Department of Commerce, Community, and Economic Development
Alaska Oil and Gas Conservation
Commission
HOME
EVENTS
DATA
Data List
Drilling
Production
Orders
Data Miner
Document Search
REPORTS
Reports and Charts
Pool Statistics
FORMS
LINKS
Links
Test Notification
Data Requests
Regulations
Industry Guidance Bulletins
How to Apply
ABOUT US
History
Staff
HELP
Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
222-150
DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No We l l L o g I n f o r m a t i o n : Di g i t a l Me d / F r m t Re c e i v e d St a r t S t o p OH / CH Co m m e n t s Lo g Me d i a Ru n No El e c t r Da t a s e t Nu m b e r Na m e In t e r v a l Li s t o f L o g s O b t a i n e d : GR , R E S , D E N , D I R , A Z I , P W D , N E U , P O R , S O N I C No No Ye s Mu d L o g S a m p l e s D i r e c t i o n a l S u r v e y RE Q U I R E D I N F O R M A T I O N (f r o m M a s t e r W e l l D a t a / L o g s ) DA T A I N F O R M A T I O N Lo g / Da t a Ty p e Lo g Sc a l e DF 3/ 3 / 2 0 2 3 24 0 1 9 5 1 8 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ C O M P _ M E M . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 1 _ M E M _ A P - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 2 _ M E M _ A P - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 3 _ M E M _ A P - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 4 _ M E M _ A P - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 5 _ M E M _ A P - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 6 _ M E M _ A P - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 1 _ M E M _V S S - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 2 _ M E M _V S S - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 3 _ M E M _V S S - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 4 _ M E M _V S S - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 5 _ M E M _V S S - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ R U N 0 6 _ M E M _V S S - L O G _ T I M E . l a s 37 5 2 8 ED Di g i t a l D a t a Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 1 o f 7 CP A I _ M T 7 - , 97_ CO MP _ M E M . l a s DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No DF 3/ 3 / 2 0 2 3 0 1 9 5 1 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ V S S - D E P _ C O M P _ M E M . l a s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 _ B a k e r MW D _ L W D _ D i s t r i b u t i o n A O G C C . d o c x 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 01 _ M E M _ A P - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 02 _ M E M _ A P - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 03 _ M E M _ A P - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 04 _ M E M _ A P - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 05 _ M E M _ A P - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 06 _ M E M _ A P - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 01 _ M E M _ V S S - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 02 _ M E M _ V S S - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 03 _ M E M _ V S S - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 04 _ M E M _ V S S - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 05 _ M E M _ V S S - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ R U N 06 _ M E M _ V S S - L O G _ T I M E . a s c 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 _ m e m _ L T K _ R 6 _ I M G . d l i s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 97 _ m e m _ L T K _ R 6 _ L M G 1 0 0 _ 0 2 4 0 s c l . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 97 _ m e m _ L T K _ R 6 _ L M G 1 0 0 _ 0 2 4 0 s c l . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 _ m e m _ S T K _ R 6 _ I M G . d l i s 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 97 _ m e m _ S T K _ R 6 _ L M G 1 0 0 _ 0 0 4 8 s c l . c g m 37 5 2 8 ED Di g i t a l D a t a Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 2 o f 7 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 97 _ m e m _ S T K _ R 6 _ L M G 1 0 0 _ 0 0 4 8 s c l . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 97 _ m e m _ S T K _ R 6 _ L M G 1 0 0 _ 0 2 4 0 s c l . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 97 _ m e m _ S T K _ R 6 _ L M G 1 0 0 _ 0 2 4 0 s c l . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 2 M D _ C O M P _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 2 T V D _ C O M P _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 5 M D _ C O M P _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 5 T V D _ C O M P _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ A P - TI M E _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ V S S - DE P _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ V S S - TI M E _ M E M . c g m 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 2 M D _ C O M P _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 2 T V D _ C O M P _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 5 M D _ C O M P _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ 5 T V D _ C O M P _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ A P - TI M E _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ V S S - DE P _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 9 7 _ V S S - TI M E _ M E M . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 N A D 2 7 D e f i n i t i v e Su r v e y s . p d f 37 5 2 8 ED Di g i t a l D a t a Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 3 o f 7 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 N A D 2 7 D e f i n i t i v e Su r v e y s . t x t 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 N A D 8 3 D e f i n i t i v e Su r v e y s . p d f 37 5 2 8 ED Di g i t a l D a t a DF 3/ 3 / 2 0 2 3 E l e c t r o n i c F i l e : M T 7 - 9 7 N A D 8 3 D e f i n i t i v e Su r v e y s . t x t 37 5 2 8 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 91 9 0 9 5 5 1 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 9 7 vi v i d _ r u n 1 _ p a s s 1 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 0 5 3 1 2 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 9 7 vi v i d _ r u n 1 _ p a s s 1 0 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 95 5 3 9 2 0 5 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 9 7 vi v i d _ r u n 1 _ p a s s 2 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 0 2 2 1 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 9 7 vi v i d _ r u n 1 _ p a s s 4 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 0 7 1 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 9 7 vi v i d _ r u n 1 _ p a s s 6 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 0 7 9 8 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 9 7 vi v i d _ r u n 1 _ p a s s 9 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 95 3 5 9 1 9 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : m t 7 - 97 _ v i v i d _ r u n 1 _ p a s s 5 . l a s 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 E l e c t r o n i c F i l e : 2 0 2 3 - 0 3 - 1 0 _ 2 2 0 8 5 _ G M T U _ M T 7 - 97 _ A r c h e r V i v i d A c o u s t i c L D L _ T r a n s m i t t a l . d o c x 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 E l e c t r o n i c F i l e : G M T U _ M T 7 - 9 7 _ 1 0 - M a r - 23 _ A r c h e r V i v i d A c o u s t i c L D L . p d f 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 E l e c t r o n i c F i l e : G M T U _ M T 7 - 9 7 _ 1 0 - M a r - 23 _ A r c h e r V i v i d A c o u s t i c L D L . t i f 37 5 6 3 ED Di g i t a l D a t a DF 3/ 2 0 / 2 0 2 3 E l e c t r o n i c F i l e : K R U _ M T 7 - 9 7 _ 1 0 m a r 2 0 2 3 _ V I V I D Le a k _ R e p o r t . p d f 37 5 6 3 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 35 0 0 9 8 2 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ T O C _ L A S _ R M . l a s 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 1 0 0 0 M D _ R M . P d f 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 2 0 0 M D _ R M . p d f 37 6 4 4 ED Di g i t a l D a t a Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 4 o f 7 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 4 0 0 0 M D _ R M . p d f 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 4 0 0 0 M D _ R M _ L a b e l e d . P d f 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 5 0 0 M D _ R M . p d f 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 6 0 0 0 M D _ R M . P d f 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ 8 0 0 0 M D _ R M . P d f 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ R M _ T O C _ 3 5 0 0 f t _ 9 7 7 5 f t _ P P T . p p t .p p t x 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ T O C _ D L I S _ R M . d l i s 37 6 4 4 ED Di g i t a l D a t a DF 5/ 1 6 / 2 0 2 3 E l e c t r o n i c F i l e : GM T U _ M T 7 _ 9 7 _ R 1 _ 9 . 6 2 5 i n _ a n d _ 7 i n _ c a s i n g s _ S on i c S c o p e 4 7 5 _ T O C _ D L I S _ R M . h t m l 37 6 4 4 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 93 3 8 9 5 9 5 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ C H C _ 4 A p r i l 2 3 _ S h o o t _ C o n C u _ R 0 1 _ L 0 0 3 U p _ CU T T E R _ U P C T _ E R S _ P E H . l a s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 93 2 4 9 5 9 4 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 97 _ C H C _ 4 A p r i l 2 3 _ T i e I n _ C o n C u _ R 0 1 _ L 0 0 4 U p _ C UT T E R _ U P C T _ E R S _ P E H . l a s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 90 2 6 9 5 6 4 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ 1 5 b b l s _ P u m p e d _ D o w n P a s s _ Co n C u _ R 0 2 _ L 0 2 1 D o w n _ P F C S _ P I L S _ P S T P _ W I Re D _ P E H . l a s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 90 6 2 9 5 5 6 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ 1 9 b b l s _ P u m p e d _ C o n C u _ R 0 2 _L 0 2 3 D o w n _ P F C S _ P I L S _ P S T P _ W I R e D _ P E H . l a s 38 4 3 2 ED Di g i t a l D a t a Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 5 o f 7 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No We l l C o r e s / S a m p l e s I n f o r m a t i o n : Re c e i v e d St a r t S t o p C o m m e n t s To t a l Bo x e s Sa m p l e Se t Nu m b e r Na m e In t e r v a l DF 1/ 1 9 / 2 0 2 4 91 4 8 9 5 5 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ I n t i a l _ D o w n P a s s _ C o n C u _ R 0 2 _L 0 0 3 D o w n _ P F C S _ P I L S _ P S T P _ W I R e D _ P E H . l a s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 90 2 6 9 5 6 4 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ T e m p O v e r l a y _ C o n C u _ T e m p e ra t u r e _ O v e r l a y _ P F C S _ P I L S _ P S T P _ W I R e D _ P E H .l a s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ C H C _ 4 A p r i l 2 3 _ S h o o t _ C o n C u _ R 0 1 _ L 0 0 3 U p _ CU T T E R _ U P C T _ E R S _ P E H . d l i s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ C H C _ 4 A p r i l 2 3 _ T i e I n _ C o n C u _ R 0 1 _ L 0 0 4 U p _ C UT T E R _ U P C T _ E R S _ P E H . d l i s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : C P A I _ M T 7 - 97 _ C H C _ 4 A p r i l 2 3 _ F i e l d P r i n t . P d f 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ 1 5 b b l s _ P u m p e d _ D o w n P a s s _ Co n C u _ R 0 2 _ L 0 2 1 D o w n _ P F C S _ P I L S _ P S T P _ W I Re D _ P E H . d l i s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ 1 9 b b l s _ P u m p e d _ C o n C u _ R 0 2 _L 0 2 3 D o w n _ P F C S _ P I L S _ P S T P _ W I R e D _ P E H . d l i s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ I n t i a l _ D o w n P a s s _ C o n C u _ R 0 2 _L 0 0 3 D o w n _ P F C S _ P I L S _ P S T P _ W I R e D _ P E H . d l i s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : M T 7 - 97 _ L D L _ 0 9 M a r 2 3 _ T e m p O v e r l a y _ C o n C u _ T e m p e ra t u r e _ O v e r l a y _ P F C S _ P I L S _ P S T P _ W I R e D _ P E H .d l i s 38 4 3 2 ED Di g i t a l D a t a DF 1/ 1 9 / 2 0 2 4 E l e c t r o n i c F i l e : M T 7 - 96 _ L D L _ 0 9 M a r 2 3 _ F i e l d P r i n t . P d f 38 4 3 2 ED Di g i t a l D a t a Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 6 o f 7 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 4 9 - 0 0 - 0 0 We l l N a m e / N o . GM T U M T 7 - 9 7 Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 3/ 1 / 2 0 2 3 Pe r m i t t o D r i l l 22 2 1 5 0 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 19 5 1 7 TV D 85 2 0 Cu r r e n t S t a t u s 1- O I L 9/ 4 / 2 0 2 5 UI C No IN F O R M A T I O N R E C E I V E D Co m p l e t i o n R e p o r t Pr o d u c t i o n T e s t I n f o r m a t i o n Ge o l o g i c M a r k e r s / T o p s Y Y / N A Y Co m m e n t s : Co m p l i a n c e R e v i e w e d B y : Da t e : Mu d L o g s , I m a g e F i l e s , D i g i t a l D a t a Co m p o s i t e L o g s , I m a g e , D a t a F i l e s Cu t t i n g s S a m p l e s Y / N A Y Y / N A Di r e c t i o n a l / I n c l i n a t i o n D a t a Me c h a n i c a l I n t e g r i t y T e s t I n f o r m a t i o n Da i l y O p e r a t i o n s S u m m a r y Y Y / N A Y Co r e C h i p s Co r e P h o t o g r a p h s La b o r a t o r y A n a l y s e s Y / N A Y / N A Y / N A CO M P L I A N C E H I S T O R Y Da t e C o m m e n t s De s c r i p t i o n Co m p l e t i o n D a t e : 3/ 1 / 2 0 2 3 Re l e a s e D a t e : 1 2 / 1 6 / 2 0 2 2 Th u r s d a y , S e p t e m b e r 4 , 2 0 2 5 AO G C C P a g e 7 o f 7 M. G u h l 9/ 5 / 2 0 2 5 TT RR AA NN SS MM II TT TT AA LL FROM::Sandra D. Lemke, ATO-704 TO:: Meredith Guhl ConocoPhillips Alaska, Inc. AOGCC P.O. Box 100360 330 W. 7 th Ave., Suite 100 Anchorage AK 99510-0360 Anchorage, Alaska 99501 RE: Schlumberger Wireline Backlog – Mooses Tooth DATE: 12/19/2023 Transmitted: North Slope, Mooses Tooth Unit Via hard drive data drop MT7-96 50-103-20834-00 221100_MT7-96_ChemCut_06Nov2022 221100_MT7-96_LDL_05Nov2022 221100_MT7-96_PlugShoot_08Oct2022 221100_MT7-96_PlugShoot_26Dec2022 221100_MT7-96_Plug_04Nov2022 221100_MT7-96_PPROF_08Mar2023 221100_MT7-96_PPROF_18Aug23 221100_MT7-96_PPROF_27Jul22 221100_MT7-96_Puncher_06Nov2022 MT7-97 50-103-20849-00 222150_MT7-97_CHC_04Apr2023 222150_MT7-97_LDL_09Mar2023 MT7-98 50-103-20843-00 222081_MT7-98_PPROF_10Dec2022 MT7-99 50-103-20845-00 222102_MT7-99_PPROF_15Dec2022 3of 3 Transmittall instructions: please promptly sign, scan, and e-mail to Sandra.D.Lemke@conocophillips.com Receipt: Date: Alaska/IT-Support Services GGRE |ConocoPhillips Alaska |Office: 907.265.6947; Mobile 907.440.4512 T38431 T38432 T38433 T38434 2/29/2024 MT7-97 50-103-20849-00 222150_MT7-97_CHC_04Apr2023 222150_MT7-97_LDL_09Mar2023 Kayla Junke Digitally signed by Kayla Junke Date: 2024.02.29 11:03:29 -09'00' 1. Operations Susp Well Insp Plug Perforations Fracture Stimulate Pull Tubing Operations shutdown Performed: Install Whipstock Perforate Other Stimulate Alter Casing Change Approved Program Mod Artificial Lift Perforate New Pool Repair Well Coiled Tubing Ops Other: ______________________ Development Exploratory 3. Address: Stratigraphic Service 6. API Number: 7. Property Designation (Lease Number): 8. Well Name and Number: 9. Logs (List logs and submit electronic data per 20AAC25.071): 10. Field/Pool(s): 11. Present Well Condition Summary: Total Depth measured 19517 feet feet true vertical 8520 feet feet Effective Depth measured 19517 feet 9624, 9498, 9391 feet true vertical 8520 feet 8272, 8237, 8202 feet Perforation depth Measured depth feet True Vertical depth feet Tubing (size, grade, measured and true vertical depth)4-1/2"L-80 9630' MD 8273' TVD Baker 5" x 7" LTP HES TNT HES TNT Packers and SSSV (type, measured and true vertical depth)9624' MD/8272' TVD 9498' MD / 8237' TVD 9391' MD / 8202' TVD 12. Stimulation or cement squeeze summary: Intervals treated (measured): Treatment descriptions including volumes used and final pressure: 13a. Prior to well operation: Subsequent to operation: 13b. Pools active after work:Rendezvous 15. Well Class after work: Daily Report of Well Operations Exploratory Development Service Stratigraphic Copies of Logs and Surveys Run 16. Well Status after work: Oil Gas WDSPL Electronic Fracture Stimulation Data GSTOR GINJ SUSP SPLUG Sundry Number or N/A if C.O. Exempt: Authorized Name and Digital Signature with Date: Contact Name: Contact Email: Authorized Title: Contact Phone: Madeline Woodard madeline.e.woodard@cop.com 907-265-6086 7500 3189 3056 Burst Collapse 2260 3810, 5090 7030, 8530 5020 6330, 8150 8160, 11220 measured TVD Production Liner 8232 1701 9891 Casing Structural 7527 8308 4-1/2" 8232 9779 19515 8520 Plugs Junk measured 1,705,048 lbs of 20/40 ceramic proppant, 68,403 lbs 100M, 25,496 bbls of seawater, final pressure of 5000 psi @ 15 min shut down Length 80 3189 120Conductor Surface Intermediate 20" x 34" 13-3/8" 5. Permit to Drill Number:2. Operator Name 4. Well Class Before Work: AA081800, AA081781 Greater Moose's Tooth/Rendezvous ConocoPhillips Alaska Inc. P.O. Box 100360 Anchorage, AK 99510-0360 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS 222-150 50-103-20849-00-00 Size 120 0 0 psi 0 0 3685 psi (@ gauge)0 4035 psi (@ gauge) 9-5/8" 11590 7" MT7-97 14. Attachments (required per 20 AAC 25.070, 25.071, & 25.283) 0 Gas-Mcf MD 17924, 17240, 16514, 15787, 15101, 14332, 13568, 12802, 12080, 11352, 10068 0 psi measured true vertical Packer Representative Daily Average Production or Injection Data Casing Pressure Tubing Pressure 323-133 Sr Pet Eng: Sr Pet Geo: Sr Res Eng: WINJ WAG 0 Water-BblOil-Bbl 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. Completions Engineer p k ft t F s O 222 6. A G L PG , ateee atee ell Form 10-404 Revised 10/2022 Due Within 30 days of Operations Submit in PDF format to aogcc.permitting@alaska.gov By Grace Christianson at 8:34 am, Jun 07, 2023 Digitally signed by Madeline Woodard DN: CN=Madeline Woodard, E=madeline.e.woodard @conocophillips.com Reason: I am the author of this document Location: Date: 2023.06.07 08:32:27-08'00' Foxit PDF Editor Version: 12.0.1 Madeline Woodard Page 1/1 MT7-97 Report Printed: 6/6/2023 AOGCC Well History Report Daily Operations Start Date End Date AFE / RFE Last 24hr Sum 5/8/2023 00:00 5/8/2023 23:59 10449823;1044 9823 RIG DOWN FRAC IRON BACK TO PIPE RACK. STAGE ACID PUMP & CHEM FLOAT AT MT6. CLEAN UP AREA AT MT7 & MT6. PREPARE TO MOBILIZE TO KUPARUK. JOB COMPLETE 5/7/2023 00:00 5/7/2023 23:59 10449823;1044 9823 LAUNCH STAGE #10 DART. GOOD SEAT & SHIFT PUMP STAGE #10 PER DESIGN w/ 6921 LBS OF 100 MESH & 156,897 LBS OF 20/40 PROPPANT UP TO 6.1 PPG. LAUNCH STAGE #11 MECH. DART. GOOD SEAT & SHIFT. PERFORM DFIT. PUMP STAGE #11 w/ 6039 LBS OF 100 MESH & 126,962 LBS OF 20/40 PROPPANT UP TO 5.07 PPG. RAN OUT OF SAND 33,000 LBS EARLY. STIMULATION IS COMPLETE. BEGIN RIGGING DOWN 5/6/2023 06:00 5/6/2023 23:59 10449823;1044 9823 SAW PRESSURE DROP DURING OVERNIGHT PRESSURE MONITOR. LRS WAS ABLE TO FREEZE PROTECT WELL. DISPLACE X-LINK FROM THE WELL WITH SEAWATER WITH FRAC FLEET @ 15 BPM **NO ISSUES** DROP BACKUP DART FOR STAGE #8. SEE GOOD SEAT SHIFT SIGNATURE PUMP STAGE #8 PER DESIGN w/ 5388 LBS OF 100 MESH & 159,076 LBS OF 20/40 PROPPANT UP TO 6.29 PPG. LAUNCH STAGE #9 DART **6366 PSI DIFFERENTIAL TO SHIFT** PUMP STAGE #9 PER DESIGN w/ 5665 LBS OF 100 MESH & 156,889 LBS OF 20/40 PROPPANT UP TO 6.17 PPG. IN PROGRESS 5/5/2023 00:00 5/5/2023 19:45 10449823;1044 9823 PUMP STAGE #6 PER DESIGN w/ 4789 LBS OF 100 MESH & 160,317 LBS OF 20/40 PROPPANT UP TO 6.05 PPG. LAND STAGE #7 DART & PERFORM DFIT PUMP STAGE #7 PER DESIGN w/ 6106 LBS OF 100 MESH & 159,326 LBS OF 20/40 PROPPANT UP TO 5.98 PPG. LAUNCH STAGE #8 DART IN X-LINK FLUID. DART LANDED 7 BBLS EARLY, BUT SLEEVE DID NOT SHIFT. CYCLE PRESSURE UP f/ 0 PSI TO 8000 PSI MULTIPLE TIMES w/ NO SUCCESS. FREEZE PROTECT & WRAP WELLHEAD. WHILE COMING UP WITH PLAN FORWARD. IN PROGRESS 5/4/2023 00:01 5/4/2023 23:59 10449823;1044 9823 COMPLETED INTERVAL 4 AND 5 TO DESIGN, ON INTERVAL 4 THE DART SEAT WAS 1100PSI, IT WAS DECIDED TO LAUNCH A SECONDARY, SECONDARY SEAT WAS 5300 PSI 165665 LB PROPPANT PLACED AND 2702 BBL CLEAN PUMPED INTERVAL 5 DART SEAT WAS 14 BBL EARLY GOOD SEAT OBSERVED 158106 LB PROPPANT PLACED 2067 BBL CLEAN VOLUME PUMPED FORCED SHUT DOWN CAUSED BY CROSSLINKER SEPARATION ISSUES, LINES NEED TO BE CLEARED AND CHEM FLOAT RELOADED IN PROGRESS 5/3/2023 00:01 5/3/2023 23:59 10449823;1044 9823 COMPLETED ALPHA DART 1 AND DART 2 STAGES COMPLETED SLEEVE SHIFT, MINIFRAC AND ALPHA SLEEVE STAGES TO DESIGN PLACING 166,305 LB PROPPANT AND 3515 BBL CLEAN VOLUME DART STAGE 1 COMPLETED TO DESIGN DART SEAT 15 BBL EARLY PLACING 164726 LB PROPPANT AND 2,026BBL CLEAN VOLUME DART STAGE 2 COMPLETED TO DESIGN DART SEAT 15 BBL EARLY PLACING 164276 LB PROPPANT AND 2,253 BBL CLEAN VOLUME LRS PUMPED 25 BBL FREEZE PROTECT 5/2/2023 00:01 5/2/2023 23:59 10449823;1044 9823 COMPLETED FLOWING/HEATING WATER, RIGGED IN FRAC 4" HARD LINE, FRAC HEAD, NIPPLED UP LAUNCH VALVES, ROTARY, COMPLETED 2"" TIE IN TO BLEED , PRV TANKS," 5/1/2023 00:01 5/1/2023 06:00 10449823;1044 9823 LOIL STARTED LOADING AND HEATING WATER, LOADING PROPPANT, HAL TREATED TANKS, RIGGED IN THE ePRV LINE AND PLANNING FOR THE DART LAUNCH PUMP, WELLS GROUP RIGGING IN THE IA, OA AND TUBING LINES TO THERE TANKS, SCAFFOLD STARTED ERECTING OR DART LAUNCH EQUIPMENT 6/5/2023 17:00 6/6/2023 05:00 10449823 ATTEMPT TO PUMP FLUID PRESSRUED UP AFTER 5 BBLS. TBG PSI FALLS OFF PUMP BACK UP TWICE BEFORE IT LOCKS UP. RAN 2.5" BAILER SD @ 3406' SLM. BREAK THROUGH OBSTRUCTION. SD IN MULTILPLE SPOTS, FALL OUT @ 3890' SLM DRIFT DOWN TO X NIP @ 9418' RKB.