, the AOGCC reserves the right to withdraw the permit in the event it was erroneously issued. Operations must be conducted in accordance with AS 31.05 and Title 20, Chapter 25 of the Alaska Administrative Code unless the AOGCC specifically authorizes a variance. Failure to comply with an applicable provision of AS 31.05, Title 20, Chapter 25 of the Alaska Administrative Code, or an AOGCC order, or the terms and conditions of this permit may result in the revocation or suspension of the permit. Sincerely, Jeremy M. Price Chair DATED this ___ day of October, 2021. Jeremy Price Digitally signed by Jeremy Price Date: 2021.10.08 09:27:01 -08'00' 1a. Type of Work: 1b. Proposed Well Class: Exploratory - Gas Service - WAG Service - Disp 1c. Specify if well is proposed for: Drill Lateral Stratigraphic Test Development - Oil Service - Winj Single Zone Coalbed Gas Gas Hydrates Redrill Reentry Exploratory - Oil Development - Gas Service - Supply Multiple Zone Geothermal Shale Gas 2. Operator Name: 5. Bond: Blanket Single Well 11.Well Name and Number: Bond No. 3. Address: 6.Proposed Depth: 12. Field/Pool(s): MD: 11,203' TVD: 10,835' 4a. Location of Well (Governmental Section): 7.Property Designation: Surface: Top of Productive Horizon: 8.DNR Approval Number: 13.Approximate Spud Date: Total Depth:9. Acres in Property:14. Distance to Nearest Property: 4b. Location of Well (State Base Plane Coordinates - NAD 27): 10. KB Elevation above MSL (ft): 92.9 15. Distance to Nearest Well Open Surface: x-323298 y- 2633587 Zone-4 74.4 to Same Pool: N/A 16. Deviated wells: Kickoff depth: 1600 feet 17. Maximum Potential Pressures in psig (see 20 AAC 25.035) Maximum Hole Angle: 18 degrees Downhole: Surface: Hole Casing Weight Grade Coupling Length MD TVD MD TVD Cond 16" 84# X-56 Weld 120' Surface Surface 120' 120' 12-1/4" 9-5/8" 40# L-80 DWC/C 3,280' Surface Surface 3,280' 3,215' 8-1/2" 7" 26# L-80 DWC/C 7,230' Surface Surface 7,230' 6,970' 6-1/8" 4-1/2" 12.75# P-110 TS-HP 4,173' 7,030' 6,778' 11,203' 10,836' 19.PRESENT WELL CONDITION SUMMARY (To be completed for Redrill and Re-Entry Operations) Junk (measured): TVD Hydraulic Fracture planned? Yes No 20.Attachments: Property Plat BOP Sketch Drilling Program Time v. Depth Plot Shallow Hazard Analysis Diverter Sketch Seabed Report Drilling Fluid Program 20 AAC 25.050 requirements Contact Name: Contact Email: Contact Phone: Date: Permit to Drill API Number: Permit Approval Number:Date: Conditions of approval : If box is checked, well may not be used to explore for, test, or produce coalbed methane, gas hydrates, or gas contained in shales: Samples req'd: Yes No Mud log req'd: Yes No H2S measures: Yes No Directional svy req'd: Yes No Spacing exception req'd: Yes No Inclination-only svy req'd: Yes No Post initial injection MIT req'd: Yes No APPROVED BY Approved by: COMMISSIONER THE COMMISSION Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng 10/1/2021 2,608' to nearest unit boundary Frank Roach frank.roach@hilcorp.com 777-8413 L - 73 ft3 / T - 500 ft3 Drilling Manager Monty Myers 21. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Surface Perforation Depth TVD (ft):Perforation Depth MD (ft): Production Liner Intermediate 9/13/2021 Conductor/Structural Authorized Title: Authorized Signature: Authorized Name: LengthCasing Cement Volume MDSize Plugs (measured): (including stage data) Driven L - 1335 ft3 / T - 269 ft3 Effect. Depth MD (ft): Effect. Depth TVD (ft): 489 18. Casing Program: Top - Setting Depth - BottomSpecifications 4767 GL / BF Elevation above MSL (ft): Total Depth MD (ft): Total Depth TVD (ft): 022224484 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION PERMIT TO DRILL 20 AAC 25.005 L - 806 ft3 / T - 123 ft3 3684 1976’ FSL, 1590’ FWL, Sec 24, T13N, R10W, SM, AK 1740’ FSL, 2016’ FWL, Sec 24, T13N, R10W, SM, AK N/A 3800 Centerpoint Drive, Suite 1400 Anchorage, AK 99503 Hilcorp Alaska, LLC 2050’ FNL, 35’ FWL, Sec 23, T13N R10W, SM, AK ADL 21128 BRU 223-24 Beluga River Field Undefined Tyonek Gas Pool Cement Quantity, c.f. or sacks Commission Use Only See cover letter for other requirements. Stratigraphic Test No Mud log req'd: Yes No No Directional svy req'd: Yes No Seabed ReportDrilling Fluid Program 20 AAC 25.050 requirements BOP SketchDrilling Program Time v. Depth Plot Shallow Hazard Analysis Single Well Gas Hydrates No Inclination-only svy req'd: Yes No Exploratory - Oil Development - Gas Service - Supply Multiple Zone Geothermal No No Form 10-401 Revised 3/2021 This permit is valid for 24 months from the date of approval per 20 AAC 25.005(g) By Meredith Guhl at 1:29 pm, Sep 13, 2021 SFD 10/6/2021 FEL * Spacing exception req'd: a spacing exception order is approved by AOGCC. Operator bears all responsibility and liability--both legal and financial--for any objections to, delays to, or denial of the * * Undefined Tyonek Gas Pool Provide daily operations reports to AOGCC during drilling/completion operation. DSR-9/13/21 operator's spacing exception request. Submit FIT data to AOGCC for review before drilling 6-1/8" hole section. No reservoir shallower than 8,500 feet TVD may be open to test or production until BJM 9/24/21 SFD 9/21/2021 *Classified as a delineation (exploratory) well if drilled as planned to appraise potential reservoirs within the upper Tyonek Formation. Initial BOP test to RWP, 5000 psi. Subsequent BOP tests to 4000 psi. Subsequent Annular test to 2500 psi. BOP test frequency is 7 days. SFD 9/15/2021 Provide 48 hrs notice for AOGCC witness of MIT-T to 4000 psi and MIT-IA to 2500 psi. 221-072 50-283-20183-00-00 * ϭϬͬϴͬϮϭ dts 10/8/2021 JLC 10/8/2021 10/8/21 Jeremy Price Digitally signed by Jeremy Price Date: 2021.10.08 09:26:23 -08'00' BRU 223-24 Drilling Program Rev 0 September 10, 2021 Contents 1.0 Well Summary ..........................................................................................................................................................2 2.0 Management of Change Information ........................................................................................................................3 3.0 Tubular Program: .....................................................................................................................................................4 4.0 Drill Pipe Information: .............................................................................................................................................4 5.0 Internal Reporting Requirements .............................................................................................................................5 6.0 Planned Wellbore Schematic ....................................................................................................................................6 7.0 Drilling / Completion Summary ................................................................................................................................7 8.0 Mandatory Regulatory Compliance / Notifications ..................................................................................................9 9.0 R/U and Preparatory Work .................................................................................................................................... 11 10.0 N/U 21-1/4” Diverter ............................................................................................................................................... 12 11.0 Drill 12-1/4” Hole Section........................................................................................................................................ 14 12.0 Run 9-5/8” Surface Casing ...................................................................................................................................... 16 13.0 Cement 9-5/8” Surface Casing ................................................................................................................................ 19 14.0 BOP N/U and Test ................................................................................................................................................... 22 15.0 Drill 8-1/2” Hole Section .........................................................................................................................................23 16.0 Run 7” Production Casing ...................................................................................................................................... 26 17.0 Cement 7” Production Casing ................................................................................................................................. 29 18.0 Drill 6-1/8” Hole Section ......................................................................................................................................... 33 19.0 Run 4-1/2” Production Liner .................................................................................................................................. 36 20.0 Cement 4-1/2” Production Liner ............................................................................................................................. 39 21.0 4-1/2” Liner Tieback Polish Run and Displacement ............................................................................................... 43 22.0 4-1/2” Tieback Run ................................................................................................................................................. 43 23.0 RDMO ..................................................................................................................................................................... 44 24.0 Diverter Schematic .................................................................................................................................................. 45 25.0 BOP Schematic........................................................................................................................................................ 46 26.0 Wellhead Schematic ................................................................................................................................................ 47 27.0 Wellhead Schematic (Contingency) ........................................................................................................................ 48 28.0 Days Vs Depth ......................................................................................................................................................... 49 29.0 Geo-Prog ................................................................................................................................................................. 50 30.0 Anticipated Drilling Hazards .................................................................................................................................. 51 31.0 Hilcorp Rig 147 Layout ........................................................................................................................................... 54 32.0 FIT/LOT Procedure ................................................................................................................................................ 55 33.0 Choke Manifold Schematic ..................................................................................................................................... 56 34.0 Casing Design Information ..................................................................................................................................... 57 35.0 8-1/2” Hole Section MASP ...................................................................................................................................... 58 36.0 6-1/8” Hole Section MASP ...................................................................................................................................... 59 37.0 Spider Plot (Governmental Sections) ...................................................................................................................... 60 38.0 Surface Plat (As-Built NAD27) ............................................................................................................................... 61 Page 2 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 1.0 Well Summary Well BRU 223-24 Pad & Old Well Designation BRU 223-24 is a grassroots well on BRU K Pad Planned Completion Type 4-1/2” Production Liner w/Tieback (monobore) Target Reservoir(s) Tyonek gas appraisal Planned Well TD, MD / TVD 11,203’ MD / 10,835’ TVD PBTD, MD / TVD 11,122’ MD / 10,756’ TVD Surface Location (Governmental) 2050’ FNL, 35’ FWL, Sec 23, T13N R10W, SM, AK Surface Location (NAD 27)X=323298.64 Y=2633587.72 Top of Productive Horizon (Governmental) 1976’ FSL, 1590’ FWL, Sec 24, T13N, R10W, SM, AK TPH Location (NAD 27) X=324908.30, Y=2632303.33 BHL (Governmental) 1740’ FSL, 2016’ FWL, Sec 24, T13N, R10W, SM, AK BHL (NAD 27) X=325330.65, Y=2632060.83 AFE Number AFE Drilling Days 2 MOB, 31 DRLG AFE Completion Days AFE Drilling Amount AFE Completion Amount Maximum Anticipated Pressure (Surface) 3684 psi Maximum Anticipated Pressure (Downhole/Reservoir) 4767 psi Work String 4-1/2” 16.6# S-135 CDS-40 RKB – GL 92.9’ (74.4 + 18.5) Ground Elevation 74.4’ BOP Equipment 11” 5M Annular BOP 11” 5M Double Ram 11” 5M Single Ram Tyonek FEL Page 3 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 2.0 Management of Change Information Page 4 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 3.0 Tubular Program: Hole Section OD (in) ID (in) Drift (in) Conn OD (in) Wt (#/ft) Grade Conn Burst (psi) Collapse (psi) Tension (k-lbs) Cond 16” 15.01” 14.822” - 84 X-56 Weld 2980 1410 - 12-1/4”9-5/8”8.835” 8.75” 10.625” 40.0 L-80 DWC/C 5750 3080 1088 8-1/2”7”6.276” 6.151” 7.875” 26.0 L-80 DWC/C 7240 5410 717 6-1/8”4-1/2”3.958” 3.833” 4.920” 12.75 P-110 TS-HP 8430 7500 396 4.0 Drill Pipe Information: Hole Section OD (in) ID (in) TJ ID (in) TJ OD (in) Wt (#/ft) Grade Conn Burst (psi) Collapse (psi) Tension (k-lbs) All 4-1/2”3.826 2.6875” 5.25” 16.6 S-135 CDS40 17,693 16,769 468k Cleanout 2-7/8”2.323 2.265” 3.438” 7.9 P-110 PH-6 16,896 16,082 194k All casing will be new, PSL 1 (100% mill inspected, 10% inspection upon delivery to TSA in Fairbanks). Page 5 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 5.0 Internal Reporting Requirements 5.1 Fill out daily drilling report and cost report on Wellez. x Report covers operations from 6am to 6am x Click on one of the tabs at the top to save data entered. If you click on one of the tabs to the left of the data entry area – this will not save the data entered, and will navigate to another data entry tab. x Ensure time entry adds up to 24 hours total. x Try to capture any out of scope work as NPT. This helps later on when we pull end of well reports. 