** UNKNOWN SUBSTANCE IN BAILER ** GET TO SURFACE TRY TO PUMP, TBG PRESSURES UP RIGHT AWAY. JOB IN PROGRESS. Last Rev Reason Annotation Wellbore End Date Last Mod By Rev Reason: SL completed post RWO work MT7-97 5/1/2023 rmoore22 Notes: General & Safety Annotation End Date Last Mod By Note: Packer leak @ 9498' RKB, stacked new packer on 2023 RWO 3/29/2023 rmoore22 Casing Strings Csg Des OD (in) ID (in) Top (ftKB) Set Depth (ftKB) Set Depth (TVD) (ftKB) Wt/Len (lb/ft) Grade Top Thread Conductor 20 19.00 39.1 120.0 120.0 Surface 13 3/8 12.42 39.1 3,189.0 3,056.4 68.00 L-80 Intermediate 1 9 5/8 8.68 37.3 8,232.6 7,527.5 47.00 T95 Hyd563 Intermediate 2 7 6.18 8,078.4 9,779.0 8,308.4 29.00 L-80 TSH 563 Liner 4 1/2 3.96 9,624.3 19,515.0 8,520.1 12.60 P110 Tubing Strings: string max indicates LONGEST segment of string Top (ftKB) 34.5 Set Depth 9,484.7 Set Depth 8,233.6 String Ma 4 1/2 Tubing Description Tubing Completion Upper Wt (lb/ft) 12.60 Grade L-80 Top Connection Hyd563 ID (in) 3.96 Completion Details: excludes tubing, pup, space out, thread, RKB... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 34.5 34.5 0.00 Hanger 11.000 FMC 4-1/2" Tubing Hanger Hydril HYD 563 FMC TC-EMS 3.958 1,914.3 1,895.7 17.18 Nipple - X 4.500 NIPPLE,LANDING, X, H563 HES X Nipple 3.813 3,764.1 3,573.3 26.19 Mandrel 4.500 4-1/2" x 1" KBG 4-5 GLM 12.6# H563 Camco KBG4-5 3.865 6,573.9 6,100.8 25.57 Mandrel 4.500 4-1/2" x 1" KBG4-5 GLM, 12.6# H563 Camco KBG4-5 3.860 9,141.7 8,101.3 62.68 Mandrel 4.500 4-1/2" x 1" KBG4-5 GLM, 12.6# H563 Camco KBG4-5 3.865 9,288.0 8,163.9 66.61 Gauge / Pump Sensor 4.500 Halliburton Opsis Mandrel w/ Downhole gauge HES DHG 3.920 9,391.8 8,202.8 69.37 Packer 6.180 Halliburton TNT Packer HES TNT 3.880 9,418.8 8,212.1 70.09 Nipple - X 4.500 NIPPLE,LANDING, 4 1/2" X, H563 SLB X 3.813 9,477.6 8,231.4 71.68 Locator 5.500 Baker Poor Boy Overshot, 4-1/2", IBT, Mule shoe, 14k shear, 6.49' swallow Baker PBOS 3.910 Top (ftKB) 9,478.3 Set Depth 9,630.6 Set Depth 8,274.0 String Ma 4 1/2 Tubing Description Tubing Completion Upper Wt (lb/ft) 12.60 Grade L-80 Top Connection Hyd563 ID (in) 3.96 Completion Details: excludes tubing, pup, space out, thread, RKB... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 9,498.7 8,237.9 72.31 Packer 6.180 Halliburton TNT Packer HES TNT 3.880 9,602.1 8,266.7 75.06 Nipple - DB 4.500 NIPPLE,LANDING, DB-6 H563 SLB 3.750 9,627.3 8,273.1 75.57 Mule Shoe 4.500 HES Self indexing Mule Shoe 3.958 Mandrel Inserts : excludes pulled inserts Top (ftKB) Top (TVD) (ftKB) Top Incl (°) St ati on No /S Serv Valve Type Latch Type OD (in) TRO Run (psi) Run Date Com Make Model Port Size (in) 3,764.1 3,573.3 26.19 1 DMY BK 1 4/29/2023 Camco BK 6,573.9 6,100.8 25.57 2 DMY BK 1 4/28/2023 Camco BK 9,141.7 8,101.3 62.68 3 DMY BK 1 4/28/2023 Camco BK Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 9,734.6 8,298.4 76.89 Baffle 5.000 Arsenal 3.510 10,068.5 8,363.4 79.93 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 10,442.1 8,414.4 84.52 Swell Packer 4.500 Baker Water swell 3.900 10,960.4 8,421.7 90.07 Swell Packer 4.500 Baker Water swell 3.900 11,352.9 8,432.8 88.04 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 11,686.9 8,438.3 89.88 Swell Packer 4.500 Baker Water swell 3.900 12,080.5 8,435.0 90.38 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 12,453.3 8,439.0 88.88 Swell Packer 4.500 Baker Water swell 3.900 12,802.8 8,449.6 88.53 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 13,175.5 8,447.3 90.91 Swell Packer 4.500 Baker Water swell 3.900 13,568.8 8,441.6 90.43 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 13,938.9 8,451.5 87.13 Swell Packer 4.500 Baker Water swell 3.900 14,332.6 8,463.8 89.14 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 14,708.0 8,470.4 89.14 Swell Packer 4.500 Baker Water swell 3.900 15,102.0 8,476.2 89.66 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 15,435.8 8,479.1 89.10 Swell Packer 4.500 Baker Water swell 3.900 15,787.7 8,479.1 91.02 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 16,161.8 8,475.8 89.13 Swell Packer 4.500 Baker Water swell 3.900 HORIZONTAL, MT7-97, 6/6/2023 4:18:43 PM Vertical schematic (actual) Liner; 9,624.3-19,515.0 Shoe; 19,510.2-19,515.0 Sleeve - Frac; 18,135.5- 18,139.1 Sleeve - Frac; 17,924.4- 17,928.1 Swell Packer; 17,613.5-17,634.2 FRAC Sleeve/Port; 17,240.4- 17,242.5 Swell Packer; 16,889.7-16,910.4 FRAC Sleeve/Port; 16,514.1- 16,516.1 Swell Packer; 16,161.8-16,182.3 FRAC Sleeve/Port; 15,787.7- 15,789.8 Swell Packer; 15,435.8-15,456.1 FRAC Sleeve/Port; 15,102.0- 15,104.0 Swell Packer; 14,708.0-14,728.6 Production String 1 Cement; 9,624.0 ftKB FRAC Sleeve/Port; 14,332.5- 14,334.6 Swell Packer; 13,938.9-13,959.2 FRAC Sleeve/Port; 13,568.8- 13,570.9 Swell Packer; 13,175.5-13,195.9 FRAC Sleeve/Port; 12,802.8- 12,804.8 Swell Packer; 12,453.3-12,474.0 FRAC Sleeve/Port; 12,080.5- 12,082.5 Swell Packer; 11,686.9-11,707.7 FRAC Sleeve/Port; 11,352.9- 11,354.9 Swell Packer; 10,960.4-10,980.4 Swell Packer; 10,442.1-10,462.5 FRAC Sleeve/Port; 10,068.5- 10,070.6 Intermediate 2; 8,078.4-9,779.0 Float Shoe; 9,776.1-9,779.0 Baffle; 9,734.6-9,736.5 Landing Collar; 9,690.7-9,694.1 Hanger; 9,638.7-9,648.0 Packer (Liner Top); 9,624.3- 9,638.7 Nipple - DB; 9,602.1 Packer; 9,498.7 Nipple - X; 9,418.8 Intermediate String 2 Cement; 9,017.0 ftKB Packer; 9,391.8 Gauge / Pump Sensor; 9,288.0 Mandrel; 9,141.7 Intermediate 1; 37.3-8,232.6 Casing Shoe; 8,229.5-8,232.6 Collar - Float; 8,139.7-8,142.5 Hanger; 8,100.0-8,102.8 Packer; 8,078.4-8,100.0 Intermediate String 1 Cement; 5,309.0 ftKB Mandrel; 6,573.9 Mandrel; 3,764.1 Surface; 39.1-3,189.0 Float Shoe; 3,186.7-3,189.0 Nipple - X; 1,914.3 Surface String Cement; 39.0 ftKB Conductor; 39.1-120.0 Casing Hanger; 39.1-40.4 Casing Hanger; 37.3-38.7 Hanger; 34.5 WNS PROD KB-Grd (ft) 39.10 RR Date 3/1/2023 Other Elev MT7-97 ... TD Act Btm (ftKB) 19,517.0 Well Attributes Field Name RENDE Wellbore API/UWI 501032084900 Wellbore Status PROD Max Angle & MD Incl (°) 93.08 MD (ftKB) 18,168.40 WELLNAME WELLBOREMT7-97 Annotation Last WO: End Date 5/1/2023 H2S (ppm) DateComment Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 16,514.1 8,479.5 90.29 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 16,889.7 8,478.8 89.31 Swell Packer 4.500 Baker Water swell 3.900 17,240.4 8,484.1 88.89 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 17,613.5 8,495.8 88.81 Swell Packer 4.500 Baker Water swell 3.900 17,924.4 8,496.2 90.81 Sleeve - Frac 5.000 Baker Alpha 3.000 18,135.5 8,492.6 92.41 Sleeve - Frac 5.000 Baker Alpha 3.000 18,346.6 8,483.8 92.13 Collar - Landing 4.500 Baker Alpha Type II 3.880 HORIZONTAL, MT7-97, 6/6/2023 4:18:44 PM Vertical schematic (actual) Liner; 9,624.3-19,515.0 Shoe; 19,510.2-19,515.0 Sleeve - Frac; 18,135.5- 18,139.1 Sleeve - Frac; 17,924.4- 17,928.1 Swell Packer; 17,613.5-17,634.2 FRAC Sleeve/Port; 17,240.4- 17,242.5 Swell Packer; 16,889.7-16,910.4 FRAC Sleeve/Port; 16,514.1- 16,516.1 Swell Packer; 16,161.8-16,182.3 FRAC Sleeve/Port; 15,787.7- 15,789.8 Swell Packer; 15,435.8-15,456.1 FRAC Sleeve/Port; 15,102.0- 15,104.0 Swell Packer; 14,708.0-14,728.6 Production String 1 Cement; 9,624.0 ftKB FRAC Sleeve/Port; 14,332.5- 14,334.6 Swell Packer; 13,938.9-13,959.2 FRAC Sleeve/Port; 13,568.8- 13,570.9 Swell Packer; 13,175.5-13,195.9 FRAC Sleeve/Port; 12,802.8- 12,804.8 Swell Packer; 12,453.3-12,474.0 FRAC Sleeve/Port; 12,080.5- 12,082.5 Swell Packer; 11,686.9-11,707.7 FRAC Sleeve/Port; 11,352.9- 11,354.9 Swell Packer; 10,960.4-10,980.4 Swell Packer; 10,442.1-10,462.5 FRAC Sleeve/Port; 10,068.5- 10,070.6 Intermediate 2; 8,078.4-9,779.0 Float Shoe; 9,776.1-9,779.0 Baffle; 9,734.6-9,736.5 Landing Collar; 9,690.7-9,694.1 Hanger; 9,638.7-9,648.0 Packer (Liner Top); 9,624.3- 9,638.7 Nipple - DB; 9,602.1 Packer; 9,498.7 Nipple - X; 9,418.8 Intermediate String 2 Cement; 9,017.0 ftKB Packer; 9,391.8 Gauge / Pump Sensor; 9,288.0 Mandrel; 9,141.7 Intermediate 1; 37.3-8,232.6 Casing Shoe; 8,229.5-8,232.6 Collar - Float; 8,139.7-8,142.5 Hanger; 8,100.0-8,102.8 Packer; 8,078.4-8,100.0 Intermediate String 1 Cement; 5,309.0 ftKB Mandrel; 6,573.9 Mandrel; 3,764.1 Surface; 39.1-3,189.0 Float Shoe; 3,186.7-3,189.0 Nipple - X; 1,914.3 Surface String Cement; 39.0 ftKB Conductor; 39.1-120.0 Casing Hanger; 39.1-40.4 Casing Hanger; 37.3-38.7 Hanger; 34.5 WNS PROD MT7-97 ... WELLNAME WELLBOREMT7-97 Hydraulic Fracturing Fluid Product Component Information DisclosureHydraulic Fracturing Fluid Composition:Job Start Date:5/3/2023Job End Date:5/7/2023State:AlaskaCounty:Harrison BayAPI Number:50-103-20849-00-00Operator Name:ConocoPhillips Company/Burlington ResourcesWell Name and Number:MT7-97Latitude:70.17339700Longitude:-151.68989100Datum:NAD27Federal Well:NOIndian Well:NOTrue Vertical Depth:8,520Total Base Water Volume (gal):1,068,364Total Base Non Water Volume:53,418Trade NameSupplierPurposeIngredientsChemicalAbstractServiceNumber(CAS #)MaximumIngredientConcentrationin Additive (% by mass)**MaximumIngredientConcentrationin HF Fluid (% by mass)**CommentsSEAWATER (SG 8.52)HalliburtonBase FluidWater7732-18-5100.0000082.62532Density = 8.52IngredientsListed AboveListed AboveWater7732-18-5100.000000.18783 LoSurf-300DHalliburtonNon-ionicSurfactantListed BelowSand-CommonWhite-100 Mesh, SSA-2HalliburtonProppantListed BelowMO-67HalliburtonpH ControlListed BelowCeramicProppant - WanliWanliProppantListed BelowCL-28MCROSSLINKERHalliburtonCrosslinkerListed BelowLVT-200Baker HughesAdditiveListed BelowOPTIFLO-IIIDELAYEDRELEASEBREAKERHalliburtonBreakerListed BelowBE-6(TM)BactericideHalliburtonMicrobiocideListed Below WG-36 GELLING AGENTHalliburtonGelling AgentListed BelowCorundum1302-74-565.0000010.39558Mullite1302-93-845.000007.19694Sodium chloride7647-14-55.000004.13177Crystalline silica, quartz14808-60-7100.000000.63212Guar gum9000-30-0100.000000.32016Borate saltsProprietary60.000000.13785Distillates (petroleum), hydrotreated light64742-47-8100.000000.06596Ethanol64-17-560.000000.04160Heavy aromatic petroleum naphtha64742-94-530.000000.02080Oxyalkylated nonyl phenolic resinProprietary30.000000.02080Ammonium persulfate7727-54-0100.000000.01852Sodium hydroxide1310-73-230.000000.01500Potassium chloride7447-40-75.000000.01149Inorganic mineral1317-65-35.000000.01149Oxyalkylated phenolic resinProprietary10.000000.00693Oxylated phenolic resinProprietary30.000000.00556Naphthalene91-20-35.000000.00347Poly(oxy-1,2-ethanediyl),alpha-(4-nonylphenyl)-omega-hydroxy-,branched127087-87-05.000000.00347Calcium magnesium carbonate16389-88-11.000000.00230PolymerProprietary1.000000.00230Gluteraldehyde111-30-81.000000.00230Inorganic mineralProprietary1.000000.00230Items above are Trade Names with the exception of Base Water . Items below are the individual ingredients. * Total Water Volume sources may include various types of water including fresh water, produced water, and recycled water ** Information is based on the maximum potential for concentration and thus the total may be over 100%*** If you are calculating a percentage of total ingredients do not add the water volume below the green line to the water volume above the green lineNote: For Field Development Products (products that begin with FDP), MSDS level only information has been provided.Ingredient information for chemicals subject to 29 CFR 1910.1200(i) and Appendix D are obtained from suppliers Material Safety Data Sheets (MSDS)2-Bromo-2-nitro-1,3-propanediol52-51-7100.000000.001441,2,4 Trimethylbenzene95-63-61.000000.00069Sodium bisulfate7681-38-10.100000.00023Methanesulfonic acid, 1-hydroxy-, sodium salt870-72-40.100000.000232-Methyl-4-isothiazolin-3-one2682-20-40.010000.000025-Chloro-2-methyl-3(2H)-Isothaiazolone26172-55-40.010000.00002Magensium chloride7786-30-30.010000.00002Magnesium nitrate10377-60-30.010000.00002 1. Operations Susp Well Insp Plug Perforations Fracture Stimulate Pull Tubing Operations shutdown Performed: Install Whipstock Perforate Other Stimulate Alter Casing Change Approved Program Mod Artificial Lift Perforate New Pool Repair Well Coiled Tubing Ops Other: Run New Completion Development Exploratory Stratigraphic Service 6. API Number: 7. Property Designation (Lease Number): 8. Well Name and Number: 9. Logs (List logs and submit electronic data per 20AAC25.071): 10. Field/Pool(s): 11. Present Well Condition Summary: Total Depth measured 19517'feet None feet true vertical 8520' feet None feet Effective Depth measured 19517'feet 9392', 9499'feet true vertical 8520' feet 8203', 8238' feet Perforation depth Measured depth True Vertical depth Tubing (size, grade, measured and true vertical depth) 4-1/2" L-80 9631' MD 8274' TVD Packers and SSSV (type, measured and true vertical depth) 9392' MD 9499' MD N/A 8203' TVD 8238' TVD N/A 12. Stimulation or cement squeeze summary: Intervals treated (measured): Treatment descriptions including volumes used and final pressure: N/A 13a. Prior to well operation: Subsequent to operation: 13b. Pools active after work: Rendezvous Oil Pool 15. Well Class after work: Daily Report of Well Operations Exploratory Development Service Stratigraphic Copies of Logs and Surveys Run 16. Well Status after work: Oil Gas WDSPL Electronic Fracture Stimulation Data GSTOR GINJ SUSP SPLUG Sundry Number or N/A if C.O. Exempt: Authorized Name and Digital Signature with Date: Contact Name: Contact Email: Authorized Title: Contact Phone: 323-157 Sr Pet Eng: Sr Pet Geo: Sr Res Eng: WINJ WAG ~ Water-BblOil-Bbl 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. N/A Packer: HBL TNT Packer Packer: HLB TNT Packer SSSV: None Sydney Long sydney.long@conocophillips.com (907) 265-6312RWO/CTD Engineer None None measured true vertical Packer Representative Daily Average Production or Injection Data Casing Pressure Tubing Pressure 14. Attachments (required per 20 AAC 25.070, 25.071, & 25.283) ~ Gas-Mcf MD ~ Size 120' ~ ~~ Well Remains Shut-In ~~ ~ measured TVD 9-5/8" 7" STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS 222-150 50-103-20849-00-00 P.O. Box 100360 Anchorage, AK 99510 3. Address: ConocoPhillips Alaska, Inc. N/A 5. Permit to Drill Number:2. Operator Name 4. Well Class Before Work: AA081781, AA081800 Greater Moose's Tooth Field/ Rendezvous Oil Pool GMT MT7-97 Plugs Junk measured Length Intermediate 2 Liner 8195' 1701' 9891' Casing 7527' 8308' 4-1/2" 8233' 9779' 19515' 8520' 3150' 120'Conductor Surface Intermediate 1 20" 13-3/8" 81' 3189' 3056' Burst Collapse Form 10-404 Revised 10/2022 Due Within 30 days of Operations Submit in PDF format to aogcc.permitting@alaska.gov By Grace Christianson at 4:13 pm, May 30, 2023 Page 1/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/21/2023 16:00 4/21/2023 21:00 5.00 MIRU, MOVE MOB P Scope in mast. Pin TD in transport position on torque rails. Scope in C section. Prepare to lower cattle shoot. Blow down steam lines. 0.0 0.0 4/21/2023 21:00 4/21/2023 22:00 1.00 MIRU, MOVE MOB P Pin in C section. Lower cattle chute. Prepare to skid the rig floor. 0.0 0.0 4/21/2023 22:00 4/22/2023 00:00 2.00 MIRU, MOVE MOB P Raise cellar, Disconnect electrical inter connects between sub, and casing shed. 0.0 0.0 4/22/2023 00:00 4/22/2023 01:30 1.50 MIRU, MOVE RURD P PJSM, Iinspect, and lower the mast. *offline: lay mats for rig move. 0.0 0.0 4/22/2023 01:30 4/22/2023 02:00 0.50 MIRU, MOVE RURD P Stomp casing complex away from pipe shed. 0.0 0.0 4/22/2023 02:00 4/22/2023 03:30 1.50 MIRU, MOVE RURD P Lift, and pin casing complex, and pin suspension. Pull casing complex away from the rig with sow. Un-pin pipe shed, lift sub, and stomp pipe shed away from sub. Stomp motor complex away from rig. 0.0 0.0 4/22/2023 03:30 4/22/2023 07:00 3.50 MIRU, MOVE RURD P Continue to stomp pipe shed away from the sub. Stomp pump module away from pit module. Stomp pit module away from sub. 0.0 0.0 4/22/2023 07:00 4/22/2023 08:00 1.00 MIRU, MOVE RURD P Lift and pin pipe shed on suspension, and move with sow and stage on location. Stomp sub off of MT7-11. 0.0 0.0 4/22/2023 08:00 4/22/2023 10:30 2.50 MIRU, MOVE RURD P Turn sub using stompers. Install Jeep, and hook up sub to SOW. 0.0 0.0 4/22/2023 10:30 4/22/2023 16:00 5.50 MIRU, MOVE RURD P Move sub with sow. Line up Sub with MT7-97. Prepare pit module to move. *offline: Pull mats around MT7-11. Lay Herculite in the cellar. Set matting boards for sub around MT7-97. 0.0 0.0 4/22/2023 16:00 4/22/2023 17:30 1.50 MIRU, MOVE RURD P Spot sub over well. Check level of sub, and shim. *offline: continue to lay mats for other modules. 0.0 0.0 4/22/2023 17:30 4/23/2023 00:00 6.50 MIRU, MOVE RURD P Move pipe shed onto rig mats near sub using sow. Stomp pipe shed towards substructure. Stage pump module, and motor module near sub, un-pin suspension and set on stompers. 0.0 0.0 4/23/2023 00:00 4/23/2023 03:30 3.50 MIRU, MOVE RURD P Stomp pipeshed under sub. Level. Shim and pin. 0.0 0.0 4/23/2023 03:30 4/23/2023 06:30 3.00 MIRU, MOVE RURD P Set pit complex. Lay mats for casing shed. Stomp pump complex into position. Stomp motor complex into position. Stomp casing shed into position. 0.0 0.0 4/23/2023 06:30 4/23/2023 07:30 1.00 MIRU, MOVE RURD P Prep to raise derrick. Raise derrick and retract mast cylinders. 0.0 0.0 4/23/2023 07:30 4/23/2023 08:30 1.00 MIRU, MOVE RURD P PJSM. Skid rig floor to drilling position. Hook up pits/pump complex interconnnects. 0.0 0.0 4/23/2023 08:30 4/23/2023 09:30 1.00 MIRU, MOVE RURD P Lower C-section. RD supports on energy track. Skid roof in place. MU interconnects in mud pits and steam lines. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 2/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/23/2023 09:30 4/23/2023 11:00 1.50 MIRU, MOVE RURD P R/U mud module interconnects. Raise cattle chute. Connect electrical lines in the electrical interconnects to the sub, and the pit module. Energize air and steam lines to the rig floor. 0.0 0.0 4/23/2023 11:00 4/23/2023 12:00 1.00 MIRU, MOVE RURD P R/D lines on cattle chute. Lower cellar walls. fill gaps with insulation. Hook up pump module inerconnects. 0.0 0.0 4/23/2023 12:00 4/23/2023 16:00 4.00 MIRU, MOVE RURD P Continue to work on rig acceptance check list. Continue to work on interconnects on the modules. RIG ACCEPTED 15:00 hrs 0.0 0.0 4/23/2023 16:00 4/23/2023 17:00 1.00 MIRU, MOVE RURD P Spool drilling line back on to the draw works drum. Install bridal lines, and scope mast up. Rig down bridal lines and store in the mast. Offline: Prepare high pressure hoses, and hard line for circulating. 0.0 0.0 4/23/2023 17:00 4/23/2023 19:00 2.00 MIRU, WELCTL RURD P Make up kelly hose, R/U lines from tree, and IA to tiger tank. 0.0 0.0 4/23/2023 19:00 4/23/2023 23:00 4.00 MIRU, WELCTL RURD P Load pits with 8.5 PPG sea water. Prime mud pumps. Finish rigging up lines from IA, and tubing in the cellar to hard line to tiger tank. * OFFLINE: Load 88 JTS 4" DP into the pipe shed. 0.0 0.0 4/23/2023 23:00 4/24/2023 00:00 1.00 MIRU, WELCTL SEQP P PJSM for line up and pressure testing lines. Line up and flood lines. Test suface lines to 250 PSI low 5min/ 2500 PSI high for 5 min: GOOD. Blow down lines. 0.0 0.0 4/24/2023 00:00 4/24/2023 02:00 2.00 MIRU, WELCTL CIRC P Line up tubing to tiger tank. Bleed tubing pressure for one minute. Bled to zero, shut in tubing and monitor 5 min. for pressure build: Pressure zero. Line up to pump down IA, displacing diesel in the tubing to tiger tank. Pump until 9.0 PPG corrosion inhibitted brine at the tiger tank 18 BBLS pumped. shut down pump. Line up to pump down the tubing taking returns out of the IA displacing diesel to the tiger tank. 90 BBLS pumped. 0.0 0.0 4/24/2023 02:00 4/24/2023 05:30 3.50 MIRU, WELCTL CIRC P Line up to pump down the tubing, taking returns out of the IA, taking returns back to the pits. Blow down line to tiger tank. Displace well over to sea water @ 4 BBL/MIN. ICP: FCP: *SIMOPS: sllip and cut 870' of drilling line. Start to C/O saver sub on the top drive. 0.0 0.0 4/24/2023 05:30 4/24/2023 06:00 0.50 MIRU, WELCTL OWFF P Observe well for flow for 30 min. *SIMOPS: Continue to C/O saver sub on the top drive. 0.0 0.0 4/24/2023 06:00 4/24/2023 06:30 0.50 MIRU, WELCTL MPSP P FMC remove tree cap and install BPV. *SIMOPS: Continue to C/O saver sub. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 3/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/24/2023 06:30 4/24/2023 07:30 1.00 MIRU, WELCTL MPSP P Line up on IA, and test BPV from below 1,000 PSI, 10 min: GOOD TEST *SIMOPS: FInish changing saver sub. M/U FOSV, & Gray valve for testing. 0.0 0.0 4/24/2023 07:30 4/24/2023 08:30 1.00 MIRU, WELCTL RURD P Blow down and rig down 2" high pressure lines in the cellar. *SIMOPS: Bring TEC wire spooler to the rig floor. 0.0 0.0 4/24/2023 08:30 4/24/2023 09:30 1.00 MIRU, WHDBOP NUND P Remove tree cap, and install lifting cap. N/D Tree and move to rig floor for storage. 0.0 0.0 4/24/2023 09:30 4/24/2023 10:30 1.00 MIRU, WHDBOP NUND P Set High pressure riser on well head, install bolts. 0.0 0.0 4/24/2023 10:30 4/24/2023 12:00 1.50 MIRU, WHDBOP NUND P Skid BOPs over and set down on high pressure riser. put in bolts, 0.0 0.0 4/24/2023 12:00 4/24/2023 17:00 5.00 MIRU, WHDBOP NUND P Torque bolts on Riser, and BOP. M/U kill line. Skid "Joe's box" into position and seal. set trip nipple, and get RKB measurements. Lower Tree from rig floor to BOP deck for storage. 0.0 0.0 4/24/2023 17:00 4/24/2023 18:00 1.00 MIRU, WHDBOP SEQP P R/U to test BOP. Install blanking plug X/O, M/U and install 4 1/2" test joint in BOP. Shell test BOP. 0.0 0.0 4/24/2023 18:00 4/25/2023 00:00 6.00 MIRU, WHDBOP SEQP P Test BOP to 250 low 3500 high 5 min low, 10 min high using using 4 1/2" & 4" Test joints. Perform accumulator Draw down test. AOGCC representative witnessed test. All tests passed. 0.0 0.0 4/25/2023 00:00 4/25/2023 01:30 1.50 COMPZN, RPCOMP MPSP B/O blanking plug, and pull with landing JT. L/D landing Jt. Remove BPV per FMC. Blow down choke and kill lines. 0.0 4/25/2023 01:30 4/25/2023 02:00 0.50 COMPZN, RPCOMP OWFF OWFF: Static. *SIMOPS: start to R/U Doyon Casing equipment on the rig floor. rig up HES TEC wire spooler. 0.0 0.0 4/25/2023 02:00 4/25/2023 02:30 0.50 COMPZN, RPCOMP RURD Continue R/U Doyon Casing equipment on the rig floor. Rig up HES TEC wire spooler and sheaves. 0.0 0.0 4/25/2023 02:30 4/25/2023 05:30 3.00 COMPZN, RPCOMP PULL T FMC BOLDS. Attempt to pull tubing. would not come free. Pick up to initial 180k HKLD. Slack off and land hanger. M/U cross over to landing joint, and kelly up to the top drive. Work up in 10- 20 k increments to max of 273k HKLD. Pipe would not come free. Contact town for plan forward. Mobilize E-line. 9,470.0 9,470.0 4/25/2023 05:30 4/25/2023 10:30 5.00 COMPZN, RPCOMP PULD T R/D tubing handling equipment. R/U 4" DP handling equipment. P/U and rack back 35 stands of 4" DP while waiting on E-line to arrive. 9,470.0 9,470.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 4/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/25/2023 10:30 4/25/2023 11:00 0.50 COMPZN, RPCOMP RURD T Change pipe handling equipment from 4" DP to 4.5" tubing equipment. Set string in tension (150K HKLD) and set slips. 9,470.0 9,470.0 4/25/2023 11:00 4/25/2023 14:00 3.00 COMPZN, RPCOMP ELNE T M/U FOSV, and X/O for E-line equipment on landing joint. R/U E-line surface equipment. Yellow Jacket E-line make up DRCT chemical cutter tool string. 9,470.0 9,470.0 4/25/2023 14:00 4/25/2023 16:00 2.00 COMPZN, RPCOMP ELNE T Yellow Jacket E-line RIH and make second cut @ 9,475' - 5' bellow original cut. *NOTE: Yellow Jacket E-line did not see original cut on CCL log. 9,470.0 9,475.0 4/25/2023 16:00 4/25/2023 17:00 1.00 COMPZN, RPCOMP ELNE T Yellow Jacket E-line POOH F/ 9475' to surface. 9,475.0 9,475.0 4/25/2023 17:00 4/25/2023 17:30 0.50 COMPZN, RPCOMP ELNE T R/D E line tools, change elevators. Rig up to pull tubing. 9,475.0 9,475.0 4/25/2023 17:30 4/25/2023 18:30 1.00 COMPZN, RPCOMP PULL P Make up cross over to landing joint. Kelly up to landing joint. Pull tubing staging up to 260K. No movement. slack off to 140 K Bring flow rate up to 315 GPM @ 440 PSI. Shut down pumps and stage up to 275K HKLD. String pulled free HKLD dropped to 141 K. PUWT: 141 K SOWT: 129 K 9,475.0 9,475.0 4/25/2023 18:30 4/25/2023 19:00 0.50 COMPZN, RPCOMP PULL P Back top drive out of landing joint. B/O and L/D landing joint and tubing hanger. 9,475.0 9,475.0 4/25/2023 19:00 4/26/2023 00:00 5.00 COMPZN, RPCOMP PULL P POOH L/D singles of tubing from 9,475' to 6,978'. Tallying tubing for re-run as it is being laid down. 9,475.0 6,978.0 4/26/2023 00:00 4/26/2023 08:30 8.50 COMPZN, RPCOMP PULL P POOH L/D singles of tubing from 6,978' to Surface. Tallying tubing for re-run as it is being laid down. 6,978.0 0.0 4/26/2023 08:30 4/26/2023 10:00 1.50 COMPZN, RPCOMP CLEN P Clean and clear rig floor, tubing tools and TEC line and equipment. 0.0 0.0 4/26/2023 10:00 4/26/2023 10:30 0.50 COMPZN, RPCOMP OTHR P Pump out stack and set wear ring. 0.0 0.0 4/26/2023 10:30 4/26/2023 11:00 0.50 COMPZN, RPCOMP BHAH P M/U Baker dress off assy. 83.3' MD 0.0 83.0 4/26/2023 11:00 4/26/2023 21:00 10.00 COMPZN, RPCOMP PULD P Single in with Baker dress off assy from 83' MD to 6520' MD. PUWT: 138 K SOWT: 133 K 83.0 750.0 4/26/2023 21:00 4/26/2023 22:30 1.50 COMPZN, RPCOMP TRIP P Continue RIH w/ Baker dress off assy from 6,520' to 9,335' PUWT: 165 K SOWT: 145 K 750.0 9,335.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 5/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/26/2023 22:30 4/26/2023 23:30 1.00 COMPZN, RPCOMP CIRC Kelly up to string. Scrape f/ 9,335' to 9,447' (Bit Depth). Placing scraper f/ 9315' to 9425' ROTWT: 156 K @ 100 RPM, TQ: 5K pumping 168 GPM @ 340 PSI. Making two passes with scraper. 9,335.0 9,447.0 4/26/2023 23:30 4/27/2023 00:00 0.50 COMPZN, RPCOMP TRIP RIH F/ 9,447 to 9,475'. Tag tubing stump w/ dress off shoe. Set down 5 K. Mark pipe, and pick up 5'. Pump @ 168 GPM @ 340 PSI. Start rotating @ 80 RPM @ 5.5 K TQ. Wash/ Rotate down over stump. Tag on dress off Mill @ 9,479' and set down 5K to confirm (dress off mill 4' inside of wash pipe extension / dress off shoe). 9,447.0 9,479.0 4/27/2023 00:00 4/27/2023 00:30 0.50 COMPZN, RPCOMP MILL P Continue dressing off stump, Pump @ 168 GPM @ 340 PSI. Start rotating @ 80 RPM @ 5.5 K TQ. Wash/ Rotate down over stump. Tag on dress off Mill @ 9,479' and set down 5K to confirm (dress off mill 4' inside of wash pipe extension / dress off shoe). 9,479.0 9,479.0 4/27/2023 00:30 4/27/2023 01:30 1.00 COMPZN, RPCOMP CIRC P Circulate BTM's up at 9,474' MD GPM: 356 PSI: 1350 .5 LBS recovered off of magnets. 9,479.0 9,474.0 4/27/2023 01:30 4/27/2023 02:00 0.50 COMPZN, RPCOMP OTHR P L/D double and Blow down top drive. 9,474.0 9,400.0 4/27/2023 02:00 4/27/2023 12:00 10.00 COMPZN, RPCOMP PULD P L/D 4" drill pipe from 9,400' MD to 400' MD. 9,400.0 400.0 4/27/2023 12:00 4/27/2023 12:30 0.50 COMPZN, RPCOMP RURD P Remove PS 21's and install master bushings. Install TEC wire on spooler on rig floor. 400.0 400.0 4/27/2023 12:30 4/27/2023 13:00 0.50 COMPZN, RPCOMP PULD P POOH L/D singles from 400' to 85'. PUWT/SOWT: 45 K. 400.0 85.0 4/27/2023 13:00 4/27/2023 13:15 0.25 COMPZN, RPCOMP OWFF P OWFF 15 min: Static. 85.0 85.0 4/27/2023 13:15 4/27/2023 14:45 1.50 COMPZN, RPCOMP BHAH P L/D Dress off BHA per Baker fishing rep. No notable debris on magnet, or in boot baskets. 85.0 0.0 4/27/2023 14:45 4/27/2023 17:30 2.75 COMPZN, RPCOMP WWWH P Pull wear bushing. Jet BOP/ well head. 0.0 0.0 4/27/2023 17:30 4/28/2023 00:00 6.50 COMPZN, RPCOMP PUTB P PJSM. P/U and RIH w/ 4 1/2" 12.6# HYD 563 upper completion from surface to 4,342'. Testing TEC wire every 1000'. SOWT: 88 K Test Guage connection to 10 K PSI 10 Min after making up to guage mandrel: GOOD. 0.0 4,342.0 4/28/2023 00:00 4/28/2023 06:30 6.50 COMPZN, RPCOMP PUTB P Continue P/U and RIH w/ 4 1/2" 12.6# HYD 563 upper completion from 4,342' MD to 9,442' MD. Testing TEC wire every 1,000' and installing cannon clamps every joint. 4,342.0 9,442.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 6/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/28/2023 06:30 4/28/2023 07:00 0.50 COMPZN, RPCOMP OTHR P P/U joint 229. Observe 7k shear and land out on stump (set 20k on stump). Top of stump - 9,478.23' MD. P/U to neutral weight (no pups needed for space out). R/U bail extensions and M/U hanger, landing joint and circulate hose. P/U: 137k S/O: 128k 9,442.0 9,485.0 4/28/2023 07:00 4/28/2023 11:00 4.00 COMPZN, RPCOMP CIRC P Circulate and displace 500 bbls CI 9.0ppg fluid. Chase with 134 bbls 9.0ppg sea water. SIMOPS: HES terminate TEC line through hanger, and test same to 5,000 psi. 9,485.0 9,485.0 4/28/2023 11:00 4/28/2023 14:00 3.00 COMPZN, RPCOMP HOSO P Land hanger with 128k 0.85' from landing on stump. FMC RILD and test hanger top to 5,000 psi for 15min. (CO bleeder valves on test pump). Drop 1- 5/16" ball and rod. 9,485.0 9,485.0 4/28/2023 14:00 4/28/2023 15:30 1.50 COMPZN, RPCOMP PRTS P RU test lines. Pressure up tubing, set pkr and test tbg to 4,200 psi & hold for 30 minutes. Bleed tubing down to 3,000 psi & bring pressure on IA to 4,200 psi & hold pressure for 30 minutes. Recieved notification that BLM in route to witness test. 9,485.0 9,485.0 4/28/2023 15:30 4/28/2023 17:00 1.50 COMPZN, RPCOMP WAIT X Wait on BLM rep to witness test. 9,485.0 9,485.0 4/28/2023 17:00 4/28/2023 19:30 2.50 COMPZN, RPCOMP PRTS P Pressure test tbg to 4,200 psi & hold for 30 minutes. Bleed tubing down to 3,000 psi & bring pressure on IA to 4,200 psi & hold pressure for 30 minutes. Reset pop off and pressure up IA to 3,000 psi. Bleed tubing to 0 psi. Shear SOV with 2,200 psi differential. Tubing & IA equalized & bled to 0 psi. Observed IA for flow for 30 minutes. No flow. 9,485.0 9,485.0 4/28/2023 19:30 4/28/2023 20:30 1.00 COMPZN, WHDBOP PRTS P R/D test equipment and pull landing joint. Pump out BOP stack and set BPV. Pressure test BPV to 1,000 psi in direction of flow for 10 min (good test). 9,485.0 9,485.0 4/28/2023 20:30 4/28/2023 21:00 0.50 COMPZN, WHDBOP CLEN P Clean and clear rig floor. 9,485.0 9,485.0 4/28/2023 21:00 4/29/2023 00:00 3.00 COMPZN, WHDBOP NUND P PJSM. Pull master bushings. N/D trip nipple, BOP's and risers. 9,485.0 9,485.0 4/29/2023 00:00 4/29/2023 00:30 0.50 COMPZN, WHDBOP NUND P Finish R/D Risers and stage in BOP deck. 0.0 0.0 4/29/2023 00:30 4/29/2023 01:30 1.00 COMPZN, WHDBOP OTHR P HES termonate TEC line and stage tree in BOP deck. 0.0 0.0 4/29/2023 01:30 4/29/2023 03:00 1.50 COMPZN, WHDBOP NUND P N/U 10k tree and test adapter flange to 5k. (Good test CPAI witnessed). 0.0 0.0 4/29/2023 03:00 4/29/2023 04:00 1.00 COMPZN, WHDBOP PRTS P Fill tree with diesel and pressure test 250/9,800psi. (Good test CPAI witnessed). 