5.2 Afternoon Updates x Submit a short operations update each work day to pmazzolini@hilcorp.com, mmyers@hilcorp.com, Frank.Roach@hilcorp.com, and cdinger@hilcorp.com 5.3 Intranet Home Page Morning Update x Submit a short operations update each morning by 7am on the company intranet homepage. On weekend and holidays, ensure to have this update in before 5am. Each rig will be assigned a username to login with. 5.4 EHS Incident Reporting x Notify EHS field coordinator. 1. This could be one of (3) individuals as they rotate around. Know who your EHS field coordinator is at all times, don’t wait until an emergency to have to call around and figure it out!!!! a. John Coston: O: (907) 777-6726 C: (907) 227-3189 b. Jacob Nordwall: O: (907) 777-8418 C: (907) 748-0753 2. Spills: Keegan Fleming: O:907-777-8477 C:907-350-9439 x Notify Drlg Manager 1. Monty M Myers: O: 907-777-8431 C: 907-538-1168 x Submit Hilcorp Incident report to contacts above within 24 hrs 5.5 Casing Tally x Send final “As-Run” Casing tally to mmyers@hilcorp.com, Frank.Roach@hilcorp.com, and cdinger@hilcorp.com 5.6 Casing and Cmt report x Send casing and cement report for each string of casing to mmyers@hilcorp.com, Frank.Roach@hilcorp.com, and cdinger@hilcorp.com Page 6 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 6.0 Planned Wellbore Schematic 6.125" Hole Page 7 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 7.0 Drilling / Completion Summary BRU 223-24 is a S-shaped, directional grassroots development well to be drilled off of the BRU K Pad. Reservoir analysis and subsurface mapping has identified an optimal location for an exploratory penetration into the Tyonek formation and TD above the Tyonek C unconformity. The well will be completed to allow future extension to appraise deeper formations. The base plan is a S-shaped, directional wellbore with a kick off point at 1600’ MD. Maximum hole angle will be 18 deg. and TD of the well will be 11,203’ TMD/ 10,835’ TVD, ending with 8 deg inclination. Vertical section will be 2,542 ft. Drilling operations are expected to commence approximately October 1st, 2021. The Hilcorp Rig # 147 will be used to drill the wellbore, then run casing and cement. Surface casing will be run to ~3,276’ MD / 3,215’ TVD and cemented to surface to ensure protection of any shallow freshwater resources. Cement returns to surface will confirm TOC at surface. If cmt returns to surface are not observed, a Temp log will be run between 6 – 18 hrs after CIP to determine TOC. Necessary remedial action will then be discussed with AOGCC authorities. All waste & mud generated during drilling and completion operations will be hauled to the Beluga Waste Cells. In the event that we cannot store cuttings at the waste cells, cuttings will be hauled to the Kenai Gas Field G&I facility for disposal / beneficial reuse depending on test results. General sequence of operations: 1. MOB Hilcorp Rig # 147 to well site 2. N/U diverter and test. 3. Drill 12-1/4” hole to 3,276’ MD. 4. POOH w/drill pipe. Run and cement 9-5/8” surface casing. 5. ND diverter, N/U & test 11” x 5M BOP. 6. Drill 8-1/2” hole to 7,221’ MD. 7. POOH w/drill pipe. Perform logging. Perform cleanout run. 8.Run and cement 7” production casing. 9. Drill 6-1/8” hole section to 11,203’ MD. Perform wiper trips as needed. 10. POOH w/drill pipe. Perform logging and coring. Perform cleanout run. 11. Run and cmt 4-1/2” production liner. 12. POOH laying down running tools. 13. PU clean out / dressoff assembly and RIH. Displace well to 6% KCL completion fluid. 14. POOH and LD clean out assembly. 15. Run tieback/upper completion. 16. N/D BOP, N/U dry hole tree, RDMO. The well will be completed to allow future extension to appraise deeper formations. directional grassroots development well to be drilled off of the BRU K Pad. n optimal location for an exploratory penetration pypyppgp into the Tyonek formation and TD above the Tyonek C unconformity. yy Page 8 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Reservoir Evaluation Plan: 1. Surface hole: GR + Res 2. Intermediate hole: Triple Combo w/e-line sonic after TD 3. Production Hole: Triple Combo w/e-line sonic after TD 4. Mud loggers from surface casing point to TD. p Mud loggers from surface casing point to TD. Page 9 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 8.0 Mandatory Regulatory Compliance / Notifications Regulatory Compliance Ensure that our drilling and completion operations comply with the below AOGCC regulations. If additional clarity or guidance is required on how to comply with a specific regulation, do not hesitate to contact the Anchorage Drilling Team. x BOPs shall be tested at (1) week intervals during the drilling of BRU 223-24. Ensure to provide AOGCC 24 hrs notice prior to testing BOPs. x The initial test of BOP equipment will be to 250/5000 psi & subsequent tests of the BOP equipment will be to 250/4000 psi for 5/5 min (annular to 50% rated WP, 2500 psi on the high test for initial and subsequent tests). Confirm that these test pressures match those specified on the APD. x If the BOP is used to shut in on the well in a well control situation, we must test all BOP components utilized for well control prior to the next trip into the wellbore. This pressure test will be charted same as the 7 day BOP test. x All AOGCC regulations within 20 AAC 25.033 “Primary well control for drilling: drilling fluid program and drilling fluid system”. x All AOGCC regulations within 20 AAC 25.035 “Secondary well control for primary drilling and completion: blowout prevention equipment and diverter requirements” x Ensure AOGCC approved drilling permits are posted on the rig floor and in Co Man office. Regulation Variance Requests: x Page 10 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Summary of BOP Equipment and Test Requirements Hole Section Equipment Test Pressure (psi) 12-1/4” x 21-1/4” x 2M Hydril MSP diverter Function Test Only 8-1/2” & 6-1/8” x 11” x 5M Annular BOP x 11” x 5M Double Ram o Blind ram in btm cavity x Mud cross x 11” x 5M Single Ram x 3-1/8” 5M Choke Line x 2-1/16” x 5M Kill line x 3-1/8” x 2-1/16” 5M Choke manifold x Standpipe, floor valves, etc Initial Test: 250/5000 (Annular 2500 psi) Subsequent Tests: 250/4000 (Annular 2500 psi) x Primary closing unit: Control Technologies accumulator unit, 5 station, 120 gallon (12 x 11 gal bottles). x Primary closing hydraulic pressure is provided by an electrically driven triplex pump. Emergency pressure is provided by bottled nitrogen. Required AOGCC Notifications: x Well control event (BOPs utilized to shut in the well to control influx of formation fluids). x 24 hours notice prior to spud. x 24 hours notice prior to testing BOPs. x 24 hours notice prior to casing running & cement operations. x Any other notifications required in APD. Additional requirements may be stipulated on APD and Sundry. Regulatory Contact Information: AOGCC Jim Regg / AOGCC Inspector / (O): 907-793-1236 / Email: jim.regg@alaska.gov Bryan McLellan / Petroleum Engineer / (O): 907-793-1226 / Email: bryan.mclellan@alaska.gov Victoria Loepp / Petroleum Engineer / (O): 907-793-1247 / Email: victoria.loepp@alaska.gov Primary Contact for Opportunity to witness: AOGCC.Inspectors@alaska.gov Test/Inspection notification standardization format: http://doa.alaska.gov/ogc/forms/TestWitnessNotif.html Notification / Emergency Phone: 907-793-1236 (During normal Business Hours) Notification / Emergency Phone: 907-659-2714 (Outside normal Business Hours) Page 11 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 9.0 R/U and Preparatory Work 9.1 16” conductor set at +/-120’ below ground level. 9.2 Impermeable cellar installed. 9.3 Install slip-on 16-3/4” 3M “A” section. Ensure to orient wellhead so that tree will line up with flowline later. 9.4 Level pad and ensure enough room for layout of rig footprint and R/U. 9.5 Layout Herculite on pad to extend beyond footprint of rig. 9.6 R/U Hilcorp Rig #147, spot service company shacks, spot & R/U company man & toolpusher offices. 9.7 RU Mud loggers. Mud loggers are required on surface hole section taking 30’ samples 9.8 After rig equipment has been spotted, R/U handi-berm containment system around footprint of rig. 9.9 Mix mud for 12-1/4” hole section. 9.10 Install 6” liners in mud pumps. x HHF-1000 mud pumps are rated at 2550 psi (85%) / 441 gpm (100%) at 120 spm with 6” liners. Page 12 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 10.0 N/U 21-1/4” Diverter 10.1 N/U 21-1/4” Diverter x N/U 21-1/4” diverter “T”. x Knife gate, 16” diverter line. x Ensure diverter R/U complies with AOGCC reg 20.AAC.25.035(C). 10.2 Function test diverter. Ensure that the knife gate and annular are operated on the same circuit so that knife gate opens prior to annular closure. Ensure to notify AOGCC inspector to witness function test of diverter. x NOTE: Ensure closing time on diverter annular is in line with API RP 64: o Annular element ID 20” or smaller: Less than 30 seconds o Annular element ID greater than 20”: Less than 45 seconds 10.3 Ensure to set up a clearly marked “warning zone” is established on each side and ahead of the vent line tip. “Warning Zone” must include: x A prohibition on vehicle parking x A prohibition on ignition sources or running equipment x A prohibition on staged equipment or materials x Restriction of traffic to essential foot or vehicle traffic only. 10.4 Set wear bushing in wellhead. Page 13 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 10.5 Rig 147 Orientation: Note: Actual layout may be different on location SFD 9/15/2021 FEL Page 14 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 11.0 Drill 12-1/4” Hole Section 11.1 P/U 12-1/4” directional drilling assy: x Ensure BHA components have been inspected previously. x Drift and caliper all components before M/U. Visually verify no debris inside components that cannot be drifted. x Ensure TF offset is measured accurately and entered correctly into the MWD software. x Have DD run hydraulics calculations on site to ensure optimum nozzle sizing. x Workstring will be 4.5” 16.6# S-135 CDS40 11.2 4-1/2” Workstring & HWDP will come from Hilcorp. 11.3 Begin drilling out from 16” conductor at reduced flow rates to avoid broaching the conductor. 11.4 Drill 12-1/4” hole section to 3,280’ MD/ 3,215’ TVD. Confirm this setting depth with the geologist and Drilling Engineer while drilling the well. x Pump sweeps and maintain mud rheology to ensure effective hole cleaning. x Pump at 500 - 550 gpm. Ensure shaker screens are set up to handle this flowrate. x Utilize past experience to drill through coal seams efficiently. Coal seam log will be provided by Hilcorp Geo team. x Keep swab and surge pressures low when tripping. x Make wiper trips every 500’ or every couple days unless hole conditions dictate otherwise. x Ensure shale shakers are functioning properly. Check for holes in screens on connections. x Adjust MW as necessary to maintain hole stability. x TD the hole section in a good shale between 3,250’ and 3,350’MD. x Take MWD surveys every stand drilled (60’ intervals). 11.5 12-1/4” hole mud program summary: Weighting material to be used for the hole section will be barite. Additional barite will be on location to weight up the active system (1) ppg above highest anticipated MW. We will start with a simple gel + FW spud mud at 8.8 ppg. Pason PVT will be used throughout the drilling and completion phase. Remote monitoring stations will be available at the driller’s console, Co Man office, Toolpusher office, and mud loggers office. e will start gp y ()pp with a simple gel + FW spud mud at 8.8 ppg. Page 15 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 System Type: 8.8 – 9.5 ppg Pre-Hydrated Aquagel/freshwater spud mud Properties: Depths Density Viscosity Plastic Viscosity Yield Point API FL pH 120-3280’ 8.8 – 9.5 85-150 20 - 40 25 - 45 <10 8.5-9.0 System Formulation: Aquagel + FW spud mud Product Concentration FRESH WATER SODA ASH AQUAGEL CAUSTIC SODA BARAZAN D+ BAROID 41 PAC-L /DEXTRID LT ALDACIDE G X-TEND II 0.905 bbl 0.5 ppb 12-15 ppb 0.1 ppb (9 pH) as needed as required for weight if required for <12 FL 0.1 ppb 0.02 ppb 11.6 At TD; pump sweeps, CBU, and pull a wiper trip back to the 16” conductor shoe. 11.7 TOH with the drilling assy, handle BHA as appropriate. Page 16 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 12.0 Run 9-5/8” Surface Casing 12.1 R/U and pull wearbushing. 12.2 R/U Weatherford 9-5/8” casing running equipment. x Ensure 9-5/8” DWC x CDS 40 XO on rig floor and M/U to FOSV. x R/U fill-up line to fill casing while running. x Ensure all casing has been drifted on the location prior to running. x Be sure to count the total # of joints on the location before running. x Keep hole covered while R/U casing tools. x Record OD’s, ID’s, lengths, S/N’s of all components w/ vendor & model info. 12.3 P/U shoe joint. Visually verify no debris inside joint. 12.4 Continue M/U & thread locking shoe track assy consisting of: x (1) Shoe joint w/ float shoe bucked on (thread locked). x (1) Joint with coupling thread locked. x (1) Joint with float collar bucked on pin end & thread locked. x Install (2) centralizers on shoe joint over a stop collar. 10’ from each end. x Install (1) centralizer, mid tube on thread locked joint and on FC joint. x Ensure proper operation of float equipment. 12.5 Continue running 9-5/8” surface casing x Fill casing while running using fill up line on rig floor. x Use “API Modified” thread compound. Dope pin end only w/ paint brush. x Install (1) centralizer every other joint to 300’. Do not run any centralizers above 300’ in the event a top out job is needed. x Utilize a collar clamp until weight is sufficient to keep slips set properly. 9-5/8” 40.0# DWC/C M/U torques Casing OD Minimum Maximum Yield Torque 9-5/8”29,800 ft-lbs 34,800 ft-lbs 39,800 ft-lbs pp Install (1) centralizer every other joint to 300’. Page 17 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Page 18 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 12.6 Watch displacement carefully and avoid surging the hole. Slow down running speed if necessary. 12.7 Slow in and out of slips. 12.8 P/U casing hanger joint and M/U to string. Casing hanger joint will come out to the rig with the landing joint already M/U. Position the shoe as close to TD as possible. Strap the landing joint while it is on the deck and mark the joint at (1) ft intervals to use as a reference when landing the hanger. 12.9 Lower string and land out in wellhead. Confirm measurements indicate the hanger has correctly landed out in the wellhead profile. 12.10 R/U circulating equipment and circulate the greater of 1 x casing capacity or 1 x OH volume. Elevate the hanger offseat to avoid plugging the flutes. Stage up pump slowly and monitor losses closely while circulating. 12.11 After circulating, lower string and land hanger in wellhead again. Page 19 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 13.0 Cement 9-5/8” Surface Casing 13.1 Hold a pre-job safety meeting over the upcoming cmt operations. Make room in pits for volume gained during cement job. Ensure adequate cement displacement volume available as well. Ensure mud & water can be delivered to the cmt unit at acceptable rates. x Pump 20 bbls of freshwater through all of Halliburton’s equipment, taking returns to cuttings bin, prior to pumping any fluid downhole x How to handle cmt returns at surface. x Which pump will be utilized for displacement, and how fluid will be fed to displacement pump. x Positions and expectations of personnel involved with the cmt operation. 13.2 Document efficiency of all possible displacement pumps prior to cement job 13.3 R/U cmt head (if not already done so). Ensure top and bottom plugs have been loaded correctly. 13.4 Pump 5 bbls 10 ppg spacer. Test surface cmt lines. 13.5 Pump remaining 10 ppg spacer. 13.6 Drop bottom plug. Mix and pump cmt per below recipe. 13.7 Cement volume based on annular volume + 50% open hole excess. Job will consist of lead & tail, TOC brought to surface. Estimated Total Cement Volume: Section: Calculation: Vol (BBLS) Vol (ft3) 12.0 ppg LEAD: 16” Conductor x 9-5/8” casing annulus: 120’ x .12887 bpf = 15.46 86.8 12.0 ppg LEAD: 12-1/4” OH x 9-5/8” Casing annulus: (2780’ – 120’) x .05578 bpf x 1.5 = 222.24 1247.8 Total LEAD: 237.70 bbl 1334.6 ft3 15.4 ppg TAIL: 12-1/4” OH x 9-5/8” Casing annulus: (3280’- 2780’) x .05578 bpf x 1.5 = 41.83 234.9 15.4 ppg TAIL: 9-5/8” Shoe track: 80 x .07583 bpf = 6.07 34.1 Total TAIL: 47.9 bbl 269 ft3 TOTAL CEMENT VOL: 285.6 bbl 1603.6 ft3 Verified Cement calcs - bjm Page 20 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Cement Slurry Design: 13.8 Attempt to reciprocate casing during cement pumping if hole conditions allow. Keep the hanger elevated above the wellhead while working. If the hole gets “sticky”, land the hanger on seat and continue with the cement job. 13.9 After pumping cement, drop top plug and displace cement with spud mud. 13.10 Ensure cement unit is used to displace cmt so that volume tracking is more accurate. 13.11 Displacement calculation: 3280’- 80’ = 3200’ x .07583 bpf = 243 bbls 13.12 Monitor returns closely while displacing cement. Adjust pump rate if necessary. If hanger flutes become plugged, open wellhead side outlet in cellar and take returns to cellar. Be prepared to pump out fluid from cellar. Have some sx of sugar available to retard setting of cement. 13.13 Do not overdisplace by more than ½ shoe track volume. Total volume in shoe track is 6.1 bbls. x Be prepared for cement returns to surface. If cmt returns are not observed to surface, be prepared to run a temp log between 12 – 18 hours after CIP. Lead Slurry (2780’ MD to surface)Tail Slurry (3280’ to 2780’ MD) System Extended Conventional Density 12 lb/gal 15.4 lb/gal Yield 2.40 ft3/sk 1.16 ft3/sk Mixed Water 14.25 gal/sk 5.04 gal/sk Mixed Fluid 14.25 gal/sk 5.04 gal/sk Additives Code Description Code Description Type I/II Cement Class A Type I/II Cement Class A Halad-344 Fluid Loss Halad-344 Fluid Loss CalSeal Accelerator CalSeal Accelerator VersaSet Thixotropic CFR-3 Dispersant D-Air 5000 Anti Foam UCS Slurry Conditioner Econolite Light-weight add. Super CBL Anti-Gas Migration SA-1015 Suspension Agent BridgeMaker II Lost Circulation Page 21 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 x Be prepared with small OD top out tubing in the event a top out job is required. The AOGCC will require us to run steel pipe through the hanger flutes. The ID of the flutes is 1.5”. 13.14 Bump the plug with 500 psi over displacement pressure. Bleed off pressure and confirm floats are holding. If floats do not hold, pressure up string to final circulating pressure and hold until cement is set. Monitor pressure build up and do not let it exceed 500 psi above final circulating pressure if pressure must be held. 13.15 R/D cement equipment. Flush out wellhead with FW. 13.16 Back out and L/D landing joint. Flush out wellhead with FW. 13.17 M/U pack-off running tool and pack-off to bottom of Landing joint. Set casing hanger packoff. Run in lock downs and inject plastic packing element. 13.18 Lay down landing joint and pack-off running tool. Ensure to report the following on wellez: x Pre flush type, volume (bbls) & weight (ppg) x Cement slurry type, lead or tail, volume & weight x Pump rate while mixing, bpm, note any shutdown during mixing operations with a duration x Pump rate while displacing, note whether displacement by pump truck or mud pumps, weight & type of displacing fluid x Note if casing is reciprocated or rotated during the job x Calculated volume of displacement, actual displacement volume, whether plug bumped & bump pressure, do floats hold x Percent mud returns during job, if intermittent note timing during pumping of job. Final circulating pressure x Note if pre flush or cement returns at surface & volume x Note time cement in place x Note calculated top of cement x Add any comments which would describe the success or problems during the cement job Send final “As-Run” casing tally & casing and cement report to cdinger@hilcorp.com and Frank.Roach@hilcorp.com. This will be included with the EOW documentation that goes to the AOGCC. Page 22 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 14.0 BOP N/U and Test 14.1 ND Diverter line and diverter 14.2 N/U multi-bowl wellhead assy. Install 9-5/8” packoff P-seals. Test to 3000 psi. 14.3 N/U 11” x 5M BOP as follows: x BOP configuration from Top down: 11” x 5M annular BOP/11” x 5M double ram /11” x 5M mud cross/11” x 5M single ram x Double ram should be dressed with 2-7/8” x 5” variable bore rams in top cavity, blind ram in btm cavity. x Single ram should be dressed with 2-7/8” x 5” variable bore rams x N/U bell nipple, install flowline. x Install (2) manual valves & a check valve on kill side of mud cross. x Install (1) manual valve on choke side of mud cross. Install an HCR outside of the manual valve. 14.4 Run 4-1/2” BOP test assy, land out test plug (if not installed previously). x Test BOP to 250/5000 psi for 5/5 min. Test annular to 250/2500 psi for 5/5 min. x Subsequent BOP tests will be to 250/4000 psi for 5/5 min. Test annular to 250/2500 psi for 5/5 min. x Ensure to leave “B” section side outlet valves open during BOP testing so pressure does not build up beneath the test plug. 14.5 R/D BOP test assy. 14.6 Dump and clean mud pits, send spud mud to G&I pad for injection. 14.7 Mix 9.0 ppg 6% KCL PHPA mud system. 14.8 R/U mud loggers for production hole section. 14.9 Rack back as much 4-1/2” DP in derrick as possible to be used while drilling the hole section. 14.10 Install 5-1/2” liners in mud pumps. x HHF-1000 mud pumps are rated at 3036 psi (85%) / 370 gpm (100%) at 120 spm with 5-1/2” liners. Initial annular test to RWP, 5000 psi. bjm Mix 9.0 ppg 6% KCL PHPA mud system. Choke line side outlet and valves must be at least 3" when MPSP >3000 psi, per 20 AAC 25.035(e)(4)(F)(i). bjm Page 23 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 15.0 Drill 8-1/2” Hole Section 15.1 Pull test plug, run and set wear bushing 15.2 Ensure BHA components have been inspected previously. 15.3 Drift and caliper all components before M/U. Visually verify no debris inside components that cannot be drifted. 15.4 TIH, Conduct shallow hole test of MWD and confirm all LWD functioning properly. 15.5 Ensure TF offset is measured accurately and entered correctly into the MWD software. 15.6 Have DD run hydraulics calculations on site to ensure optimum nozzle sizing. Hydraulics calculations and recommended TFA is attached below. 15.7 Workstring will be 4.5” 16.6# S-135 CDS40. Ensure to have enough 4-1/2” DP in derrick to drill the entire open hole section without having to pick up pipe from the pipeshed. 15.8 8-1/2” hole section mud program summary: Weighting material to be used for the hole section will be barite, salt and calcium carbonate. Additional calcium carbonate will be on location to weight up the active system (1) ppg above highest anticipated MW. Pason PVT will be used throughout the drilling and completion phase. Remote monitoring stations will be available at the driller’s console, Co Man office, Toolpusher office, and mud loggers office. System Type: 9.0 ppg 6% KCL PHPA fresh water based drilling fluid. Properties: MD Mud Weight Viscosity Plastic Viscosity Yield Point pH HPHT 3,280’- 7,230’9.0 – 10.0 40-53 15-25 15-25 8.5-9.5 11.0 : 9.0 ppg 6% KCL PHPA fresh water based drilling fluid. Page 24 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 System Formulation: 6% KCL EZ Mud DP Product Concentration Water KCl Caustic BARAZAN D+ EZ MUD DP DEXTRID LT PAC-L BARACARB 5/25/50 BAROID 41 ALDACIDE G BARACOR 700 BARASCAV D 0.905 bbl 22 ppb (29 K chlorides) 0.2 ppb (9 pH) 1.25 ppb (as required 18 YP) 0.75 ppb (initially 0.25 ppb) 1-2 ppb 1 ppb 15 - 20 ppb (5 ppb of each) as required for a 9.0 – 10.0 ppg 0.1 ppb 1 ppb 0.5 ppb (maintain per dilution rate) 15.9 TIH w/ 8-1/2” directional assy to TOC. Shallow test MWD and LWD on trip in. Note depth TOC tagged on AM report. 15.10 R/U and test casing to 3000 psi / 30 min. Ensure to record volume / pressure and plot on LOT graph. AOGCC requirement is 50% of burst. 9-5/8” burst is 5750 psi / 2 = 2875 psi. 15.11 Drill out shoe track and 20’ of new formation. 15.12 CBU and condition mud for FIT. 15.13 Conduct FIT. Target value is 13.5 ppg EMW. Note: Offset field test data predicts frac gradient at the 9-5/8” shoe to be between 11.0 – 13.5 ppg EMW. A 13.5 ppg FIT results in a 3.5 ppg kick margin and a >15 bbl kick tolerance volume while drilling with the max planned MW of 10.0 ppg. Minimum value to attain greater than 15 bbl kick tolerance is 11.5 ppg EMW. 15.14 Drill 8-1/2” hole section to 7,230’ MD / 6,970’ TVD x Pump sweeps and maintain mud rheology to ensure effective hole cleaning. x Pump at 500 - 600 gpm. Ensure shaker screens are set up to handle this flowrate. x Keep swab and surge pressures low when tripping. x Make wiper trips every 1000’ unless hole conditions dictate otherwise. x On the second wiper trip (around 5,300’ MD), trip back to the 9-5/8” shoe to split the hole section in half x Ensure shale shakers are functioning properly. Check for holes in screens on connections. x Adjust MW as necessary to maintain hole stability. Keep HTHP fluid loss < 10. x Take MWD surveys every 100’ drilled. Surveys can be taken more frequently if deemed necessary. x Take (3) sets of formation samples every 20’. 15.15 At TD; pump sweeps, CBU, and pull a wiper trip back to the 9-5/8” shoe. Page 25 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 15.16 TOH with the drilling assy, standing back drill pipe. 15.17 LD BHA 15.18 RU E-Line and perform wireline logging plan. 15.19 RD E-Line. PU 8-1/2” clean out BHA, and TIH to TD. 15.20 Pump sweep, CBU and condition mud for casing run. 15.21 POOH and LD BHA 15.22 Install 7” casing rams in BOP stack and test. Page 26 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 16.0 Run 7” Production Casing 16.1. R/U Weatherford 7” casing running equipment. x Ensure 7” DWC x CDS 40 crossover on rig floor and M/U to FOSV. x R/U fill up line to fill casing while running. x Ensure all casing has been drifted prior to running. x Be sure to count the total # of joints before running. x Keep hole covered while R/U equipment. x Record OD’s, ID’s, lengths, S/N’s of all components w/ vendor & model info. 16.2. P/U shoe joint, visually verify no debris inside joint. 