0.0 0.0 4/29/2023 04:00 4/29/2023 06:30 2.50 COMPZN, WHDBOP FRZP P PJSM, R/U LRS, PT lines to 3,500psi. Pump 85 bbls diesel down IA at 2.5 bpm taking returns up tubing to pits. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 7/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/29/2023 06:30 4/29/2023 08:30 2.00 COMPZN, WHDBOP FRZP P Line up manifold to U-Tube well. SIMOPS: Move slick line equipment to rig floor and spot truck. SIMOPS: Change out saver sub on TD. BD freeze protect lines. SIMOPS: Change out #2 pump liner to 6.5". 0.0 0.0 4/29/2023 08:30 4/29/2023 09:30 1.00 COMPZN, WHDBOP SLKL P Remove tree cap and M/U slick line risers, side entry and WL BOP. SIMOPS: Remove and inspect blind rams. 0.0 0.0 4/29/2023 09:30 4/29/2023 13:30 4.00 COMPZN, WHDBOP SLKL P P/U slick line lubricator. Secure slick line sheave. 0.0 0.0 4/29/2023 13:30 4/29/2023 14:30 1.00 COMPZN, WHDBOP SLKL P R/U LRS and flood lines. Leak on X/O (change seals). Pressure test lubricator and riser to 2,500 psi (good test). 0.0 0.0 4/29/2023 14:30 4/29/2023 16:00 1.50 COMPZN, WHDBOP SLKL P Slick line run #1 set ball and rod retrieval tool. 0.0 0.0 4/29/2023 16:00 4/29/2023 16:30 0.50 COMPZN, WHDBOP SLKL P Add 17' to lubricator assy. 0.0 0.0 4/29/2023 16:30 4/29/2023 17:30 1.00 COMPZN, WHDBOP SLKL P Slick line run #2 RIH and pull SOV. 0.0 0.0 4/29/2023 17:30 4/29/2023 19:00 1.50 COMPZN, WHDBOP SLKL P Slick line run #3 Set DV. 0.0 0.0 4/29/2023 19:00 4/30/2023 00:00 5.00 COMPZN, WHDBOP SLKL P P/U Lubrictor assy and install test cap. Pressure test tubing and IA to 4,200 psi (good test). Pull tree cap and M/U lubricator, test to 2,500 psi (good test). 0.0 0.0 4/30/2023 00:00 4/30/2023 01:30 1.50 COMPZN, WHDBOP SLKL P Slick line run #4, Retrieve ball and rod 0.0 0.0 4/30/2023 01:30 4/30/2023 03:00 1.50 COMPZN, WHDBOP SLKL P Slick line run #5, Retrieve RHC Plug. 0.0 0.0 4/30/2023 03:00 4/30/2023 04:30 1.50 COMPZN, WHDBOP SLKL P Slick line run #6, Attempt to retrieve prong, unsuccesfull. 0.0 0.0 4/30/2023 04:30 4/30/2023 07:00 2.50 COMPZN, WHDBOP SLKL P Slick line run #7, LIB run and tag at 9,496' WLM, (9,478' MD) set impression and POOH. Impression looks like tagging on tubing stump. Retrieved brass shear screw. 0.0 0.0 4/30/2023 07:00 4/30/2023 09:30 2.50 COMPZN, WHDBOP SLKL P Slick line run #8, LIB, tagged on stump again - 9,478' MD, retrieved another brass shear screw. 0.0 0.0 4/30/2023 09:30 4/30/2023 11:00 1.50 COMPZN, WHDBOP SLKL P Consult with town on making another attempt or R/D for coil. 0.0 0.0 4/30/2023 11:00 4/30/2023 13:00 2.00 COMPZN, WHDBOP SLKL P Slick line run #9, 3.78 swedge, able to work through top of stump to 9,588 (Saw metal marks that looked like we were at bait sub @ 9,608 MD) 0.0 0.0 4/30/2023 13:00 4/30/2023 15:00 2.00 COMPZN, WHDBOP SLKL P Slick line run # 10, Run a GR pulling tool to attempt to engage bait sub and prong. (pushed something down 2, no catch) 0.0 0.0 4/30/2023 15:00 4/30/2023 16:30 1.50 COMPZN, WHDBOP SLKL P Slick line run #11, Bailer, got down all the way to bait sub/ prong 9,602 SLM (9,602 MD). (Bailer was clean) 0.0 0.0 4/30/2023 16:30 4/30/2023 18:30 2.00 COMPZN, WHDBOP SLKL P Slick line run #12, Running the swage again 3.78 OD to see if all is clear to 9,618'. 0.0 0.0 4/30/2023 18:30 4/30/2023 21:00 2.50 COMPZN, WHDBOP SLKL P Slick line work #13, Run a GR pulling tool to engage bait sub and prong at 9,621'. POOH with Prong. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 Page 8/8 MT7-97 Report Printed: 5/24/2023 Operations Summary (with Timelog Depths) Job: RECOMPLETION Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 4/30/2023 21:00 4/30/2023 23:00 2.00 COMPZN, WHDBOP SLKL P Slick line run #14, Run a PRS pulling tool, latch and pull plug body at 9,626 WLM, Work up hole to 9,435 WLM. Continue attempt to work up hole. Sheared off at 9,435WLM. POOH and redress tools. 0.0 0.0 4/30/2023 23:00 5/1/2023 00:00 1.00 COMPZN, WHDBOP SLKL P L/D tools, Cut and rehead 1.25" slick line. 0.0 0.0 5/1/2023 00:00 5/1/2023 01:30 1.50 COMPZN, WHDBOP SLKL P Slick line work, Run #15 bait sub and PRS pulling tool, latch plug body and attempt to jar free, Sheared off bait sub. POOH 0.0 0.0 5/1/2023 01:30 5/1/2023 04:30 3.00 COMPZN, WHDBOP SLKL P Slick line work, Run #16, GS latch onto plug body, work free and POOH. 0.0 0.0 5/1/2023 04:30 5/1/2023 05:30 1.00 DEMOB, MOVE SLKL P R/D Slick line equipment, Secure well. 0.0 0.0 5/1/2023 05:30 5/1/2023 06:00 0.50 DEMOB, MOVE MOB P R/D prep to MOB to MT7-95 well Released off MT7-97 RWO at 0600hrs 5 -1-23 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 5/1/2023 DTTMSTART JOBTYP SUMMARYOPS 3/13/2023 MAINTAIN WELL LDL THRU PATCH @ 9265' RKB & THRU PACKER @ 9499' RKB, PARTIAL DATA. IN PROGRESS. 3/23/2023 SUPPORT OTHER OPERATIONS UNABLE TO REPAIR 3rd PARTY CRANE ONSITE. IN PROGRESS. 3/24/2023 SUPPORT OTHER OPERATIONS STANDBY FOR NES 3rd PARTY CRANE, SET 4.5" TTS PULLING TOOL ON 4.5" GR ON TOP OF PATCH AT 9,244' RKB. IN PROGRESS. 3/25/2023 SUPPORT OTHER OPERATIONS PULLED 21' TOP SECTION OF 3.76" PIIP PATCH F/ 9,245' RKB, PULLED LOWER PIIP PATCH PACKER F/ 9,266' RKB. IN PROGRESS. 3/26/2023 SUPPORT OTHER OPERATIONS PULLED BALL & ROD F/ 9,615' RKB AND 4.5" RHC F/ 9,606'RKB. ATTEMPT TO SET 3.75" DBP PLUG BODY, CAN NOT WORK PAST 9,571' RKB. IN PROGRESS 3/27/2023 SUPPORT OTHER OPERATIONS RAN FULL BORE BRUSH BETWEEN 9600' RKB AND 9550' RKB. UNABLE TO PUMP DUE TO WELL BORE NOT OPEN TO FORMATION, RAN 3" BAILER TO 9615' RKB, RECOVERED 1 CUP DEHYDRATED DRILLING MUD. ATTEMPT TO SET SET 3.75" DBP PLUG BODY AT 9602' RKB. IN PROGRESS. 3/28/2023 SUPPORT OTHER OPERATIONS PULL 3.75" DBP F/ 9602' RKB. RUN FULL BORE BLB ABOVE 3" BAILER W/ FLAPPER BOTTOM TO 9615' RKB W/ SMALL RETURNS 2 TIMES, ATTEMPT TO SET 3.75" DBP PLUG BODY AT 9602' RKB. IN PROGRESS. 3/29/2023 SUPPORT OTHER OPERATIONS PULLED 3.75" DBP PLUG @ 9602' RKB. RAN 2 3" BALILER RUNS w/ BRUSH TO CLEAN UP NIPPLE. SET 3.75" DBP PLUG ( OA= 28" ) @ 9602' RKB, SET PRONG @ SAME ( OAL= 86" ) OBTAIN PASSING CMIT TO 2500 PSI BLEED TBG TO 500 PSI. READY FOR TBG CUT. IN PROGRESS. 4/4/2023 SUPPORT OTHER OPERATIONS RIG UP ELINE, CUT TUBING AT 9470 FT WITH 3 5/8" CHEMICAL CUTTER, POOH AND BECOME STUCK AT 215'. TROUBLESHOOT LIKELIHOOD OF CABLE STUCK IN GREASEHEAD BASED ON OBSERVED INDICATIONS. UPON FURTHER INVESTIGATION, DETERMINE THAT THE ANCHORS ON THE TOOLSTRING BECAME PRESSURED UP CAUSING A STUCK TOOLSTRING. PRESSURE UP TUBING TO 1000 PSI, TOOLSTRING FREE. ***JOB COMPLETE*** 4/21/2023 RECOMPLETION Finish operations on MT7-11. RDMO. Begin move over MT7-97 4/22/2023 RECOMPLETION Lower mast, and rig down. Move rig off of MT7-11. Move rig over to MT7-97. 4/23/2023 RECOMPLETION Finish moving rig over MT7-97. Rig up, and raise mast. Bring on fluid, test lines. Displace diesel out of well. 4/24/2023 RECOMPLETION Displace well over to sea water. Install and test BPV to 1,000 PSI. N/D Tree install Blanking plug, N/U BOP. Test BOP. Pull BPV. 4/25/2023 RECOMPLETION Attempt to pull tubing. R/U Yellow Jacket E-line. RIH and make second cut. POOH L/D tubing. 4/26/2023 RECOMPLETION POOH L/D 4 1/2" tubing. M/U clean out / Scraper BHA. RIH picking up 4" DP. Tag stump, and confrim @ 9,475'. Dress off stump. 4/27/2023 RECOMPLETION POOH L/D Drill pipe. Pull wear bushing, Jet BOP. R/U and run tubing. 4/28/2023 RECOMPLETION Tag tubing stump, space out. Displace well over to corrosion inhibited brine. Land completion. Set Packer. Test tubing and Packer. Install, and test BPV, N/D BOP's 4/28/2023 SUPPORT OTHER OPERATIONS PLAN & PREP FOR POST RWO ON RIG 4/29/2023 RECOMPLETION N/D BOP's. N/U tree and test. Freeze protect well. Slick line work. 4/29/2023 SUPPORT OTHER OPERATIONS SHAKE OFF BAITED PULLING TOOL @ 6500' SLM. PULL SOV & SET DV @ 3764' RKB. LRS PERFORM PASSING PT TO 4250 PSI ON TBG & IA. PULL B&R & RHC FROM 9418' RKB. ATTEMPT TO PULL BAITED PRONG FROM 9602' RKB BUT SAT DOWN EARLY @ 9478' RKB. TAKE LIB IMPRESSION OF TBG CUT RESTRICTING ACCESS BELOW 9478' RKB. RUN 3.78" TBG SWEDGE TO BREAK THROUGH RESTRICTION BUT UNABLE TO MAKE IT TO PLUG. RUN 3" DRIVE DOWN BAILER AND MAKE HOLE TO 9599' RKB. RE RUN 3.78" SWEDGE AND BEAT IT DOWN TO 9599' RKB. PULL BAITED P-PRONG & DBP PLUG FROM 9602' RKB. ***JOB COMPLETE*** MT7-97 Recompletion Summary of Operations Last Rev Reason Annotation Wellbore End Date Last Mod By Rev Reason: SL completed post RWO work MT7-97 5/1/2023 rmoore22 Notes: General & Safety Annotation End Date Last Mod By Note: Packer leak @ 9498' RKB, stacked new packer on 2023 RWO 3/29/2023 rmoore22 Casing Strings Csg Des OD (in) ID (in) Top (ftKB) Set Depth (ftKB) Set Depth (TVD) (ftKB) Wt/Len (lb/ft) Grade Top Thread Conductor 20 19.00 39.1 120.0 120.0 Surface 13 3/8 12.42 39.1 3,189.0 3,056.4 68.00 L-80 Intermediate 1 9 5/8 8.68 37.3 8,232.6 7,527.5 47.00 T95 Hyd563 Intermediate 2 7 6.18 8,078.4 9,779.0 8,308.4 29.00 L-80 TSH 563 Liner 4 1/2 3.96 9,624.3 19,515.0 8,520.1 12.60 P110 Tubing Strings: string max indicates LONGEST segment of string Top (ftKB) 34.5 Set Depth 9,484.7 Set Depth 8,233.6 String Ma 4 1/2 Tubing Description Tubing Completion Upper Wt (lb/ft) 12.60 Grade L-80 Top Connection Hyd563 ID (in) 3.96 Completion Details: excludes tubing, pup, space out, thread, RKB... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 34.5 34.5 0.00 Hanger 11.000 FMC 4-1/2" Tubing Hanger Hydril HYD 563 FMC TC-EMS 3.958 1,914.3 1,895.7 17.18 Nipple - X 4.500 NIPPLE,LANDING, X, H563 HES X Nipple 3.813 3,764.1 3,573.3 26.19 Mandrel 4.500 4-1/2" x 1" KBG 4-5 GLM 12.6# H563 Camco KBG4-5 3.865 6,573.9 6,100.8 25.57 Mandrel 4.500 4-1/2" x 1" KBG4-5 GLM, 12.6# H563 Camco KBG4-5 3.860 9,141.7 8,101.3 62.68 Mandrel 4.500 4-1/2" x 1" KBG4-5 GLM, 12.6# H563 Camco KBG4-5 3.865 9,288.0 8,163.9 66.61 Gauge / Pump Sensor 4.500 Halliburton Opsis Mandrel w/ Downhole gauge HES DHG 3.920 9,391.8 8,202.8 69.37 Packer 6.180 Halliburton TNT Packer HES TNT 3.880 9,418.8 8,212.1 70.09 Nipple - X 4.500 NIPPLE,LANDING, 4 1/2" X, H563 SLB X 3.813 9,477.6 8,231.4 71.68 Locator 5.500 Baker Poor Boy Overshot, 4-1/2", IBT, Mule shoe, 14k shear, 6.49' swallow Baker PBOS 3.910 Top (ftKB) 9,478.3 Set Depth 9,630.6 Set Depth 8,274.0 String Ma 4 1/2 Tubing Description Tubing Completion Upper Wt (lb/ft) 12.60 Grade L-80 Top Connection Hyd563 ID (in) 3.96 Completion Details: excludes tubing, pup, space out, thread, RKB... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 9,498.7 8,237.9 72.31 Packer 6.180 Halliburton TNT Packer HES TNT 3.880 9,602.1 8,266.7 75.06 Nipple - DB 4.500 NIPPLE,LANDING, DB-6 H563 SLB 3.750 9,627.3 8,273.1 75.57 Mule Shoe 4.500 HES Self indexing Mule Shoe 3.958 Mandrel Inserts : excludes pulled inserts Top (ftKB) Top (TVD) (ftKB) Top Incl (°) St ati on No /S Serv Valve Type Latch Type OD (in) TRO Run (psi) Run Date Com Make Model Port Size (in) 3,764.1 3,573.3 26.19 1 DMY BK 1 4/29/2023 Camco BK 6,573.9 6,100.8 25.57 2 DMY BK 1 4/28/2023 Camco BK 9,141.7 8,101.3 62.68 3 DMY BK 1 4/28/2023 Camco BK Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 9,734.6 8,298.4 76.89 Baffle 5.000 Arsenal 3.510 10,068.5 8,363.4 79.93 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 10,442.1 8,414.4 84.52 Swell Packer 4.500 Baker Water swell 3.900 10,960.4 8,421.7 90.07 Swell Packer 4.500 Baker Water swell 3.900 11,352.9 8,432.8 88.04 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 11,686.9 8,438.3 89.88 Swell Packer 4.500 Baker Water swell 3.900 12,080.5 8,435.0 90.38 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 12,453.3 8,439.0 88.88 Swell Packer 4.500 Baker Water swell 3.900 12,802.8 8,449.6 88.53 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 13,175.5 8,447.3 90.91 Swell Packer 4.500 Baker Water swell 3.900 13,568.8 8,441.6 90.43 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 13,938.9 8,451.5 87.13 Swell Packer 4.500 Baker Water swell 3.900 14,332.6 8,463.8 89.14 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 14,708.0 8,470.4 89.14 Swell Packer 4.500 Baker Water swell 3.900 15,102.0 8,476.2 89.66 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 15,435.8 8,479.1 89.10 Swell Packer 4.500 Baker Water swell 3.900 15,787.7 8,479.1 91.02 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 16,161.8 8,475.8 89.13 Swell Packer 4.500 Baker Water swell 3.900 HORIZONTAL, MT7-97, 5/30/2023 1:05:46 PM Vertical schematic (actual) Liner; 9,624.3-19,515.0 Production String 1 Cement; 9,624.0 ftKB Intermediate 2; 8,078.4-9,779.0 Mule Shoe; 9,627.3 Pup Joint; 9,621.7 Nipple - DB; 9,602.1 Packer; 9,498.7 Locator; 9,477.6 Nipple - X; 9,418.8 Intermediate String 2 Cement; 9,017.0 ftKB Packer; 9,391.8 Mandrel; 9,141.7 Intermediate 1; 37.3-8,232.6 Intermediate String 1 Cement; 5,309.0 ftKB Mandrel; 6,573.9 Mandrel; 3,764.1 Surface; 39.1-3,189.0 Nipple - X; 1,914.3 Surface String Cement; 39.0 ftKB Conductor; 39.1-120.0 Hanger; 34.5 WNS PROD KB-Grd (ft) 39.10 RR Date 3/1/2023 Other Elev MT7-97 ... TD Act Btm (ftKB) 19,517.0 Well Attributes Field Name RENDE Wellbore API/UWI 501032084900 Wellbore Status PROD Max Angle & MD Incl (°) 93.08 MD (ftKB) 18,168.40 WELLNAME WELLBOREMT7-97 Annotation Last WO: End Date 5/1/2023 H2S (ppm) DateComment Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 16,514.1 8,479.5 90.29 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 16,889.7 8,478.8 89.31 Swell Packer 4.500 Baker Water swell 3.900 17,240.4 8,484.1 88.89 FRAC Sleeve/Port 5.000 Adv Upstrea m Limitless 3.510 17,613.5 8,495.8 88.81 Swell Packer 4.500 Baker Water swell 3.900 17,924.4 8,496.2 90.81 Sleeve - Frac 5.000 Baker Alpha 3.000 18,135.5 8,492.6 92.41 Sleeve - Frac 5.000 Baker Alpha 3.000 18,346.6 8,483.8 92.13 Collar - Landing 4.500 Baker Alpha Type II 3.880 HORIZONTAL, MT7-97, 5/30/2023 1:05:47 PM Vertical schematic (actual) Liner; 9,624.3-19,515.0 Production String 1 Cement; 9,624.0 ftKB Intermediate 2; 8,078.4-9,779.0 Mule Shoe; 9,627.3 Pup Joint; 9,621.7 Nipple - DB; 9,602.1 Packer; 9,498.7 Locator; 9,477.6 Nipple - X; 9,418.8 Intermediate String 2 Cement; 9,017.0 ftKB Packer; 9,391.8 Mandrel; 9,141.7 Intermediate 1; 37.3-8,232.6 Intermediate String 1 Cement; 5,309.0 ftKB Mandrel; 6,573.9 Mandrel; 3,764.1 Surface; 39.1-3,189.0 Nipple - X; 1,914.3 Surface String Cement; 39.0 ftKB Conductor; 39.1-120.0 Hanger; 34.5 WNS PROD MT7-97 ... WELLNAME WELLBOREMT7-97 t >>ED W/η^ Zs/ KZ Zη&/ >ED ^ Zs/ ^Z/Wd/KE >/s Z> ^Z/Wd/KE ddzW d >K'' K>KZWZ/Ed^ ƐGMTU MT7-97 50-103-20849-00-00 222-150 GMTU MEMORY SonicScope TOC FINAL FIELD 1GMTU MT7-11 50-103-20850-00-00 223-002 GMTU MEMORY SonicScope TOC FINAL FIELD 1dƌĂŶƐŵŝƚƚĂůZĞĐĞŝƉƚͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ yͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺWƌŝŶƚEĂŵĞ ^ŝŐŶĂƚƵƌĞ ĂƚĞWůĞĂƐĞƌĞƚƵƌŶǀŝĂĐŽƵƌŝĞƌŽƌƐŝŐŶͬƐĐĂŶĂŶĚĞŵĂŝůĂĐŽƉLJƚŽ^ĐŚůƵŵďĞƌŐĞƌ͘sdƵŽŶŐΛƐůď͘ĐŽŵ^>ƵĚŝƚŽƌͲdƌĂŶƐŵŝƚƚĂůZĞĐĞŝƉƚƐŝŐŶĂƚƵƌĞĐŽŶĨŝƌŵƐƚŚĂƚĂƉĂĐŬĂŐĞ;ďŽdž͕ĞŶǀĞůŽƉĞ͕ĞƚĐ͘ͿŚĂƐďĞĞŶƌĞĐĞŝǀĞĚĂŶĚƚŚĞĐŽŶƚĞŶƚƐŽĨƚŚĞƉĂĐŬĂŐĞŚĂǀĞďĞĞŶǀĞƌŝĨŝĞĚƚŽŵĂƚĐŚƚŚĞŵĞĚŝĂŶŽƚĞĚĂďŽǀĞ͘dŚĞƐƉĞĐŝĨŝĐĐŽŶƚĞŶƚŽĨƚŚĞƐĂŶĚͬŽƌŚĂƌĚĐŽƉLJƉƌŝŶƚƐŵĂLJŽƌŵĂLJŶŽƚŚĂǀĞďĞĞŶǀĞƌŝĨŝĞĚĨŽƌĐŽƌƌĞĐƚŶĞƐƐŽƌƋƵĂůŝƚLJůĞǀĞůĂƚƚŚŝƐƉŽŝŶƚ͘η^ĐŚůƵŵďĞƌŐĞƌͲWƌŝǀĂƚĞPTD: 222-150 T37644 PTD: 223-002 T37645MT7-97MT7-11GMTU MT7-9750-103-20849-00-00222-150GMTUMEMORYSonicScope TOCFINAL FIELDKayla JunkeDigitally signed by Kayla Junke Date: 2023.05.16 09:58:45 -08'00' STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION BOPE Test Report for: Reviewed By: P.I. Suprv Comm ________GMTU MT7-97 JBR 05/23/2023 MISC. INSPECTIONS: FLOOR SAFTY VALVES:CHOKE MANIFOLD:BOP STACK: ACCUMULATOR SYSTEM:MUD SYSTEM: P/F P/F P/FP/FP/F Visual Alarm QuantityQuantity Time/Pressure SizeQuantity Number of Failures:0 Tested with 4" and 4 1/2" test joints, Tested all gas alarms and PVT's. Precharge Bottles = 22 each all at 1000psi each. Test Results TEST DATA Rig Rep:Fritts / ColemanOperator:ConocoPhillips Alaska, Inc.Operator Rep:Shirley / Burson Rig Owner/Rig No.:Doyon 25 PTD#:2221500 DATE:4/25/2023 Type Operation:WRKOV Annular: 250/3500Type Test:INIT Valves: 250/3500 Rams: 250/3500 Test Pressures:Inspection No:bopBDB230426090026 Inspector Brian Bixby Inspector Insp Source Related Insp No: INSIDE REEL VALVES: Quantity P/F (Valid for Coil Rigs Only) Remarks: Test Time 5.5 MASP: 3079 Sundry No: 323-157 Control System Response Time (sec) Time P/F Housekeeping:P PTD On Location P Standing Order Posted P Well Sign P Hazard Sec.P Test Fluid W Misc NA Upper Kelly 1 P Lower Kelly 1 P Ball Type 2 P Inside BOP 1 P FSV Misc 0 NA 15 PNo. Valves 1 PManual Chokes 1 PHydraulic Chokes 0 NACH Misc Stripper 0 NA Annular Preventer 1 13 5/8"P #1 Rams 1 2 7/8"x5.5"P #2 Rams 1 Blind/Shear P #3 Rams 1 2 7/8"x5.5 P #4 Rams 0 NA #5 Rams 0 NA #6 Rams 0 NA Choke Ln. Valves 1 3 1/8"P HCR Valves 2 3 1/8"P Kill Line Valves 2 3 1/8"P Check Valve 0 NA BOP Misc 0 NA System Pressure P3000 Pressure After Closure P1650 200 PSI Attained P21 Full Pressure Attained P118 Blind Switch Covers:PYES Bottle precharge P Nitgn Btls# &psi (avg)P6@1983 ACC Misc NA0 P PTrip Tank P PPit Level Indicators P PFlow Indicator P PMeth Gas Detector P PH2S Gas Detector 0 NAMS Misc Inside Reel Valves 0 NA Annular Preventer P22 #1 Rams P14 #2 Rams P17 #3 Rams P15 #4 Rams NA0 #5 Rams NA0 #6 Rams NA0 HCR Choke P2 HCR Kill P2 BOPE Test - Doyon 25 GMTU MT7-97 (PTD 2221500 AOGCC Insp # bopBDB2304260-0026 4/25/2023 MT7-97 RWO 4/25/2023 Tested to 250PSI/5MIN, 3500PSI/10MIN 4.5” Test Jt 1.Annular Preventer, Valves: 1, 13, 14, 15, 4” Kill Line Valve, 4” Dart Valve 2.Upper Pipe Rams (2.87” x 5.5” ), Valves: 2, 10, 12, HCR KILL & 4” FOSV #1 3.Valves: 6, 9 ,11, Manual Kill, 4” FOSV #2 4.Valves 5, 7, 8 & Auto IBOP 5.Valves 3 & 5” MAN IBOP 6.Lower Pipe Rams (2.87” x 5.5” VBR’S) 7.Blind Shear Rams, Valves: 4 8.Manually Operated & Super Choke ( 8B = SUPER Choke – 8A = MANUAL Choke) 4” Test Jt 9.Annular Preventer, HCR Choke 10.Upper Pipe Rams (2.87” x 5.5” VBR’S) & Manual Choke 11.Lower Pipe Rams (2.87” x 5.5” VBR’S) BOPE Test - Doyon 25 GMTU MT7-97 (PTD 2221500 AOGCC Insp # bopBDB2304260-0026 4/25/2023 1a. Well Status:Oil SPLUG Other Abandoned Suspended 1b. Well Class: 20AAC 25.105 20AAC 25.110 Development Exploratory GINJ WINJ WDSPL No. of Completions: __________________ Service Stratigraphic Test 2. Operator Name: 6. Date Comp., Susp., or 14. Permit to Drill Number / Sundry: Aband.: 3. Address: 7. Date Spudded: 15. API Number: 4a. Location of Well (Governmental Section): 8. Date TD Reached: 16. Well Name and Number: Surface: Top of Productive Interval: 2480' FSL, 1242' FWL S5 T9N R2E 9. Ref Elevations: KB: 17. Field / Pool(s): GL: 100.8 BF: Total Depth: 10. Plug Back Depth MD/TVD: 18. Property Designation: 4b. Location of Well (State Base Plane Coordinates, NAD 27): 11. Total Depth MD/TVD: 19. DNR Approval Number: Surface: x- y- Zone- 4 TPI: x- y- Zone- 4 12. SSSV Depth MD/TVD: 20. Thickness of Permafrost MD/TVD: Total Depth: x- y- Zone- 4 5. Directional or Inclination Survey: Yes (attached) No 13. Water Depth, if Offshore: 21. Re-drill/Lateral Top Window MD/TVD: Submit electronic information per 20 AAC 25.050 N/A (ft MSL) 22. Logs Obtained: 23. BOTTOM 20" L-80 120'10yards 13 3/8" L-80 3056' 9 5/8" T-95 7528' 7" L-80 8308' 4 1/2" P110 8520' 24. Open to production or injection? Yes No 25. 26. Was hydraulic fracturing used during completion? Yes No DEPTH INTERVAL (MD) AMOUNT AND KIND OF MATERIAL USED 27. Date First Production: Method of Operation (Flowing, gas lift, etc.): Hours Tested: Production for Gas-MCF: Test Period Casing Press: Calculated Gas-MCF: Oil Gravity - API (corr): Press. 