16.3. Continue M/U & thread locking shoe track assy consisting of: x (1) Shoe joint w/ shoe bucked on & threadlocked (coupling also thread locked). x (1) joint casing, threadlocked (coupling also thread locked) x (1) Joint with float collar bucked on pin end & threadlocked (coupling also thread locked). x Solid body centralizers will be pre-installed on shoe joint an FC joint. x Leave centralizers free floating so that they can slide up and down the joint. x Ensure proper operation of float shoe and float collar. x Utilize a collar clamp until weight is sufficient to keep slips set properly 16.4. Continue running 7” production casing x Fill casing while running using fill up line on rig floor. x Use “API Modified” thread compound. Dope pin end only w/ paint brush. x Install solid body centralizers on every joint across zones of interest, TBD after LWD. x Install solid body centralizers on every other joint to 9-5/8” shoe. Leave the centralizers free floating. x Pick up swell packer and place in string at approximately 250’ above 9-5/8” surface casing shoe depth (~3,026’ MD). 16.5. Continue running 7” production casing 7” 26# DWC/C M/U torques Casing OD Minimum Maximum Yield Torque 7”18,300 ft-lbs 21,100 ft-lbs 23,800 ft-lbs pppyp Install solid body centralizers on every joint across zones of interest, TBD after LWD. x yyj Install solid body centralizers on every other joint to 9-5/8” shoe. Page 27 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Page 28 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 16.6. Run in hole w/ 7” casing to the 9-5/8” casing shoe. 16.7. Fill the casing with fill up line and break circulation every 1,000 feet to the shoe or as the hole dictates. 16.8. Obtain slack off weight, PU weight, rotating weight, and torque of the casing. 16.9. Circulate 2X bottoms up at shoe, ease casing thru shoe. 16.10. Continue to RIH w/ casing no faster than 1 jt./minute. Watch displacement carefully and avoid surging the hole. Slow down running speed if necessary. 16.11. Set casing slowly in and out of slips. 16.12. Monitor PUW & SOW. Circulate BU if needed. Highlight zones of interest before running past, ex: coals 16.13. Swedge up and wash last stand before picking up hanger/landing joint. Note slack-off and pick- up weights. 16.14. P/U casing hanger joint and M/U to string. Casing hanger joint will come out to the rig with the landing joint already M/U. Position the shoe as close to TD as possible. Strap the landing joint while it is on the deck and mark the joint at (1) ft intervals to use as a reference when landing the hanger. 16.15. Lower string and land out in wellhead. Confirm measurements indicate the hanger has correctly landed out in the wellhead profile. 16.16. Stage pump rates up slowly to circulating rate. Circ and condition mud with casing on bottom. Circulate 2X bottoms up or until pressures stabilize and mud properties are correct and the shakers are clean. Reduce the low-end rheology of the drilling fluid by adding water and thinners. 16.17. Rotate and reciprocate string if hole conditions allow. Circ until hole and mud is in good condition for cementing. Page 29 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 17.0 Cement 7” Production Casing 17.1. Hold a pre-job safety meeting over the upcoming cmt operations. Make room in pits for volume gained during cement job. Ensure adequate cement displacement volume available as well. Ensure mud & water can be delivered to the cmt unit at acceptable rates. x Pump 20 bbls of freshwater through all of Halliburton’s equipment, taking returns to cuttings bin, prior to pumping any fluid downhole x How to handle cmt returns at surface, regardless of how unlikely it is that this should occur. x Which pump will be utilized for displacement, and how fluid will be fed to displacement pump. x Positions and expectations of personnel involved with the cmt operation. x Document efficiency of all possible displacement pumps prior to cement job. 17.2. Attempt to reciprocate the casing during cmt operations until hole gets sticky. 17.3. R/U cmt head (if not already done so). Ensure top and bottom plugs have been loaded correctly. 17.4. Pump 5 bbls of 12.5 ppg Mud Push spacer. 17.5. Test surface cmt lines to 4000 psi. 17.6. Pump remaining 12.5 ppg Mud Push spacer. 17.7. Drop bottom plug. Mix and pump cmt per below recipe. 17.8. Cement volume based on annular volume + 40% open hole excess. Job will consist of lead & tail, TOC brought to 500’ above surface casing shoe. Page 30 Version 1 September, 2021 BRU 223-24 Drilling Procedure Rev 1 Estimated Total Cement Volume: Cement Slurry Design: Section:Calculation:Vol (BBLS)Vol (ft3) 12.0 ppg LEAD: 9-5/8” casing x 7” casing annulus: (3280’ – 2780’) x .02823 bpf = 14.11 79.2 12.0 ppg LEAD: 8-1/2” OH x 7” Casing annulus: (6730’ – 3280’) x .02259 bpf x 1.4 = 109.22 613.2 Total LEAD: 123.33 bbl 692.4 ft3 15.4 ppg TAIL: 8-1/2” OH x 7” Casing annulus: (7230’- 6730’) x .02259 bpf x 1.4 = 15.81 88.8 15.4 ppg TAIL: 7” Shoe track: 80 x .03826 bpf = 3.06 17.2 Total TAIL: 18.87 bbl 106.0 ft3 TOTAL CEMENT VOL: 142.20 bbl 798.4 ft3 Lead Slurry (6730’ MD to 2780’)Tail Slurry (7230’ to 6730’ MD) System Extended Conventional Density 12 lb/gal 15.4 lb/gal Yield 2.40 ft3/sk 1.16 ft3/sk Mixed Water 14.25 gal/sk 5.04 gal/sk Mixed Fluid 14.25 gal/sk 5.04 gal/sk Additives Code Description Code Description Type I/II Cement Class A Type I/II Cement Class A Halad-344 Fluid Loss Halad-344 Fluid Loss CalSeal Accelerator CalSeal Accelerator VersaSet Thixotropic CFR-3 Dispersant D-Air 5000 Anti Foam UCS Slurry Conditioner Econolite Light-weight add. Super CBL Anti-Gas Migration SA-1015 Suspension Agent BridgeMaker II Lost Circulation Page 30 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Estimated Total Cement Volume: Cement Slurry Design: Section: Calculation: Vol (BBLS) Vol (ft3) 12.0 ppg LEAD: 9-5/8” casing x 7” casing annulus: (3280’ – 2780’) x .02823 bpf = 14.11 79.2 12.0 ppg LEAD: 8-1/2” OH x 7” Casing annulus: (6730’ – 3280’) x .02678 bpf x 1.4 = 129.47 726.9 Total LEAD: 143.58 bbl 806.1 ft3 15.4 ppg TAIL: 8-1/2” OH x 7” Casing annulus: (7230’- 6730’) x .02678 bpf x 1.4 = 18.74 105.2 15.4 ppg TAIL: 7” Shoe track: 80 x .03826 bpf = 3.06 17.2 Total TAIL: 21.80 bbl 122.4 ft3 TOTAL CEMENT VOL: 165.38 bbl 928.5 ft3 Lead Slurry (6730’ MD to 2780’) Tail Slurry (7230’ to 6730’ MD) System Extended Conventional Density 12 lb/gal 15.4 lb/gal Yield 2.40 ft3/sk 1.16 ft3/sk Mixed Water 14.25 gal/sk 5.04 gal/sk Mixed Fluid 14.25 gal/sk 5.04 gal/sk Additives Code Description Code Description Type I/II Cement Class A Type I/II Cement Class A Halad-344 Fluid Loss Halad-344 Fluid Loss CalSeal Accelerator CalSeal Accelerator VersaSet Thixotropic CFR-3 Dispersant D-Air 5000 Anti Foam UCS Slurry Conditioner Econolite Light-weight add. Super CBL Anti-Gas Migration SA-1015 Suspension Agent BridgeMaker II Lost Circulation 142.1 bbl 14.1 Actual cement volume pumped must be at least the corrected volumes indicated in blue text, w/ allowance for changes in casing length. bjm See revised cement table attached. .0226 bpf 123.2 bbl Superseded .0226 bpf 18.9 bbl 109.1 Page 31 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 17.9. Attempt to reciprocate casing during cement pumping if hole conditions allow. Keep the hanger elevated above the wellhead while working. If the hole gets “sticky”, land the hanger on seat and continue with the cement job. 17.10. After pumping cement, drop top plug and displace cement with mud. Displace at max rate of 5 bbl/min. 17.11. Displacement calculation: 7230’- 80’ = 7150’ x .03826 bpf = 274 bbls 17.12. If hole conditions allow – continue reciprocating casing throughout displacement. This will ensure a high quality cement job with 100% coverage around the pipe. 17.13. If elevated displacement pressures are encountered, position casing at setting depth and cease reciprocation. Monitor returns & pressure closely while circulating. Notify Drilling Foreman immediately of any changes. 17.14. Do not overdisplace by more than ½ shoe track. Shoe track volume is 3.7 bbls. 17.15. Bump the plug with 500 psi over displacement pressure. Bleed off pressure and confirm floats are holding. Note amount of fluid returned after bumping plug and releasing pressure. If floats do not hold, pressure up string to final circulating pressure and hold until cement is set. Monitor pressure build up and do not let it exceed 500 psi above final circulating pressure if pressure must be held. 17.16. Bleed pressure to zero to check float equipment. Watch for flow. Note amount of fluid returned after bumping plug and releasing pressure. 17.17. R/D cement equipment. Flush out wellhead with FW. 17.18. Back out and L/D landing joint. Flush out wellhead with FW. 17.19. M/U pack-off running tool and pack-off to bottom of Landing joint. Set casing hanger packoff. Run in lock downs and inject plastic packing element. 17.20. Lay down landing joint and pack-off running tool. 17.21. Remove 7” rams and reinstall 2-7/8” x 5” VBRs in ram cavity. Test VBRs with 2-7/8” and 4- 1/2” test joints. Page 32 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Ensure to report the following on wellez: x Pre flush type, volume (bbls) & weight (ppg) x Cement slurry type, lead or tail, volume & weight x Pump rate while mixing, bpm, note any shutdown during mixing operations with a duration x Pump rate while displacing, note whether displacement by pump truck or mud pumps, weight & type of displacing fluid x Note if casing is reciprocated or rotated during the job x Calculated volume of displacement , actual displacement volume, whether plug bumped & bump pressure, do floats hold x Percent mud returns during job. If intermittent, note timing during pumping of job. Final circulating pressure x Note if pre flush or cement returns at surface & volume x Note time cement in place x Note calculated top of cement x Add any comments which would describe the success or problems during the cement job Send final “As-Run” casing tally & casing and cement report to cdinger@hilcorp.com and Frank.Roach@hilcorp.com. This will be included with the EOW documentation that goes to the AOGCC. Page 33 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 18.0 Drill 6-1/8” Hole Section 15.23 Pull test plug, run and set wear bushing 15.24 Ensure BHA components have been inspected previously. 15.25 Drift and caliper all components before M/U. Visually verify no debris inside components that cannot be drifted. 15.26 TIH, Conduct shallow hole test of MWD and confirm all LWD functioning properly. 15.27 Ensure TF offset is measured accurately and entered correctly into the MWD software. 15.28 Have DD run hydraulics calculations on site to ensure optimum nozzle sizing. Hydraulics calculations and recommended TFA is attached below. 15.29 Workstring will be 4-1/2” 16.6# S-135 CDS40. Ensure to have enough 4-1/2” DP in derrick to drill the entire open hole section without having to pick up pipe from the pipeshed. 15.30 6-1/8” hole section mud program summary: Weighting material to be used for the hole section will be barite, salt and calcium carbonate. Additional calcium carbonate will be on location to weight up the active system (1) ppg above highest anticipated MW. Pason PVT will be used throughout the drilling and completion phase. Remote monitoring stations will be available at the driller’s console, Co Man office, Toolpusher office, and mud loggers office. System Type: 9.0 ppg 6% KCL PHPA fresh water based drilling fluid. Properties: MD Mud Weight Viscosity Plastic Viscosity Yield Point pH HPHT 7,230’- 11,203’9.0 – 12.0 40-53 15-25 15-25 8.5-9.5 11.0 gg , Additional calcium carbonate will be on location to weight up the active system (1) ppg above highest anticipated MW. Page 34 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 System Formulation: 6% KCL EZ Mud DP Product Concentration Water KCl Caustic BARAZAN D+ EZ MUD DP DEXTRID LT PAC-L BARACARB 5/25/50 BAROID 41 ALDACIDE G BARACOR 700 BARASCAV D 0.905 bbl 22 ppb (29 K chlorides) 0.2 ppb (9 pH) 1.25 ppb (as required 18 YP) 0.75 ppb (initially 0.25 ppb) 1-2 ppb 1 ppb 15 - 20 ppb (5 ppb of each) as required for a 9.0 – 11.0 ppg 0.1 ppb 1 ppb 0.5 ppb (maintain per dilution rate) 15.31 TIH w/ 6-1/8” directional assy to TOC. Shallow test MWD and LWD on trip in. Note depth TOC tagged on AM report. 15.32 R/U and test casing to 4000 psi / 30 min. Ensure to record volume / pressure and plot on LOT graph. AOGCC requirement is 50% of burst. 7” burst is 7240 psi / 2 = 3620 psi. 15.33 Drill out shoe track and 20’ of new formation. 15.34 CBU and condition mud for LOT. 15.35 Conduct LOT. Target value is 13.4 ppg EMW. Note: Offset field test data predicts frac gradient at the 7” shoe to be between 12.5 – 15.5 ppg EMW. A 13.4 ppg LOT results in a 2.4 ppg kick margin and a >15 bbl kick tolerance volume while drilling with a MW of 11.0 ppg. 15.36 Drill 6-1/8” hole section to 11,203’ MD / 10,835’ TVD x Pump sweeps and maintain mud rheology to ensure effective hole cleaning. x Pump at 400 - 500 gpm. Ensure shaker screens are set up to handle this flowrate. x Keep swab and surge pressures low when tripping. x Make wiper trips every 1000’ unless hole conditions dictate otherwise. x On the second wiper trip (around 9,200’ MD), trip back to the 7” shoe to split the hole section in half x Ensure shale shakers are functioning properly. Check for holes in screens on connections. x Adjust MW as necessary to maintain hole stability. Keep HTHP fluid loss < 10. x Take MWD surveys every 100’ drilled. Surveys can be taken more frequently if deemed necessary. x Take (3) sets of formation samples every 20’. 15.37 At TD; pump sweeps, CBU, and pull a wiper trip back to the 7” shoe. Submit FIT data to AOGCC for review before drilling 6-1/8" hole section. bjm Page 35 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 15.38 TOH with the drilling assy, standing back drill pipe. 15.39 LD BHA 15.40 RU E-Line and perform wireline logging plan. 15.41 RD E-Line. PU 6-1/8” clean out BHA, and TIH to TD. 15.42 Pump sweep, CBU and condition mud for casing run. 15.43 POOH and LD BHA 15.44 2-7/8” x 5” VBRs previously installed in BOP stack and tested with 4-1/2” test joint. Page 36 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 19.0 Run 4-1/2” Production Liner 16.6. R/U Weatherford 4-1/2” casing running equipment. x Ensure 4-1/2” TS-HP x CDS 40 crossover on rig floor and M/U to FOSV. x R/U fill up line to fill liner while running. x Ensure all liner has been drifted prior to running. x Be sure to count the total # of joints before running. x Keep hole covered while R/U liner tools. x Record OD’s, ID’s, lengths, S/N’s of all components w/ vendor & model info. 16.7. P/U shoe joint, visually verify no debris inside joint. 16.8. Continue M/U & thread locking shoe track assy consisting of: x (1) Shoe joint w/ shoe bucked on & threadlocked (coupling also thread locked). x (1) Joint with float collar bucked on pin end & threadlocked (coupling also thread locked). x (1) Joint with Baker landing collar bucked on pin end & threadlocked. x Solid body centralizers will be pre-installed on shoe joint an FC joint. x Leave centralizers free floating so that they can slide up and down the joint. x Ensure proper operation of float shoe and float collar. x Utilize a collar clamp until weight is sufficient to keep slips set properly 16.9. Continue running 4-1/2” production liner x Fill liner while running using fill up line on rig floor. x Use “Jet Lube Seal Guard” or “BOL 4010 NM” thread compound. Dope pin end only w/ paint brush. Note: this is different than what is used for the DWC threads. Ensure new brushes are used and all other thread compound buckets are removed from the rig floor to avoid contamination. x Install solid body centralizers on every joint across zones of interest, TBD after LWD. x Install solid body centralizers on every other joint to 7” shoe. Leave the centralizers free floating. 16.10. Continue running 4-1/2” production liner 4-1/2” 12.75# TS-HP M/U torques Casing OD Minimum Maximum Yield Torque 4-1/2”4,500 ft-lbs 5,600 ft-lbs 18,700 ft-lbs Install solid body centralizers on every joint across zones of interest, TBD after LWD. x yyj Install solid body centralizers on every other joint to 7” shoe. Page 37 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Page 38 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 16.18. Run in hole w/ 4-1/2” liner. 16.19. Fill the liner with fill up line and break circulation every 1,000 feet to the shoe or as the hole dictates. 16.20. Obtain slack off weight, PU weight, rotating weight, and torque of the liner. 16.21. PU 4-1/2” X 7” Baker liner hanger/LTP assembly. RIH 1 stand and circulate one liner volume to clear string. Obtain slack off weight, PU weight, rotating weight, and torque parameters of the liner. 16.22. Continue to RIH w/ liner to shoe. Break circulation every 1,000 feet to the shoe or as the hole dictates. 16.23. Set liner slowly in and out of slips. 16.24. Circulate 2X bottoms up at shoe, ease liner thru shoe. 16.25. Continue running in hole at slow speeds to avoid surging well. Target 20 ft/min and adjust slower as hole conditions dictate. 16.26. Monitor PUW & SOW. Circulate BU if needed. Highlight zones of interest before running past, ex: coals 16.27. Swedge up and wash last stand to bottom. P/U 2-5’ off bottom. Note slack-off and pick-up weights. 16.28. Stage pump rates up slowly to circulating rate. Circ and condition mud with liner on bottom. Circulate 2X bottoms up or until pressures stabilize and mud properties are correct and the shakers are clean. Reduce the low-end rheology of the drilling fluid by adding water and thinners. 16.29. Rotate and reciprocate string if hole conditions allow. Circ until hole and mud is in good condition for cementing. Page 39 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 20.0 Cement 4-1/2” Production Liner 17.22. Hold a pre-job safety meeting over the upcoming cmt operations. Make room in pits for volume gained during cement job. Ensure adequate cement displacement volume available as well. Ensure mud & water can be delivered to the cmt unit at acceptable rates. x Pump 20 bbls of freshwater through all of Halliburton’s equipment, taking returns to cuttings bin, prior to pumping any fluid downhole x How to handle cmt returns at surface, regardless of how unlikely it is that this should occur. x Which pump will be utilized for displacement, and how fluid will be fed to displacement pump. x Positions and expectations of personnel involved with the cmt operation. x Document efficiency of all possible displacement pumps prior to cement job. 17.23. Attempt to rotate and reciprocate the liner during cmt operations until hole gets sticky 17.24. Pump 5 bbls of 12.5 ppg Mud Push spacer. 17.25. Test surface cmt lines to 4500 psi. 17.26. Pump remaining 12.5 ppg Mud Push spacer. 17.27. Mix and pump lead and tail cement per below recipe. Ensure cement is pumped at designed weight. Job is designed to pump 40% OH excess. Estimated Total Cement Volume: Section: Calculation: Vol (BBLS) Vol (ft3) 12.0 ppg LEAD: 7” csg x 4-1/2” drillpipe annulus: 200’ x .01859 bpf = 3.72 20.9 12.0 ppg LEAD: 7” csg x 4-1/2” liner annulus: 200’ x .01859 bpf = 3.72 20.9 12.0 ppg LEAD: 6-1/8” OH x 4-1/2” annulus: (10702’ – 7230’) x .01677 bpf x 1.4 = 81.53 457.7 Total LEAD: 88.97 bbl 499.5 ft3 15.4 ppg TAIL: 6-1/8” OH x 4-1/2” annulus: (11202’- 10702’) x .01677 bpf x 1.4 = 11.74 65.9 15.4 ppg TAIL: 4-1/2” Shoe track: 80 x .01522 bpf = 1.22 6.8 Total TAIL: 12.96 bbl 72.8 ft3 TOTAL CEMENT VOL: 101.93 bbl 572.3 ft3 Verified cement calcs - bjm Page 40 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Cement Slurry Design: 17.28. Drop drillpipe dart and displace with drilling mud. If hole conditions allow – continue rotating and reciprocating liner throughout displacement. This will ensure a high quality cement job with 100% coverage around the pipe. 17.29. Displace cement at max rate of 5 bbl/min. Reduce pump rate to 2-3 bpm prior to latching DP dart into liner wiper plug. Note plug departure from liner hanger running tool and resume pumping at full displacement rate. Displacement volume can be re-zeroed at this point. 17.30. If elevated displacement pressures are encountered, position casing at setting depth and cease reciprocation. Monitor returns & pressure closely while circulating. Notify Drilling Foreman immediately of any changes. 17.31. Bump the plug and pressure up to 500 psi over final lift pressure. Hold pressure for 3-5 minutes. 17.32. Do not overdisplace by more than ½ shoe track. Shoe track volume is 1.2 bbls. 17.33. Bleed pressure to zero to check float equipment. Watch for flow. Note amount of fluid returned after bumping plug and releasing pressure. Pressure up to set liner hanger and bleed off pressure. Pick up and slack off to confirm liner hanger is set. Pressure back up to release running tool. 17.34. Pick up to expose dogs and set liner top packer. Confirm with slow rotation and setting weight back on liner top packer. Look for good shear indication successful weight transfer to set packer. Lead Slurry (10702’ MD to 7030’ MD) Tail Slurry (11202’ to 10702’ MD) System Extended Conventional Density 12 lb/gal 15.4 lb/gal Yield 2.4 ft3/sk 1.24 ft3/sk Mixed Water 14.09 gal/sk 5.58 gal/sk Mixed Fluid 14.09 gal/sk 5.58 gal/sk Additives Code Description Code Description Type I/II Cement CLASS A Type I/II Cement CLASS A Halad-344 Fluid Loss Halad-344 Fluid Loss HR-5 Retarder HR-5 Retarder D-Air 5000 Anti Foam CFR-3 Dispersant Econolite Light-weight add. UCS Slurry Conditioner SA-1015 Suspension Agent Super CBL Anti-Gas Migration BridgeMaker II Lost Circulation Page 41 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 17.35. Pressure up drill pipe to 500 psi and pick up to remove the RS packoff bushing from the RS nipple. Bump up pressure as req’d to maintain 500 psi DP pressure while moving pipe until the pressure drops rapidly, indicating pack-off is above the sealing area (ensure that 500 psi will be enough to overcome hydrostatic differential at liner top). 17.36. Immediately with the loss of pressure and before DP reaches zero, initiate circulation while picking up to position the bottom of the stinger inside the tieback sleeve. Increase pump rate to wellbore clean up rate until the sleeve area is thoroughly cleaned. 17.37. Pick up to the high-rate circulation point above the tieback extension, mark the pipe for reciprocation, do not re-tag the liner top, and circulate the well clean. Watch for cement returns and record the estimated volume. Rotate & circulate to clear cmt from DP. 17.38. RD cementers and flush equipment. POOH, LDDP and running tool. Verify the liner top packer received the required setting force by inspecting the rotating dog sub. Backup release from liner hanger: 17.39. If the HRD-E tool still does not release hydraulically, left-hand (counterclockwise) torque will have to be applied to the tool. This torque acts to shear brass screws. Bleed off pump pressure and ensure that the tool is in the neutral position. Apply left-hand torque as required to shear screws. 17.40. NOTE: Some hole conditions may require movement of the drillpipe to “work” the torque down to the setting tool. 17.41. After screws have sheared, the top sub and body of the setting tool will turn 1/4 turn. Then proceed slacking off set-down weight to shear second set of shear screws. The top sub will drop 1-3/4 inches. At this point, the bottom sub no longer supports the collet fingers. Pick straight up with workstring to release collet from the profile. 17.42. WOC minimum of 12 hours, test liner to 4,000 psi and chart for 30 minutes. Page 42 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 Ensure to report the following on wellez: x Pre flush type, volume (bbls) & weight (ppg) x Cement slurry type, lead or tail, volume & weight x Pump rate while mixing, bpm, note any shutdown during mixing operations with a duration x Pump rate while displacing, note whether displacement by pump truck or mud pumps, weight & type of displacing fluid x Note if liner is reciprocated or rotated during the job x Calculated volume of displacement , actual displacement volume, whether plug bumped & bump pressure, do floats hold x Percent mud returns during job. If intermittent, note timing during pumping of job. Final circulating pressure x Note if pre flush or cement returns at surface & volume x Note time cement in place x Note calculated top of cement x Add any comments which would describe the success or problems during the cement job Send final “As-Run” liner tally & liner and cement report to cdinger@hilcorp.com and Frank.Roach@hilcorp.com. This will be included with the EOW documentation that goes to the AOGCC. Page 43 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 21.0 4-1/2” Liner Tieback Polish Run and Displacement 18.1. PU liner tieback polish mill assy per Baker rep and RIH on drillpipe. x Liner Tieback Polish Mill x Casing scraper & brush for 7” 26# casing x 4-1/2” DP to surface 18.2. RIH to top of liner assembly and establish parameters. Polish tieback receptacle per Baker procedure. 18.3. After wellbore has been cleaned out satisfactorily using mud, test casing/liner envelope to 4000 psi / 30 min. Ensure to chart record casing test. 18.4. Displace drilling fluid in wellbore with a hi-vis pill followed by 6% KCl completion fluid. Drilling fluid will be left in the 4-1/2” liner 18.5. POOH, LDDP and polish mill assembly. Clean and clear rig floor in preparation for running tieback. 22.0 4-1/2” Tieback Run 19.1 PU 4-1/2” tieback assembly and RIH with 4-1/2” 12.75# L-80 TS-HP casing. 19.2 No-go tieback seal assembly in liner PBR and mark pipe. PU pup joint(s) if necessary to space out tieback seals in PBR within 1’ of no-go. 19.3 PU hanger and land string in hanger bowl. Note distance of seals from no-go. 19.4 Install packoff and test hanger void. 19.5 Test 4-1/2” liner and tieback to 4,000 psi and chart for 30 minutes. 19.6 Test 7” x 4-1/2” annulus to 2,500 psi and chart for 30 minutes. y 6% KCl completion fluid. Provide 48 hrs notice for AOGCC to witness MIT-T and MITIA. bjm Page 44 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 23.0 RDMO 20.1 Install BPV in wellhead 20.2 N/D BOPE 20.3 N/U dry-hole tree or full tree (if space permitting) and test to 5,000 psi. 20.4 RDMO Hilcorp Rig #147 Page 45 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 24.0 Diverter Schematic 16'’ Hydril V 4.30'Hydril MSP 21-¼ 2M .50' 4.00' 2.67' 1.33' 4.37' Grade Level 3.09' DSA16¾3MX21¼2M 21 ¼ 2M Spool 21 ¼ 2M Diverter Tee 16'’ 150 outlet 4.08' 16'’ casing cut @64'’ below ground level .42' Page 46 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 25.0 BOP Schematic Choke line side outlets and side outlet valves are 3-1/8", per Frank Roach email attached. Page 47 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 26.0 Wellhead Schematic Page 48 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 27.0 Wellhead Schematic (Contingency) Page 49 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 28.0 Days Vs Depth Page 50 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 29.0 Geo-Prog Surf Csg @ 3280' MD Interm Csg @ 7230' MD 8.5 ppg EMW ------------------- 13.9 ppg EMW SFD 9/15/2021 Total Depth @ 11,202' MD --------------- CAUTION: Page 51 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 30.0 Anticipated Drilling Hazards 12-1/4” Hole Section: Lost Circulation: Ensure 500 lbs of medium/coarse fibrous material & 500 lbs different sizes of Calcium Carbonate are available on location to mix LCM pills at moderate product concentrations. Hole Cleaning: Maintain rheology w/ gel and gel extender. Sweep hole with gel or flowzan sweeps as necessary. Optimize solids control equipment to maintain density, sand content, and reduce the waste stream. Maintain YP between 25 – 45 to optimize hole cleaning and control ECD. Wellbore stability: Lithology through this zone is a composite of pebble conglomerate and sand in the upper intervals with intermittent clay matrix. Carbonaceous material and coal may be noted. Gravel sizes that are larger than normal can cause hole-cleaning problems. If encountered, be prepared to increase the viscosity. Excessive quantities of gravel and sand may indicate wellbore instability. Increase properties up to a YP of ~50 - ~60 lbs/100ft2 to combat this issue. Maintain low flow rates for the initial 200’ of drilling to reduce the likelihood of washing out the conductor shoe. To help insure good cement to surface after running the casing, condition the mud to a YP of 25 – 30 prior to cement operations. Do not lower the YP beyond 25 to avoid trouble with sands that may be found on this well. Have Desco DF, SAPP, and water on hand to ensure the desired rheologies can be achieved. H2S: H2S is not present in this hole section. No abnormal pressures or temperatures are present in this hole section. Page 52 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 8-1/2” Hole Section: Lost Circulation: Ensure 500 lbs of medium/coarse fibrous material & 500 lbs different sizes of Calcium Carbonate are available on location to mix LCM pills at moderate product concentrations. Given the volume of losses experienced in BRU 241-34T, ensure all LCM inventory is fully stocked before drilling out surface casing. Hole Cleaning: Maintain rheology w/ viscosifier as necessary. Sweep hole w/ 20 bbls hi-vis pills as necessary. Optimize solids control equipment to maintain density and minimize sand content. Maintain YP between 20 - 30 to optimize hole cleaning and control ECD. Wellbore stability: Maintain MW as necessary using additions of Calcium Carbonate as weighting material. A torque reduction lube may be used in this hole section in concentrations up to 3% if needed. Maintain 6% KCl in system for shale inhibition. Coal Drilling: The following lessons were learned from extensive experience drilling coal seams in Cook Inlet. The need for good planning and drilling practices is also emphasized as a key component for success. x Keep the drill pipe in tension to prevent a whipping effect which can disturb coal sections. x Use asphalt-type additives to further stabilize coal seams. x Increase fluid density as required to control running coals. x Emphasize good hole cleaning through hydraulics, ROP and system rheology. H2S: H2S is not present in this hole section. No abnormal pressures or temperatures are present in this hole section. Page 53 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 6-1/8” Hole Section: Pressure Ramp / Overpressure: Maintain high kick-detection alert throughout this hole section. While While lost circulation was not documented in the 4 wells penetrating these depths in the 60’s and 70’s, be prepared in the event losses occur. Ensure all LCM inventory is fully stocked before drilling out intermediate casing. Lost Circulation: Ensure 1000 lbs of each of the different sizes of Calcium Carbonate are available on location to mix LCM pills at moderate product concentrations. While lost circulation was not documented in the 4 wells penetrating these depths in the 60’s and 70’s, be prepared in the event losses occur. Ensure all LCM inventory is fully stocked before drilling out intermediate casing. Hole Cleaning: Maintain rheology w/ viscosifier as necessary. Sweep hole w/ 20 bbls hi-vis pills as necessary. Optimize solids control equipment to maintain density and minimize sand content. Maintain YP between 20 - 30 to optimize hole cleaning and control ECD. Wellbore stability: Maintain MW as necessary using additions of Calcium Carbonate as weighting material. A torque reduction lube may be used in this hole section in concentrations up to 3% if needed. Maintain 6% KCl in system for shale inhibition. Coal Drilling: The following lessons were learned from extensive experience drilling coal seams in Cook Inlet. The need for good planning and drilling practices is also emphasized as a key component for success. x Keep the drill pipe in tension to prevent a whipping effect which can disturb coal sections. x Use asphalt-type additives to further stabilize coal seams. x Increase fluid density as required to control running coals. x Emphasize good hole cleaning through hydraulics, ROP and system rheology. H2S: H2S is not present in this hole section. No abnormal temperatures are present in this hole section. !Pressure Ramp / Overpressure: Maintain high kick-detection alert throughout this hole section. pp Page 54 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 31.0 Hilcorp Rig 147 Layout Page 55 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 32.0 FIT/LOT Procedure Formation Integrity Test (FIT) and Leak-Off Test (LOT) Procedures Procedure for FIT: 1. Drill 20' of new formation below the casing shoe (this does not include rat hole below the shoe). 2. Circulate the hole to establish a uniform mud density throughout the system. P/U into the shoe. 3. Close the blowout preventer (ram or annular). 4. Pump down the drill stem at 1/4 to 1/2 bpm, utilizing only the test pump. 5. On a graph with the recent casing test already shown, plot the fluid pumped (volume or strokes) vs. drill pipe pressure until appropriate surface pressure is achieved for FIT at shoe. 6. Shut down at required surface pressure. Hold for a minimum 10 minutes or until the pressure stabilizes. Record time vs. pressure in 1-minute intervals. 7. Bleed the pressure off and record the fluid volume recovered. The pre-determined surface pressure for each formation integrity test is based on achieving an EMW at least 1.0 ppg higher than the estimated reservoir pressure, and allowing for an appropriate amount of kick tolerance in case well control measures are required. Where required, the LOT is performed in the same fashion as the formation integrity test. Instead of stopping at a pre-determined point, surface pressure is increased until the formation begins to take fluid; at this point the pressure will continue to rise, but at a slower rate. The system is shut in and pressure monitored as with an FIT. Page 56 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 33.0 Choke Manifold Schematic Page 57 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 34.0 Casing Design Information Page 58 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 35.0 8-1/2” Hole Section MASP Page 59 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 36.0 6-1/8” Hole Section MASP Page 60 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 37.0 Spider Plot (Governmental Sections) Page 61 Version 0 September, 2021 BRU 223-24 Drilling Procedure Rev 0 38.0 Surface Plat (As-Built NAD27) SFD 9/15/2021 FEL SFD 9/15/2021 FEL !""# $% & ' 0 750 1500 2250 3000 3750 4500 5250 6000 6750 7500 8250 9000 9750 10500 11250True Vertical Depth (1500 usft/in)-750 0 750 1500 2250 3000 3750 4500 5250 6000 6750 7500 8250 9000 9750 Vertical Section at 126.04° (1500 usft/in) BRU Deep wp1 tgt1 BRU Deep wp1 tgt2 9 5/8" X 13 1/2" 7" X 8 1/2" 4 1/2" X 6 1/8" 500 1000 1500 2 0 0 0 2 5 0 0 3 0 0 0 3 5 0 0 4 0 0 0 4 5 0 0 5 0 0 0 5 5 0 0 6 0 0 0 6 5 0 0 7 0 0 0 7 5 0 0 8 0 0 0 8 5 0 0 9 0 0 0 9 5 0 0 1 0 0 0 0 1 0 5 0 0 1 1 0 0 0 1 1 20 3 BRU 223-24 wp04 Start Dir 3º/100' : 1600' MD, 1600'TVD End Dir : 2210.69' MD, 2200.33' TVD Start Dir 2º/100' : 6788.57' MD, 6546.18'TVD End Dir : 7043.39' MD, 6790.07' TVD Start Dir 2º/100' : 9883.39' MD, 9532.25'TVD End Dir : 10237.5' MD, 9878.98' TVD Total Depth : 11202.92' MD, 10835' TVD Sterling X2 Coal STERLING_A STERLING_B STERLING_C BELUGA_D BELUGA_E BELUGA_F BELUGA_G BELUGA_H BELUGA_I BRU_BELUGA_J TYONEK UNCONFORMITYTyonek T2 Tyonek T6 Sand Tyonek T19 Sand Tyonek T25 Hilcorp Alaska, LLC Calculation Method:Minimum Curvature Error System:ISCWSA Scan Method: Closest Approach 3D Error Surface: Ellipsoid Separation Warning Method: Error Ratio WELL DETAILS: Plan: BRU 223-24 74.40 +N/-S +E/-W Northing Easting Latitude Longitude 0.00 0.00 2633587.72 323298.64 61° 12' 16.4856 N 151° 0' 6.9819 W SURVEY PROGRAM Date: 2021-06-02T00:00:00 Validated: Yes Version: Depth From Depth To Survey/Plan Tool 18.50 3280.00 BRU 223-24 wp04 (BRU 223-24) 3_MWD+AX+Sag 3280.00 7230.00 BRU 223-24 wp04 (BRU 223-24) 3_MWD+AX+Sag 7230.00 11202.92 BRU 223-24 wp04 (BRU 223-24) 3_MWD+AX+Sag FORMATION TOP DETAILS TVDPath TVDssPath MDPath Formation 2510.69 2417.79 2537.61 Sterling X2 Coal 3265.28 3172.38 3332.50 STERLING_A 3444.52 3351.62 3521.31 STERLING_B 3592.63 3499.73 3677.32 STERLING_C 3816.43 3723.53 3913.07 BELUGA_D 4025.79 3932.89 4133.61 BELUGA_E 4336.71 4243.81 4461.13 BELUGA_F 4774.09 4681.19 4921.87 BELUGA_G 5074.44 4981.54 5238.25 BELUGA_H 5741.26 5648.36 5940.68 BELUGA_I 6310.64 6217.74 6540.46 BRU_BELUGA_J 7548.56 7455.66 7828.94 TYONEK UNCONFORMITY 7559.98 7467.08 7840.77 Tyonek T2 8052.55 7959.65 8350.91 Tyonek T6 Sand 10180.24 10087.34 10541.72 Tyonek T19 Sand 10831.90 10739.00 11199.79 Tyonek T25 REFERENCE INFORMATION Co-ordinate (N/E) Reference:Well Plan: BRU 223-24, True North Vertical (TVD) Reference:BRU 223-24 @ 92.90usft (147) Measured Depth Reference:BRU 223-24 @ 92.90usft (147) Calculation Method: Minimum Curvature Project:Beluga River Site:BRU K-Pad Well:Plan: BRU 223-24 Wellbore:BRU 223-24 Design:BRU 223-24 wp04 CASING DETAILS TVD TVDSS MD Size Name 3215.00 3122.10 3279.53 9-5/8 9 5/8" X 13 1/2" 6970.25 6877.35 7230.00 7 7" X 8 1/2" 10835.00 10742.10 11202.92 4-1/2 4 1/2" X 6 1/8" SECTION DETAILS Sec MD Inc Azi TVD +N/-S +E/-W Dleg TFace VSect Target Annotation 1 18.50 0.00 0.00 18.50 0.00 0.00 0.00 0.00 0.00 2 1600.00 0.00 0.00 1600.00 0.00 0.00 0.00 0.00 0.00 Start Dir 3º/100' : 1600' MD, 1600'TVD 3 2210.69 18.32 130.43 2200.33 -62.78 73.69 3.00 130.43 96.52 End Dir : 2210.69' MD, 2200.33' TVD 4 6788.57 18.32 130.43 6546.18 -996.00 1169.03 0.00 0.00 1531.29 Start Dir 2º/100' : 6788.57' MD, 6546.18'TVD 5 6996.99 16.00 118.65 6745.36 -1031.03 1219.19 2.00 -129.26 1592.46 BRU Deep wp1 tgt1 6 7043.39 15.08 119.15 6790.07 -1037.04 1230.08 2.00 171.99 1604.80 End Dir : 7043.39' MD, 6790.07' TVD 7 9883.39 15.08 119.15 9532.25 -1396.95 1875.46 0.00 0.00 2338.40 Start Dir 2º/100' : 9883.39' MD, 9532.25'TVD 8 10237.50 8.00 118.65 9878.98 -1431.24 1937.39 2.00 -179.44 2408.66 BRU Deep wp1 tgt2 End Dir : 10237.5' MD, 9878.98' TVD 9 11202.92 8.00 118.65 10835.00 -1495.66 2055.30 0.00 0.00 2541.90 Total Depth : 11202.92' MD, 10835' TVD -1650-1500-1350-1200-1050-900-750-600-450-300-1500150300450South(-)/North(+) (300 usft/in)-300 -150 0 150 300 450 600 750 900 1050 1200 1350 1500 1650 1800 1950 2100 2250 2400 2550West(-)/East(+) (300 usft/in)BRU Deep wp1 tgt2BRU Deep wp1 tgt19 5/8" X 13 1/2"7" X 8 1/2"4 1/2" X 6 1/8"2505007501000125015001750200022502500275030003250350037504000425045004750500052505500575060006250650067507000725075007750800082508500875090009250950097501000010250105001075010835BRU 223-24 wp04Start Dir 3º/100' : 1600' MD, 1600'TVDEnd Dir : 2210.69' MD, 2200.33' TVDStart Dir 2º/100' : 6788.57' MD, 6546.18'TVDEnd Dir : 7043.39' MD, 6790.07' TVDStart Dir 2º/100' : 9883.39' MD, 9532.25'TVDEnd Dir : 10237.5' MD, 9878.98' TVDTotal Depth : 11202.92' MD, 10835' TVDCASING DETAILSTVDTVDSS MDSize Name3215.00 3122.10 3279.53 9-5/8 9 5/8" X 13 1/2"6970.25 6877.35 7230.00 7 7" X 8 1/2"10835.00 10742.10 11202.92 4-1/2 4 1/2" X 6 1/8"Project: Beluga RiverSite: BRU K-PadWell: Plan: BRU 223-24Wellbore: BRU 223-24Plan: BRU 223-24 wp04WELL DETAILS: Plan: BRU 223-2474.40+N/-S +E/-WNorthingEastingLatitudeLongitude0.00 0.00 2633587.72 323298.64 61° 12' 16.4856 N 151° 0' 6.9819 WREFERENCE INFORMATIONCo-ordinate (N/E) Reference:Well Plan: BRU 223-24, True NorthVertical (TVD) Reference: BRU 223-24 @ 92.90usft (147)Measured Depth Reference:BRU 223-24 @ 92.90usft (147)Calculation Method:Minimum Curvature ( # ) " # * +,- * . . ! ! $&)#$ /0 "## !$%&%'()*!+, -% !-'! -./01 . 2 /- * !$%&%'()*!+, 1 0 * 3 ! 0 / ) 2 -$ ( / 3 )-$ *%+)45 , . 2*%+). 2/./., 6'! " 3( ( 4 "$ " %$ ) 1 0% 5% 2# &% ( " ( ( 7'&88 $9* :*; ; ; !&88 8 &** <&'' ;*7*=*;&%;+. *<*7'=<&++3 . . " %$ "$ 5% 1 0% ( 657. 617 ) ( ( (2 $"& ! ( ( '&'' '&'' ; <8+&+ %8&;! +!&!'.05& ('&<' ;*7*=*;&!8<;. *<*7'=;&%8*%3 . - 89: 4%0 8+: - - % 89: ! / 1/% >>"'* *':*<:'* *<& ; + &%% << %'& ; <<; 0, $1 -% !-'! . , - 04 8+,-: 8$*: 617 8$*: - 89: 657. 8$*: +;- 0*8&<' *;&'!'&'''&''*8&<' < 89: =$0 89: 657. 8$*: + 4 89: 617 8$*: /$ - 0 8$*: , - 0 8$*: - %% 897$*: $ 897$*: +$ 897$*: +,- ) $* '&'''&'''&'''&'''&'''&''*8&<''&'''&''*8&<'+!&!' '&'''&'''&'''&'''&'''&''* ;''&'''&'''&''* ;''&''* <'+&*' * '&! '&'' &'' &''+ &;%;&+8 ''& * '&! *8& *'&;% *'+&! '&'''&'''&'''&''* *;%&' %%;&''; <!;&*8* '&! *8& ; +88&<+; !< &8 *%&;<&;<*&**&''* *%&*%* ' *&' ; +!<& ;**8&;<*;&''; %%;&%%; ;<&!; *+*&%%*&'+*&%8&''* '&'8* ' +&'!; +%'&'+**%&*<*<&'8+ '! & %; ;%+&*+ '&'''&'''&'''&''* 8+<&!;* %;&%<% < &<**%&*<*<&'8% 88 & %% ! %& < *+%&!!'&*!&''&''* % +& %* ! *&!% 8+8&%8**8&;<8&''*' +&<'% +8;&'8 '&'''&'''&'''&'' '<<& '* !%<&;;*' 8 <&''**8&;<8&''** '&%*' +!&*' ( # ) " # * +,- * . . ! ! $&)#$ /0 "## !$%&%'()*!+, -% !-'! -./01 . 2 /- * !$%&%'()*!+, 1 0 * 3 ! 0 /$ - 0 8$*: < 89: =$0 89: 657. 8$*: / 1 0% 8$*: / 5% 8$*: 617 8$*: $&) , - 0 8$*: +,- $* -" >? , *8&<' '&'' *8&<' '&'' '&'''&'' %8&;! ; <8+&++!&!''&'' '&'' *''&'' '&'' *''&'' '&'' '&'''&'' %8&;! ; <8+&++&*''&'' '&'' ''&'' '&'' ''&'' '&'' '&'''&'' %8&;! ; <8+&+*'+&*''&'' '&'' ''&'' '&'' ''&'' '&'' '&'''&'' %8&;! ; <8+&+'+&*''&'' '&'' !''&'' '&'' !''&'' '&'' '&'''&'' %8&;! ; <8+&+ '+&*''&'' '&'' <''&'' '&'' <''&'' '&'' '&'''&'' %8&;! ; <8+&+!'+&*''&'' '&'' ;''&'' '&'' ;''&'' '&'' '&'''&'' %8&;! ; <8+&+<'+&*''&'' '&'' +''&'' '&'' +''&'' '&'' '&'''&'' %8&;! ; <8+&+;'+&*''&'' '&'' 8''&'' '&'' 8''&'' '&'' '&'''&'' %8&;! ; <8+&++'+&*''&'' '&'' %''&'' '&'' %''&'' '&'' '&'''&'' %8&;! ; <8+&+8'+&*''&'' '&'' * '''&'' '&'' * '''&'' '&'' '&'''&'' %8&;! ; <8+&+%'+&*''&'' '&'' * *''&'' '&'' * *''&'' '&'' '&'''&'' %8&;! ; <8+&+* ''+&*''&'' '&'' * ''&'' '&'' * ''&'' '&'' '&'''&'' %8&;! ; <8+&+* *'+&*''&'' '&'' * ''&'' '&'' * ''&'' '&'' '&'''&'' %8&;! ; <8+&+* '+&*''&'' '&'' * !''&'' '&'' * !''&'' '&'' '&'''&'' %8&;! ; <8+&+* '+&*''&'' '&'' * <''&'' '&'' * <''&'' '&'' '&'''&'' %8&;! ; <8+&+* !'+&*''&'' '&'' * ;''&'' '&'' * ;''&'' '&'' '&'''&'' %8&;! ; <8+&+* <'+&*''&'' '&'' -@7ABA/-BA+,- * +''&'' &'' * ;%%&%< *&+' *&%%* '&! ''&;* ; <8<&%%* ;'+&'< &'' &;* * 8''&'' ;&'' * +%%&; ;&+% +&%;* '&! ';&<' ; <8'&8** +';&+ &'' *'&! * %''&'' %&'' * 8%8&++ *<&< *+&%'* '&! *;& ' ; <+&'* 8'<&8+ &'' &!! '''&'' *&'' * %%+&'8 +&'+ *&++* '&! %&%% ; <;'&*+* %'!&*8 &'' !*&;* *''&'' *<&'' '%!& * !&' !%&<!* '&! !+&< ; <!!&+; ''*&!* &'' ;!&8% ''&'' *8&'' *%'&*8 ;'&; +*&*<* '&! ;8&8< ; <;&' '%+&8 &'' % &' *'&;% *8& ''& ;&+8 + &;%* '&! +*& < ; < &8 *'+&! &'' %;&< 5-?BA/-?A+,- ''&'' *8& 8<&* 8'&%% %<&';* '&! %&!! ; <'<&% *%&'&'' *!&<* !''&'' *8& 8'&'< *'*& + **8&%8* '&! !*;&'< ; !8!&<! 8+&*<'&'' *<<&8; <''&'' *8& !+!&%8 **&+; *!&%** '&! ! %&;; ; !; &+% 8&'8 '&'' *8+&' < +&;* *8& <*'&;% *%&! *<*&%** '&! !!8&<! ; !<<&%% !*+&+%'&'' *%8&%% %C# ;''&'' *8& <;%&%* *!&*! *;;&8!* '&! !; &+ ; !! &'! !++&'*'&'' *8&<! +''&'' *8& ;;!&8! *;&< *%'&+;* '&! !8;&88 ; !& ' <+*&%!'&'' !%&88 8''&'' *8& +<%&+8 *8&% *!&;%* '&! <*'&!% ; !'*&<< ;;;&88 '&'' 8*& %''&'' *8& 8<!&+* ' & ' 8&;* '&! < !&*' ; 8'&8' +;*&8*'&'' *&<; '''&'' *8& %!%&;! &;% ;&<<* '&! <<+&+* ; ;'&'< 8<;&+!'&'' ! &%' *''&'' *8& '!!&<+ !!&'+ 8;&!+* '&! <8*& ; %& ' %<*&;+'&'' +<&! ''&'' *8& * %&<' ;!&!; *'&!'* '&! ;'!&% ; *8&<< '!;&;''&'' !';&<% +%&< *8& *<&'' 8'&;+ %&! * '&! ; &+* ; '&'< *&*''&'' ! *&<* D7EFC7F ''&'' *8& !&! 8!&8! !& * '&! ;8&<! ; %+&8* *!*&< '&'' ! +&% &<' *8& ;<&8 %*&!+ !&*'* '&! ; ;&* ; %*&'; *+& 8 '&'' !!8&** +5 "<12G !''&'' *8& %& ; '<& <8&<* '&! ;<&*< ; ++&'; ;&!;'&'' !;%&+ <''&'' *8& !!&% <&;* 8&*8* '&! ;+<&+; ; <;& * *& %'&'' <''&;* +<%&+8 ( # ) " # * +,- * . . ! ! $&)#$ /0 "## !$%&%'()*!+, -% !-'! -./01 . 2 /- * !$%&%'()*!+, 1 0 * 3 ! 0 /$ - 0 8$*: < 89: =$0 89: 657. 8$*: / 1 0% 8$*: / 5% 8$*: 617 8$*: $&) , - 0 8$*: +,- $* -" D?B , <*& * *8& !!!&< %&%; 8+&8* '&! ;8'&+% ; <*&8% <*&;'&'' <'+&% +5 "<12G ;''&'' *8& <*%& !;&'' !';&*** '&! ;%%& + ; <&<; !;& '&'' < *&%< ;++& *8& <%&; ;*&+; !!&;** '&! +*+&; ; *%&< !%%&+ '&'' <<;&*% +5 "<12G# +''&'' *8& ;*!&*; ;;& 8 ! '&' * '&! +&%8 ; *!&8* <*&;'&'' <; &% 8''&'' *8& +'%&'% 8;&++ !< &%;* '&! +!;&<% ; *%!&'; ;*;&*%'&'' <%!&; %''&'' *8& 8'!&' !'+&*; !++&8%* '&! ++'&' ; *+ & +**&*'&'' ;<&%8 %* &'+ *8& 8*;&! !'%&8 !8*&'** '&! ++ &% ; *+'&;' + &< '&'' ; '&'+ 5"2 G- ! '''&'' *8& 8%8&%< !+&<! <'*&8** '&! +% &8* ; *<&<+ 8';&'<'&'' ;<+& ! *''&'' *8& %% &88 !!+&% <<&+!* '&! 8*+&! ; * *&8 %''&%8 '&'' ;88&;; ! * &;* *8& ! '<&+% !<!&+8 < &+8* '&! 8<& ; ; *!&8! % &8%'&'' ;%%&*% 5"2 G5 ! ''&'' *8& ! '88&8* !;8& * <!%&;+* '&! 8!*&' ; ***&'+ %%<&%*'&'' +'&'' ! ''&'' *8& ! *8 &+! !88&+' <+ &<%* '&! 8;!&;! ; '%'& ! '%'&8!'&'' +<*& ! ! !''&'' *8& ! +8&;8 <'%&'8 <%+&<* '&! 888&< ; ';%&<+! *8<&+8 '&'' +8&;8 ! !;*&* *8& ! ;&+* <*&<< ;*&*<* '&! %'&;8 ; '<;&8%! ! &8*'&'' 8'*&8! 5"2 G4 ! <''&'' *8& ! + &;* <%&!+ ;*&!<* '&! %**&8; ; '!8&8! 8'&+*'&'' 8*!&' ! ;''&'' *8& ! !;8&<! <!%&8< ;!<& +* '&! % <&!+ ; '8&'8! +<&;!'&'' 8!<& ; ! +''&'' *8& ! <; &!+ <+'&! ;;%& '* '&! %<%&'8 ; ''+& ! !+'&<+'&'' 8+;&+* ! 8''&'' *8& ! ;<8&!' <%'&; ;% & * '&! %8&;% ; %8;&<8! <;<&<''&'' %'8&'< ! %''&'' *8& ! +< & ;**&'* +*+&*<* '&! ! '';& ' ; %;<&8 ! ;;'&! '&'' % %& % ! %*&8+ *8& ! ++!&'% ;*<&!+ +& %* '&! ! '**&!; ; %;*&%! ;8*&*%'&'' %!;&! 5"2 G2 < '''&'' *8& ! 8!8&; ; *&!' +!*&'8* '&! ! '%&%* ; %!<&'8! +<<& ;'&'' %+'&+ < *''&'' *8& ! %! &*% ;<*&+8 +;<&'** '&! ! '< &< ; %!& ! 8<'&%'&'' * ''&'+ < ''&'' *8& < ' 8&* ;+&*+ +88&% * '&! ! '++&* ; %' &<%! %!<& '&'' * ' &!* < 8&< *8& < '+!&!! ;+%&%; +%8&'%* '&! ! '8;&*; ; 8%<&;<! %8*&<!'&'' * '!<&!' 5"2 G < ''&'' *8& < * &'; ;%&<< 8*&8;* '&! ! *''&+! ; 88&8!< '!'&*;'&'' * ';!&+< < !''&'' *8& < +&%% +*&%! 8 ;&+%* '&! ! *!& < ; 8;&'%< * <&'%'&'' * '%;&'% < <''&'' *8& < &% + & 8;'&+* '&! ! *!+&%; ; 8!*& !< '&''&'' * *+&!! < ;''&'' *8& < !*+&8< +< &+* 88!&;!* '&! ! *+*&<+ ; 8'&<%< !&%<'&'' * *<8&+8 < +''&'' *8& < <*&+8 ++!&'% %'8&<+* '&! ! *%<&*8 ; +%%&8!< !*%&88 '&'' * *%'&* < 8''&'' *8& < ;'+&+* +%!&!8 % &<'* '&! ! *8&+% ; ++%&*'< <*!&8*'&'' * *&!; < %''&'' *8& < +'&;! 8*!&8+ %<;&!* '&! ! !&!' ; +<8& << ;'%&+!'&'' * <&8' < %!'&;8 *8& < +!*&; 8 &*; %;;&*;* '&! ! <&'* ; +!%&%*< ;!8& ;'&'' * ;<&<< 5"2 G< ; '''&'' *8& < +%+&<8 8 <&< %8'& <* '&! ! ;;&'* ; + +&;'< +'!&;8 '&'' * 8!&*! ; *''&'' *8& < 8%&<* 8<<&;! * ''!&8* '&! ! 8%&; ; +*;&8<< +%%&;*'&'' * *<&!8 ; ''&'' *8& < %8+&!! 8+;&' * '8&'* '&! ! * & ; ;%;&*'< 8%!&<!'&'' * !;&8 ; ''&'' *8& ; '8& + 8%;&!* * '<&* * '&! ! ;&8! ; ;+<& << %8%&!+'&'' * +8&*+ ; !''&'' *8& ; *++& ' %*;&+% * '+;&';* '&! ! ;'&!< ; ;<!&;'; '8!&!''&'' * !'%&<* ( # ) " # * +,- * . . ! ! $&)#$ /0 "## !$%&%'()*!+, -% !-'! -./01 . 2 /- * !$%&%'()*!+, 1 0 * 3 ! 0 /$ - 0 8$*: < 89: =$0 89: 657. 8$*: / 1 0% 8$*: / 5% 8$*: 617 8$*: $&) , - 0 8$*: +,- $* -" B>? , ; <''&'' *8& ; +& % +&*8 * '%%&%8* '&! ! 8!&'; ; ; &8;; *+%& '&'' * !!'&8< ; <!'&!; *8& ; *'&;! %!<&! * *'%&;;* '&! ! % &;* ; ;<&!;; *+&+!'&'' * !< &< G5"2 GH ; ;''&'' *8& ; ;+&*; %<+&<; * * &%** '&! ! !'+&;+ ; ;* &**; +!&;'&'' * !+&*% ; +''&'' *8& ; !;&'% %++&%< * *!+&8!* '&! ! ! *&8 ; <%& ;; ;%&*%'&'' * <' &< ; +88&<+ *8& ; <!;&*8 %%;&'' * *;%&' * '&! ! !<&*% ; <+ &%8; !< &8 '&'' * < *&% -@7AB>EE?D>A/-BDB?EA+,- ; 8''&'' *8&*8 ; <<+&' %%8& * * *+*&+;*%&8; ! !<!&8% ; <+*&; ; !;!&* &'' * < !&8; ; %''&'' *;&%% ; ;<& ; * '*;&<% * *%<&+8*!&< ! !+8&; ; <<&%%; <<%&!;&'' * <;<&'! ; %%;&%% *;&'' ; +!<& ; * ' *&' * *%&*%**8&;< ! <'*&8* ; < 8&*%; ;<&!;&'' * <%&!; - % + '''&'' *<&%! ; +!8&; * ' *&! * *%&%**8&;8 ! <'&< ; < +&+8; ;<<& ;&'' * <% &8 + '! & % *<&'8 ; +%'&'+ * ' +&'! * '&'8**%&*< ! <*&;' ; < &'; ;%+&*+&'' * ;'!&8' 5->?A/-B>?>A+,- + *''&'' *<&'8 ; 8!!&+ * '!!& * !&%!**%&*< ! <<& < ; <!&;<; +<*&8 '&'' * ;*%&! + ''&'' *<&'8 ; %!*&8 * '<;&8% * ;<&;+**%&*< ! <!+&88 ; <**&; ; 8!8& 8 '&'' * ;!<&< + '&'' *<&'8 ; %+'&< * ';'&;% * +&!8**%&*< ! <<!&;! ; <'+&+; 8++& <'&'' * ;< &'' >FCE7F + ''&'' *<&'8 + ' +&8! * ';%&<; * 88& %**%&*< ! <+'&!* ; !%8&;*; %!!&%!'&'' * ;+*&'8 + !''&'' *<&'8 + * !& % * '8& * **&****%&*< ! <%&% ; !8<&<%+ '!*&!%'&'' * ;%;&%* + <''&'' *<&'8 + '&%< * '%!&%* * &8!**%&*< ! ;*<&!; ; !+&<++ * 8&'<'&'' * +&+< + ;''&'' *<&'8 + +&<* * *'+&<8 * <;&<;**%&*< ! ; +&%8 ; !<%&<<+ !&;*'&'' * +!8&<8 + +''&'' *<&'8 + !!&'; * *'&< * +%&%**%&*< ! ;;'&<* ; !!;&<!+ *&*;'&'' * ++!&!* + 8''&'' *<&'8 + <'&; * * &% * !'&'***%&*< ! ;8 &'! ; ! &<+ !+&+'&'' * 8''&! + 88&%! *<&'8 + <!8&<; * * ;&<% * !'8&<%**%&*< ! ;8%&<; ; !%&+<+ !<<&;;'&'' * 8'+&+* +I;15'1#;14; /<+I + 8!'&++ *<&'8 + <<%&%8 * * 8&'% * !**&8**%&*< ! ;%& ; !8&*+ !;+&'8 '&'' * 8*'&++ +) !+ + %''&'' *<&'8 + ;*+&*+ * *!<&;' * !!&+!**%&*< ! +'<&<; ; !'&<'+ <!&+'&'' * 8;&'+ 8 '''&'' *<&'8 + +* &+ * *<8&+ * !!+&!;**%&*< ! +8&'% ; !'+&!8+ ;'&8 '&'' * 8<*&%' 8 *''&'' *<&'8 + 8*'&8 * *+'&%! * !+'&*%**%&*< ! +<'&; ; %!&!;+ +*+& 8 '&'' * 8++&+ 8 ''&'' *<&'8 + %';&8! * *8 &;* * !%&%***%&*< ! ++ &*! ; 8*&!!+ 8* &%!'&'' * %' &<; 8 ''&'' *<&'8 8 '' & % * *%;&% * <*<&;!**%&*< ! +%<&;+ ; ;8&!+ %*'&!%'&'' * %%& % 8 <'&%* *<&'8 8 '<&<< * '&+! * <+&***%&*< ! 8'+&*! ; ;*&8'+ %<%&;<'&'' * %!&<! +) !+B 8 !''&'' *<&'8 8 '%%&%< * '8&%; * < 8& ;**%&*< ! 8*8&' ; <<&!*8 ''+&'<'&'' * %<<& 8 <''&'' *<&'8 8 *%;&<* * *&; * <;*&'%**%&*< ! 8!'&+ ; !& %8 *' &;*'&'' * %8*&'; 8 ;''&'' *<&'8 8 % &'; * !& * * <8 &8***%&*< ! 8; &< ; %& +8 ''&*;'&'' '';&8% 8 +''&'' *<&'8 8 8%&; * !;&%8 * ;';&< **%&*< ! 88<&++ ; *;& <8 %;&+'&'' ' &+ 8 8''&'' *<&'8 8 !8;&*+ * <%&;< * ;%&;**%&*< ! %'8& ' ; ' & 8 % &+'&'' '<8&<< 8 %''&'' *<&'8 8 <8&+ * +& * ;<*&%8**%&*< ! % '&8 ; %'& *8 !8%&8 '&'' '8!& 8 % '''&'' *<&'8 8 ;+%&8 * 8<&'' * ;+!&+***%&*< ! %< & < ; ++&%8 <8;& 8 '&'' **'&* % *''&'' *<&'8 8 ++<&8! * %+&;+ * ;%+&! **%&*< ! %+<&88 ; ;!&88 ;8&%!'&'' * ;&'! % ''&'' *<&'8 8 8+&!' * *'& ! * +'&*;**%&*< ! %%8&!* ; <*&;8 ++%&<''&'' *;*&8+ % ''&'' *<&'8 8 %;8&%< * &'* * +!&88**%&*< < ''&% ; 8&!8 8+;&'<'&'' *8+&+' ( # ) " # * +,- * . . ! ! $&)#$ /0 "## !$%&%'()*!+, -% !-'! -./01 . 2 /- * !$%&%'()*!+, 1 0 * 3 ! 0 /$ - 0 8$*: < 89: =$0 89: 657. 8$*: / 1 0% 8$*: / 5% 8$*: 617 8$*: $&) , - 0 8$*: +,- $* -" E>?B , % !''&'' *<&'8 % ';<&<* * <&;% * +;<&;***%&*< < '! &!; ; <&8 %+&;*'&'' * &<! % <''&'' *<&'8 % *;&'; * !8& ; * +88& **%&*< < ';<&%8 ; *&'% ';%&*;'&'' %& + % ;''&'' *<&'8 % <8&; * ;*&' * 8**&';**%&*< < '88&<* ; *%%&*8% *;<&+'&'' ;<&' % +''&'' *<&'8 % <<&*+ * + &+* * 8 &+8**%&*< < ***&'! ; *8;&*;% ;&+'&'' %*&' % 8''&'' *<&'8 % !<*&+ * 8;& 8 * 8<;&<***%&*< < * &<; ; *+ &*<% <8&8 '&'' *;&8; % 88 & % *<&'8 % < &< * %;&%< * 8+<&!;**%&*< < *<& < ; *;&%% ! %& <'&'' 8&!' -@7AEE?A/-D?DA+,- % %''&'' *!&+< % <!8& ' * %%&' * 8+%&*%**%&* < *<;&'< ; *;'&*<% !<<&!'&'' !&;! *' '''&'' *&+< % ;!<&! * !*'&<8 * 8%%&%;**%&'! < *+;&;! ; *!8&8% <<&< &'' ;;&! *' *''&'' *'&+< % +! & * !'&!< * %*+&++**8&% < *%!&% ; * 8&*!% ;<'&! &'' 8;&!! *' ''&'' 8&+< % 8!*&88 * !8&; * % &;'**8&+! < '%&'' ; *%&+<% +!8&%8 &'' !' &! *' +&<' 8&'' % 8+8&%8 * ! *&! * % +& %**8&;< < * &+< ; *+&'<% +8;&'8 &'' !'8&;; 5->?DA/-E>E?EA+,- - % *' ''&'' 8&'' % %!'&8+ * ! <&!* * %!<&' **8&;< < *& ; *&+;% 8!+&%+'&'' !*+&% *' !''&'' 8&'' *' ' %&%' * !!&'8 * %<+&!**8&;< < &! ; **<&%'% %!+&'''&'' ! *&'% *' <''&'' 8&'' *' * 8&% * !!8&+; * %;%&!<**8&;< < !<&<! ; *'%&'<*' '!;&''&'' !!!&8% *' <!*&+ 8&'' *' *8'&! * !<*&<! * %+!&<<**8&;< < <'&<% ; *';&*8*' '8+& !'&'' !<'&;< +) !+ *' ;''&'' 8&'' *' +&%< * !<<&! * %8*&;+**8&;< < <+&;! ; *'&*%*' *!<&'<'&'' !<8&;% *' +''&'' 8&'' *' ;&%8 * !;&*' * %% &88**8&;< < ;%&+< ; '%<& *' !!&'8 '&'' !+&!% *' 8''&'' 8&'' *' ! ;&'' * !;8&+8 '';&'%**8&;< < 8*&8; ; '88&!+*' ! &*''&'' !8;& ' *' %''&'' 8&'' *' < <&' * !+<&!< '*8& ***8&;< < % &%+ ; '8*&;**' !!&* '&'' <''&*' ** '''&'' 8&'' *' ; !&'; * !8&* ' '&<**8&;< < ';&'8 ; '+!&+<*' <!*&*;'&'' <* &%' ** *''&'' 8&'' *' + &'8 * !88&+% '!&+ **8&;< < *8&*% ; ';+&8%*' ;!'&*8 '&'' <+&+' ** *%%&+% 8&'' *' 8 *&%' * !%<&!< '<!&%**8&;< < '&+ ; ';*&'<*' + %&'''&'' <!*&!+ +) !+D ** ''&'' 8&'' *' 8 &** * !%<&!+ '<!&%<**8&;< < '& ' ; ';*&'!*' + %&*'&'' <!*&<' ** '&% 8&'' *' 8 <&'' * !%<&;; '<<& '**8&;< < '&;< ; ';'&8 *' +!&*''&'' <!*&%' + - 0?A/-EDA+,- +%1 07% 0 +,- 8$*: 1 0% 8$*: 5% 8$*: 617 8$*: 657. 8$*: +% - % 89: - -? 89: 2-*% 8+8&%8 ; *+&'< < * &+<* ! *&! * % +& %'&'' <%&* ? 2-**; +!<& ; ; < 8&*% ! <'*&8** ' *&' * *%&*%'&'' <%&* ? ( # ) " # * +,- * . . ! ! $&)#$ /0 "## !$%&%'()*!+, -% !-'! -./01 . 2 /- * !$%&%'()*!+, 1 0 * 3 ! 0 , - 0 8$*: /$ - 0 8$*: #% - 8F: - 8F:1 #% +9@8*:9; %+'&<+ '&''+8*: !*:9@;*:89*' 8 <&''** '&%!*: ;*:8 %<:89@* *:9 *<&'' +%&< %<:8 * *: /$ - 0 8$*: , - 0 8$*: - - 89:1 "0 %) - 89: 4 , - 0 < 8&< < '+!&!! 4> A + 8!'&++ + <<%&%8 0B0 ! * &;* ! '<&+% 4> A4 &<' ;<&8 04C.>A *' <!*&+ *' *8'&! 0B0*% %* &'+ 8*;&! 4> A2 ; <!'&!; ; *'&;! A4> AD ;++& <%&; 04C.>A <*& * !!!&< 04C.>A + 88&%! + <!8&<; 0E/.4./.F/"C0E ! %*&8+ ! ++!&'% 4> A> < %!'&;8 < +!*&; 4> AC < +&;* <*'&;% @ ** *%%&+% *' 8 *&%' 0B0< ! !;*&* ! ;&+* 4> AF 8 <'&%* 8 '<&<< 0B0; /$ - 0 8$*: , - 0 8$*: 657. 8$*: 617 8$*: " # # * ;''&'' * ;''&'' '&'' '&'' 2 G:*''=*;''="2 *;''=0H2 *'&;% ''& ;&+8 + &;% 42*'&;%="2 ''& =0H2 ; +88&<+ ; <!;&*8 %%;&'' * *;%&' 2G:*''=;+88&<+="2 ;<!;&*8=0H2 + '! & % ; +%'&'+ * ' +&'! * '&'8 42+'! & %="2 ;+%'&'+=0H2 % 88 & % % < &< * %;&%< * 8+<&!; 2G:*''=%88 & %="2 %< &<=0H2 *' +&<' % 8+8&%8 * ! *&! * % +& % 42*' +&<="2 %8+8&%8=0H2 ** '&% *' 8 <&'' * !%<&;; '<<& ' 0 2?**'&%="2 *'8 <=0H2 !"#$#% &"' &"' &"'(')*% !"#$"#% &"'" &"'" &"'(' +&*#, *-+$)./$%0&&123435&&240'6-07804'951780429/.* +% &"':4 )-'3. %44 )4; $*+4 <%141 $%6 $ $4= )) $4;,6 4 ) !"#"$ $ >% >%%& )#% &"'" &"'('/5"/5"*:; $*+- ).; *- ).6 - ).:; $*+ )= $ $4= )) $4;,6 4 ) 5 %44 )4; $*+4 +&*#, *-+$).)*% !"#$"#% &"'" &"'" &"'('; $*+- ). $; / '"()('"()('"() *+&+, -"&.* ,&. -"+&+ /&,.-"&.*0 ('"()('"()('"() *+&) -%& ,&, -,&" /&).-%& ('"()('"()('"() *+&* -%& ,&+% -%"&+% /&".-%&0 ('"()('"()('"() "*+&, "*&% ",,&, &// +&%/)"*&%0 ('"()('"()('"() "*+&, %& ",,&, .& +&%,%& ('"()('"()('"() *&"/ "-.,%& "."&,+ "-./%&/ "&/,)"-.,%&0 ('+(+('+(+('+(+ ).&"% .*/&, +,&+/ ..*&* )&"/*.*/&, ('+(+('+(+('+(+ ).&+ "-& +,&)% "-""&%, )&"%%"-&0 ( !"#$'"()('"()('"() *%&,+ "-.,+&%/ ,)& "-.,/&," ,&)+/"-.,+&%/0 ('"()('"()('"() *%&,+ "-.,%& ,)&". "-.,*&" ,&)+""-.,%& ('"()('"()('"() *,&. -%& ,%&+ -%"&+* ,&./-%&0 ('"()('"()('"() ",.&)) "*&% ",,&)* &/, ."&+*)"*&% ('"()('"()('"() "&"% -& ".,&"/ "-.*,&** ")&"%/-&0 ('()('()('() %"&). /&*+ )*&% /&%+ ",&+)/&*+0 ('()('()('() %& )& )*&"* +..&+) "+&%.")& ('()('()('() %,&*% %%& %+&+ %)%&+* "&"%%%&0 ('+(+('+(+('+(+ )+&) .,+&* ++&. .*)&./ )&,"..,+&*0 ('+(+('+(+('+(+ )+&) .,%& ++&." .*/&/ )&,".,%& ('+(+('+(+('+(+ )+&, "-& +)&) "-"&)/ )&,""-&0 ( )#% &"'" &"'(' =- ).>- ). ?# >"*&% +-*& '+()) +123!4! 5+-*& ,-+& '+()) +123!4! 5,-+& ""-&. '+()) +123!4! 5 6 7 89(& 7 :&0 7 7 $ &0 ; $#< $( =& 5 :: & 7 75267607 8 7 6& 0.001.002.003.004.00Separation Factor0 750 1500 2250 3000 3750 4500 5250 6000 6750 7500 8250 9000 9750 10500 11250 12000 12750 13500 14250Measured Depth (1500 usft/in)BRU 232-23No-Go Zone - Stop DrillingCollision Avoidance RequiredCollision Risk Procedures Req.NOERRORSWELL DETAILS:Plan: BRU 223-24 NAD 1927 (NADCON CONUS)Alaska Zone 0474.40+N/-S +E/-W Northing EastingLatitudeLongitude0.000.002633587.72 323298.64 61° 12' 16.4856 N 151° 0' 6.9819 WREFERENCE INFORMATIONCo-ordinate (N/E) Reference:Well Plan: BRU 223-24, True NorthVertical (TVD) Reference: BRU 223-24 @ 92.90usft (147)Measured Depth Reference:BRU 223-24 @ 92.90usft (147)Calculation Method:Minimum CurvatureSURVEY PROGRAMDate: 2021-06-02T00:00:00 Validated: Yes Version: Depth From Depth To Survey/PlanTool18.50 3280.00 BRU 223-24 wp04 (BRU 223-24) 3_MWD+AX+Sag3280.00 7230.00 BRU 223-24 wp04 (BRU 223-24) 3_MWD+AX+Sag7230.00 11202.92 BRU 223-24 wp04 (BRU 223-24) 3_MWD+AX+Sag0.0030.0060.0090.00120.00150.00180.00Centre to Centre Separation (60.00 usft/in)0 750 1500 2250 3000 3750 4500 5250 6000 6750 7500 8250 9000 9750 10500 11250 12000 12750 13500 14250Measured Depth (1500 usft/in)BRU 212-24BRU 232-23BRU 212-24BRU 212-24TBRU 222-24BRU 232-23GLOBAL FILTER APPLIED: All wellpaths within 200'+ 100/1000 of reference18.50 To 11202.92Project: Beluga RiverSite: BRU K-PadWell: Plan: BRU 223-24Wellbore: BRU 223-24Plan: BRU 223-24 wp04CASING DETAILSTVD TVDSS MD Size Name3215.00 3122.10 3279.53 9-5/8 9 5/8" X 13 1/2"6970.25 6877.35 7230.00 7 7" X 8 1/2"10835.00 10742.10 11202.92 4-1/2 4 1/2" X 6 1/8" 1 Carlisle, Samantha J (CED) From:Frank Roach <Frank.Roach@hilcorp.com> Sent:Friday, September 24, 2021 11:40 AM To:McLellan, Bryan J (CED) Subject:RE: [EXTERNAL] FW: BRU 223-24 Choke side outlets Bryan, Justconfirmedourmudcrosssideoutletsare3Ͳ1/8”. Regards, FrankVRoach DrillingEngineer 907.854.2321(c) 907.777.8413(o) From:McLellan,BryanJ(CED)<bryan.mclellan@alaska.gov> Sent:Friday,September24,202110:09 To:FrankRoach<Frank.Roach@hilcorp.com> Subject:RE:[EXTERNAL]FW:BRU223Ͳ24Chokesideoutlets Soundsgood,thanks. Theyneedtobeminimum3”outletsfor>3000psiMPSP. Welcomeback.Howdidtheracego? BryanMcLellan SeniorPetroleumEngineer AlaskaOil&GasConservationCommission 333W7thAve Anchorage,AK99501 Bryan.mclellan@alaska.gov +1(907)250Ͳ9193 From:FrankRoach<Frank.Roach@hilcorp.com> Sent:Friday,September24,202110:08AM To:McLellan,BryanJ(CED)<bryan.mclellan@alaska.gov>;JosephEngel<jengel@hilcorp.com> Subject:RE:[EXTERNAL]FW:BRU223Ͳ24Chokesideoutlets Bryan, I’mbacksir.Chokevalvesare3Ͳ1/8”.I’mgettingconfirmationonthemudcrosssideoutlets. Fortiming,we’relookingatstartingaroundOct.10. AssoonasIgetconfirmationonthemudcrosssideoutletsizes,I’llletyouknow. Regards, 2 FrankVRoach DrillingEngineer 907.854.2321(c) 907.777.8413(o) From:McLellan,BryanJ(CED)<bryan.mclellan@alaska.gov> Sent:Friday,September24,202109:01 To:JosephEngel<jengel@hilcorp.com> Cc:FrankRoach<Frank.Roach@hilcorp.com> Subject:[EXTERNAL]FW:BRU223Ͳ24Chokesideoutlets Joe, CouldyouanswerthequestionbelowinFrank’sabsence.That’sthelastbitofinfoI’mwaitingforbeforeapprovingthe PTD. Whenisyouranticipatedstartdateforthiswell? Thanks BryanMcLellan SeniorPetroleumEngineer AlaskaOil&GasConservationCommission 333W7thAve Anchorage,AK99501 Bryan.mclellan@alaska.gov +1(907)250Ͳ9193 From:McLellan,BryanJ(CED) Sent:Tuesday,September21,20215:57PM To:FrankRoach<Frank.Roach@hilcorp.com> Subject:BRU223Ͳ24Chokesideoutlets Frank, WhatisthesizeofthesideoutletsandvalvesonyourchokesideofthemudcrossontheBOPstackinthiswell? Thanks BryanMcLellan SeniorPetroleumEngineer AlaskaOil&GasConservationCommission 333W7thAve Anchorage,AK99501 Bryan.mclellan@alaska.gov +1(907)250Ͳ9193 The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. No responsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. 1 Carlisle, Samantha J (CED) From:McLellan, Bryan J (CED) Sent:Wednesday, September 22, 2021 10:34 AM To:Benjamin Siks Cc:Trudi Hallett; Frank Roach Subject:RE: [EXTERNAL] BRU 223-24 pore pressure Ben, Thanksforthatinfo.The500’TVDstandoffseemslikeagoodbufferinthiscase. Regards. BryanMcLellan SeniorPetroleumEngineer AlaskaOil&GasConservationCommission 333W7thAve Anchorage,AK99501 Bryan.mclellan@alaska.gov +1(907)250Ͳ9193 From:BenjaminSiks<bsiks@hilcorp.com> Sent:Wednesday,September22,20219:47AM To:McLellan,BryanJ(CED)<bryan.mclellan@alaska.gov> Cc:TrudiHallett<thallett@hilcorp.com>;FrankRoach<Frank.Roach@hilcorp.com> Subject:FW:[EXTERNAL]BRU223Ͳ24porepressure Hi Bryan, There is a pressure ramp directly associated with the Tyonek C unconformity. The sands between the T25 and Tyonek C did not see any abnormal pressures when drilled in the past. We are drilling between BRU 224-13 and BRU 14-19 at this depth, which both drilled through and observed this ramp in pressure in the immediate area. These wells also provide us with a good sense check for tops conformability. At most our uncertainty on the T25 top is +/- 200’ TVD, thus by doubling our stand off and adding at bit extra to get to 560’ TVD standoff, we should be well above that pressure ramp. We will also be correlating as we drill in the event that our tops begin coming in significantly higher, we will adjust TD accordingly to avoid approaching Tyonek C and aiming to give ourselves the ~500’ standoff. Cheers, Ben Ben Siks Geologist – Kenai Asset Team Office – 907-777-8388 Cell –----907-229-0865 bsiks@hilcorp.com 2 From:McLellan,BryanJ(CED)<bryan.mclellan@alaska.gov> Sent:Wednesday,September22,20218:26AM To:JeffNelsonͲ(C)<Jeff.Nelson@hilcorp.com>;MeredythRichards<Meredyth.Richards@hilcorp.com> Cc:FrankRoach<Frank.Roach@hilcorp.com> Subject:[EXTERNAL]BRU223Ͳ24porepressure HiJeff,Meredyth SinceFrankisout,I’msendingthisreservoirpressurequestiondirectlytoyou. ItlookslikethereisaveryabruptpressuretransitionbetweentheTyonekT25(4767psi)andtheTyonekC(8207psi), whichhaveonly560’TVDseparationinBRU223Ͳ24.IfthedepthprognosisfortheTyonekCisoff,youcoulddrillintoa zonethatyour5000psiBOPsarenotsuitedfor.WhatisthecertaintylevelfortheTopTyonekCandarethereany sandsbetweenT25andTyonekCthatcouldhaveabnormalpressures? Thankyou BryanMcLellan SeniorPetroleumEngineer AlaskaOil&GasConservationCommission 333W7thAve Anchorage,AK99501 Bryan.mclellan@alaska.gov +1(907)250Ͳ9193 The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you are hereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly and permanently delete this message. Revised 2/2015 TRANSMITTAL LETTER CHECKLIST WELL NAME: ______________________________________ PTD: _____________________________________________ ___ Development ___ Service ___ Exploratory ___ Stratigraphic Test ___ Non-Conventional FIELD: ____________________________ POOL: ______________________________________ Check Box for Appropriate Letter / Paragraphs to be Included in Transmittal Letter CHECK OPTIONS TEXT FOR APPROVAL LETTER MULTI LATERAL (If last two digits in API number are between 60-69) The permit is for a new wellbore segment of existing well Permit No. _____________, API No. 50-_______________________. Production should continue to be reported as a function of the original API number stated above. Pilot Hole In accordance with 20 AAC 25.005(f), all records, data and logs acquired for the pilot hole must be clearly differentiated in both well name (_______________________PH) and API number (50-_____________________) from records, data and logs acquired for well (name on permit). Spacing Exception The permit is approved subject to full compliance with 20 AAC 25.055. Approval to produce/inject is contingent upon issuance of a conservation order approving a spacing exception. (_____________________________) as Operator assumes the liability of any protest to the spacing exception that may occur. Dry Ditch Sample All dry ditch sample sets submitted to the AOGCC must be in no greater than 30' sample intervals from below the permafrost or from where samples are first caught and 10' sample intervals through target zones. Non- Conventional Well Please note the following special condition of this permit: Production or production testing of coal bed methane is not allowed for well ( ) until after ( ) has designed and implemented a water well testing program to provide baseline data on water quality and quantity. (________________________) must contact the AOGCC to obtain advance approval of such water well testing program. Well Logging Requirements Regulation 20 AAC 25.071(a) authorizes the AOGCC to specify types of well logs to be run. In addition to the well logging program proposed by (_______________________________) in the attached application, the following well logs are also required for this well: Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071, composite curves for well logs run must be submitted to the AOGCC within 90 days after completion, suspension or abandonment of this well. Beluga River Unit 223-24 Hilcorp 221-072 Beluga River, Tyonek Undefined GasBeluga River WELL PERMIT CHECKLISTCompanyHilcorp Alaska, LLCWell Name:BELUGA RIV UNIT 223-24Initial Class/TypDEV / PENDGeoArea820Unit50220On/Off ShoreOnProgramDEVField & PooWell bore segAnnular DisposalPTD#:2210720BELUGA RIVER, TYON UNDEF GAS - 92550NA17 Nonconven. gas conforms to AS31.05.030(j.1.A),(j.2.A-D)NA1 Permit fee attachedYes Entire well in ADL0021128; Designation of Operator form filed by CEA effective 4/22/20162 Lease number appropriateYes includes lease ADL 0021128.3 Unique well name and numberNo Target is the Tyonek Formation, which here is an undefined gas pool.4 Well located in a defined poolNo Vertically segmented lease with boundary at 7000' depth; spacing exception required for perforations within5 Well located proper distance from drilling unit boundaryYes 1500' of that boundary. No other wells capable of producing from Tyonek nearby, but if well6 Well located proper distance from other wellsYes is completed in overlying Sterling/Beluga Undefined gas pool, exception will be needed.7 Sufficient acreage available in drilling unitYes8 If deviated, is wellbore plat includedNo9 Operator only affected partyYes10 Operator has appropriate bond in forceNo SPACING EXCEPTION REQUIREDDue to proximity to vertical lease boundary and other development11 Permit can be issued without conservation orderYes wells in the Sterling/Beluga Und Gas Pool.12 Permit can be issued without administrative approvalYes13 Can permit be approved before 15-day waitNA14 Well located within area and strata authorized by Injection Order # (put IO# in comments) NA15 All wells within 1/4 mile area of review identified (For service well only)NA16 Pre-produced injector: duration of pre-production less than 3 months (For service well onlYes18 Conductor string providedYes19 Surface casing protects all known USDWsYes20 CMT vol adequate to circulate on conductor & surf csgYes21 CMT vol adequate to tie-in long string to surf csgYes Entire well planned to be cemented.22 CMT will cover all known productive horizonsYes23 Casing designs adequate for C, T, B & permafrostYes24 Adequate tankage or reserve pitNA25 If a re-drill, has a 10-403 for abandonment been approvedYes26 Adequate wellbore separation proposedYes27 If diverter required, does it meet regulationsYes28 Drilling fluid program schematic & equip list adequateYes29 BOPEs, do they meet regulationYes Rated to 5000 psi. Initial test to RWP. Subsequent test to 4000 psi.30 BOPE press rating appropriate; test to (put psig in comments)Yes31 Choke manifold complies w/API RP-53 (May 84)Yes32 Work will occur without operation shutdownNo33 Is presence of H2S gas probableNA34 Mechanical condition of wells within AOR verified (For service well only)Yes No H2S anticipated, but rig will have sensors and alarms, and mudloggers will be employed below the35 Permit can be issued w/o hydrogen sulfide measuresYes surface casing shoe. Under pressure to normal pressure expected down to TD at 11,203' MD. Below Tyonek C36 Data presented on potential overpressure zonesNA unconformity at ~11,400' MD, abrupt pressure transition occurs from 8.5 to 13.9 ppg EMW. Drilling Hazards37 Seismic analysis of shallow gas zonesNA discussion indicates crew will maintain a high kick-detection alert while drilling the production section.38 Seabed condition survey (if off-shore)NA39 Contact name/phone for weekly progress reports [exploratory only]ApprSFDDate9/27/2021ApprBJMDate9/24/2021ApprSFDDate9/27/2021AdministrationEngineeringGeologyGeologic Commissioner:Date:Engineering Commissioner:DatePublic CommissionerDateWell will be mudlogged and sampled while drilling from the surface casing shoe to total depth. SFD-03JLC 10/8/2021