24-Hour Rate ACID, FRACTURE, CEMENT SQUEEZE, ETC. CASING, LINER AND CEMENTING RECORD List all logs run and, pursuant to AS 31.05.030 and 20 AAC 25.071, submit all electronic data within 90 days of completion, 70bbls 15.8ppg Class G8.5"x9 7/8" TUBING RECORD 239bbls of 15.3ppg Class G19515' Lead: 69bbl 13ppg Class G Tail: 153bbl 15.8ppg Class G 8272' 12 1/4" 6 1/8" 9631'4.5 8078'MD/7408'TVD 9499'MD/8238'TVD 9624'MD/8272'TVD BOTTOM 16" Lead: 361.5bbl 11ppg Class G Tail: 72bbl 15.8ppg Class G CASING 501-103-20849-00-00 GMT/MT7-97 1/26/2022 19517'MD/8520'TVD N/A 139.8 P.O.Box 100360, Anchorage, AK 99510-0360 290079 1044' FSL, 2000' FWL S32 T10N R2E 4449' FSL, 412' FWL S16 T9N R2E 2/22/2023 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION WELL COMPLETION OR RECOMPLETION REPORT AND LOG ConocoPhillips Alaska, Inc. WAG Gas 3/1/2023 222-150/323-002 892'MD/889'TVD SETTING DEPTH TVD 5903330 TOP HOLE SIZE AMOUNT PULLEDTOP SETTING DEPTH MD PACKER SET (MD/TVD) 9624' 42" 12.6 5915863 Greater Mooses Tooth/Rendevous Pool AA081800, AA081781 932535000, 932516000 39' 29 39' 8078' 3189' If Yes, list each interval open (MD/TVD of Top and Bottom; Perforation Size and Number; Date perf'd or liner run): WT. PER FT.GRADE 289227 293465 CEMENTING RECORD 5912041 If Yes, list each interval open (MD/TVD of Top and Bottom; Perforation Size and Number; Date perf'd or liner run): Liner: 9624'MD/8272' TVD - 19515'MD/8520'TVD Gas-Oil Ratio:Choke Size: suspension, or abandonment; or within 90 days of acquisition of the log, whichever occurs first. Types of logs to be listed include, but are not limited to: mud log, spontaneous potential, gamma ray, caliper, resistivity, porosity, magnetic resonance, dipmeter, formation tester, temperature, cement evaluation, casing collar locator, jewelry, and perforation record. Acronyms may be used. Attach a separate page only if necessary. N/A GR, RES, DEN, DIR, AZI, PWD, NEU, POR, SONIC, 39' 39' Per 20 AAC 25.283 (i)(2) attach electronic information 47 9779' 37' 7408' 94 68 120' 37' 8233' SIZE DEPTH SET (MD) Sr Res EngSr Pet GeoSr Pet Eng N/A Oil-Bbl: Water-Bbl: Water-Bbl: PRODUCTION TEST N/A Date of Test: Oil-Bbl: Flow Tubing Form 10-407 Revised 10/2022 Due within 30 days of Completion, Suspension, or Abandonment By James Brooks at 2:29 pm, Mar 31, 2023 Completed 3/1/2023 JSB RBDMS JSB 041023 2023 G DSR-4/26/23 Conventional Core(s): Yes No Sidewall Cores: 30. MD TVD Surface Surface 892 889 C-30 1418 1412 2038 2013 3133 3006 K-2 3518 3353 Albian 97 3821 3624 Albian 96 4042 3822 HRZ 8184 7490 Kalubik 8255 7544 Kuparuk C 8364 7627 8367 7629 9812 8316 19517 8520 31. List of Attachments: Directional Survey, Well Schematic, Cement Operations, Operations Summary 32. I hereby certify that the foregoing is true and correct to the best of my knowledge. Contact Name: Jenna Taylor Digital Signature with Date: Contact Phone:907-263-4522 General: Item 1a: Item 1b: Item 4b: Item 9: Item 15: Item 19: Item 20: Item 22: Item 23: Item 24: Item 27: Item 28: Item 30: Item 31: Pursuant to 20 AAC 25.070, attach to this form: well schematic diagram, summary of daily well operations, directional or inclination survey, and other tests as required including, but not limited to: core analysis, paleontological report, production or well test results. Report measured depth and true vertical thickness of permafrost. Provide MD and TVD for the top and base of permafrost in Box 29. Attached supplemental records should show the details of any multiple stage cementing and the location of the cementing tool. If this well is completed for separate production from more than one interval (multiple completion), so state in item 1, and in item 23 show the producing intervals for only the interval reported in item 26. (Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval). Provide a listing of intervals cored and the corresponding formations, and a brief description in this box. Pursuant to 20 AAC 25.071, submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results, including, but not limited to: porosity, permeability, fluid saturation, fluid composition, fluid fluorescence, vitrinite reflectance, geochemical, or paleontology. Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water Injection, Gas Injection, Shut-in, or Other (explain). Provide a listing of intervals tested and the corresponding formation, and a brief summary in this box. Submit detailed test and analytical laboratory information required by 20 AAC 25.071. Review the reporting requirements of 20 AAC 25.071 and, pursuant to AS 31.05.030, submit all electronic data within 90 days of completion, suspension, or abandonment; or 90 days after log acquisition, whichever occurs first. Well Class - Service wells: Gas Injection, Water Injection, Water-Alternating-Gas Injection, Salt Water Disposal, Water Supply for Injection, Observation, or Other. LCU/Miluveach C-10 Report the Division of Oil & Gas / Division of Mining Land and Water: Plan of Operations (LO/Region YY-123), Land Use Permit (LAS 12345), and/or Easement (ADL 123456) number. The Kelly Bushing, Ground Level, and Base Flange elevations in feet above Mean Sea Level. Use same as reference for depth measurements given in other spaces on this form and in any attachments. The API number reported to AOGCC must be 14 digits (ex: 50-029-20123-00-00). This form and the required attachments provide a complete and concise record for each well drilled in Alaska. Submit a current well schematic diagram with each 10-407. Submit 10-407 and attachments in PDF format to aogcc.permitting@alaska.gov. All laboratory analytical reports from a well must be submitted to the AOGCC, no matter when the analyses are conducted per 20 AAC 25.071. Information to be attached includes, but is not limited to: summary of daily operations, wellbore schematic, directional or inclination survey, as-built, core analysis, paleontological report, production or well test results, per 20 AAC 25.070. Multiple completion is defined as a well producing from more than one pool with production from each pool completely segregated. Each segregated pool is a completion. TPI (Top of Producing Interval). Authorized Name and INSTRUCTIONS Contact Email: jenna.l.taylor@conocophillips.com Authorized Title: Wells Analyst K-3 If Yes, list formations and intervals cored (MD/TVD, From/To), and briefly summarize lithology and presence of oil, gas or water (submit separate pages if needed). Submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results per 20 AAC 25.071 no matter when acquired. Formation Name at TD: Kingak E Yes No Well tested? Yes No 28. CORE DATA If Yes, list intervals and formations tested, briefly summarizing test results for each. Attach separate pages if needed and submit detailed test info including reports and Excel or ASCII tables per 20 AAC 25.071. NAME Permafrost - Top Permafrost - Base 29. GEOLOGIC MARKERS and POOL BOUNDARIES: (list all encountered) FORMATION TESTS Top of Productive Interval: Alpine C Form 10-407 Revised 10/2022 Submit in PDF format to aogcc.permitting@alaska.gov Digitally signed by Jenna Taylor DN: CN=Jenna Taylor, E=jenna.l.taylor@conocophillips.com Reason: I am the author of this document Location: Date: 2023.03.31 10:55:18-08'00' Foxit PDF Editor Version: 12.0.1 Jenna Taylor MT 7 - 9 7 So u t h e r n P r o d u c e r AC T U A L – A s D r i l l e d RK B = 1 3 9 . 6 ' A M S L JJ L – 0 3 / 0 1 / 2 0 2 3 To p S u b A l b i a n 9 3 58 0 9 ' M D / 5 4 1 2 ' T V D To p H R Z 81 8 4 ' M D / 7 4 9 0 ' T V D To p A l p i n e D 96 4 8 ' M D / 8 2 7 8 ' T V D To p A l p i n e C 98 1 2 ' M D / 8 3 1 6 ' T V D 20 " 9 4 p p f H - 4 0 I n s u l a t e d C o n d u c t o r 80 ' M D / T V D - C e m e n t e d t o s u r f a c e In t e r m e d i a t e I C a s i n g 9- 5 / 8 " 4 3 . 5 # L 8 0 H 5 6 3 | 9 - 5 / 8 " 4 7 # T 9 5 H 5 6 3 ( 5 0 0 0 ' ) 82 3 3 ' M D / 7 5 2 8 ' T V D 4- ½ " 1 2 . 6 # P 1 1 0 S H 5 6 3 1 A r s e n a l F l o t a t i o n S u b / 1 1 S w e l l P a c k e r s / 1 0 A d v a n c e d U p s t r e a m F r a c S l e e v e s / 1 A l p h a L a n d i n g C o l l a r 2 A l p h a T o e S l e e v e s / 1 C i t a d e a l M O A S F l o a t S h o e 5" x 7 " H R D E Z X H D L i n e r T o p P K R 96 2 4 ' M D / 8 2 7 2 ' T V D TO C : Li n e r T o p | 1 5 . 3 p p g G a s B L O K 7" x 4 - ½ ” Pr o d u c t i o n P a c k e r 94 9 9 ' M D / 8 2 3 8 ' T V D 4- 1 / 2 " 1 2 . 6 # P 1 1 0 S H Y D 5 6 3 19 5 1 0 ' M D / 8 5 2 0 ' T V D 6- 1 / 8 ” P r o d u c t i o n H o l e 19 5 1 7 ' M D / 8 5 2 0 ' T V D Su r f a c e C a s i n g 13 - 3 / 8 " 6 8 # L 8 0 H 5 6 3 32 0 1 ' M D / 3 0 6 7 ' T V D TO C : Ce m e n t e d t o S u r f a c e Le a d : 1 1 . 0 p p g D e e p C R E T E | T a i l : 1 5 . 8 p p g C l a s s G In t e r m e d i a t e I I L i n e r 7" 2 9 # L 8 0 H 5 6 3 | 7 " 2 9 # T N - 1 1 0 S S T S - B l u e ( 7 0 0 ' ) 97 7 9 ' M D / 8 3 0 6 ' T V D TO C – 5 0 0 ' A b o v e S u b - A l b i a n 9 3 42 6 0 ' M D / 4 0 1 8 ' T V D Le a d : 1 3 . 0 p p g C l a s s G | T a i l : 1 5 . 8 p p g C l a s s G TO C – 5 0 0 ' A b o v e A l p i n e D 83 3 5 ' M D / 7 6 0 7 ' T V D Ta i l : 1 5 . 8 p p g C l a s s G 4- ½ ” 1 2 . 6 # L8 0 H 5 6 3 T u b i n g UP P E R C O M P L E T I O N : 1. 4 - ½ ” X L a n d i n g N i p p l e ( 3 . 8 1 3 " I D ) 1 8 7 2 ' M D / 1 8 5 5 ’ T V D 2. 4 - ½ ” x 1 " K B G 4 - 5 ( 3 x – 1 S O V , 2 D V ) 3 7 1 8 ' M D / 3 5 3 2 ‘ T V D 65 2 4 ' M D / 6 0 5 6 ‘ T V D 92 5 1 ' M D / 8 1 4 9 ‘ T V D 3. H E S O p s i s D o w n h o l e G a u g e 9 3 9 8 ' M D / 8 2 0 5 ’ T V D 4. H E S T N T P a c k e r 9 4 9 9 ' M D / 8 2 3 8 ’ T V D 5. 4 - ½ ” DB L a n d i n g N i p p l e ( 3 . 7 5 " I D ) 9 6 0 2 ' M D / 8 2 6 7 ’ T V D 6. 4 - ½ ” Tu b i n g T a i l ( B o t t o m ) 9 6 3 1 ' M D / 8 2 7 4 ' T V D 7" x 9 - 5 / 8 " H R D E S L Z X P L i n e r T o p P K R 80 7 8 ' M D / 7 4 0 8 ' T V D Page 1/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/24/2023 06:00 1/24/2023 07:00 1.00 MIRU, MOVE DMOB P Prep to scope down derrick and Prep casing and pipe shed to move. 0.0 0.0 1/24/2023 07:00 1/24/2023 08:00 1.00 MIRU, MOVE DMOB P Scope down derrick, Bridle top drive and pin in layover position. SIMOPS: Blow down all service lines. 0.0 0.0 1/24/2023 08:00 1/24/2023 09:30 1.50 MIRU, MOVE DMOB P Blow down steam lines to rig floor, Secure energy track, secure top drive. 0.0 0.0 1/24/2023 09:30 1/24/2023 11:30 2.00 MIRU, MOVE DMOB P Raise C-Section and lower cattel chute to pipe shed. 0.0 0.0 1/24/2023 11:30 1/24/2023 12:00 0.50 MIRU, MOVE DMOB P Prep to skid rig floor and Stomp casing module from pipe shed. 0.0 0.0 1/24/2023 12:00 1/24/2023 14:30 2.50 MIRU, MOVE DMOB P PJSM, skid rig floor and comtinue stomp casing module, 0.0 0.0 1/24/2023 14:30 1/24/2023 17:00 2.50 MIRU, MOVE DMOB P Stomp motor, pump and pit module. Raise well house and secure. 0.0 0.0 1/24/2023 17:00 1/24/2023 21:00 4.00 MIRU, MOVE DMOB P UNpin pipe shed from sub, Stomp pipe shed away from sub and turn into position. 0.0 0.0 1/24/2023 21:00 1/24/2023 23:00 2.00 MIRU, MOVE MOB P Stomp casing and pipe shed into positionat MT7-97 well. 0.0 0.0 1/24/2023 23:00 1/25/2023 00:00 1.00 MIRU, MOVE MOB P Prep and lay rig mats into position on MT7-97 well. 0.0 0.0 1/25/2023 00:00 1/25/2023 03:00 3.00 MIRU, MOVE MOB P Stomp and align Sub with MT7-97 well SIMOPS: Stomp pipe shed. 0.0 0.0 1/25/2023 03:00 1/25/2023 04:00 1.00 MIRU, MOVE MOB P Stomp Sub and center on MT7-97 well. 0.0 0.0 1/25/2023 04:00 1/25/2023 10:30 6.50 MIRU, MOVE MOB P Continue Stomp pipe shed and pit module into position and pin to Sub. SIMOPS: plugging in electrical 0.0 0.0 1/25/2023 10:30 1/25/2023 14:00 3.50 MIRU, MOVE MOB P Spot pump and motor module, Install energy tray to pump module, Stomp and spot casing module 0.0 0.0 1/25/2023 14:00 1/25/2023 15:00 1.00 MIRU, MOVE RURD P Raise derrick and secure rig floor. 0.0 0.0 1/25/2023 15:00 1/25/2023 16:00 1.00 MIRU, MOVE RURD P Skid rig floor to drilling position, Install hand rails and walk ways. 0.0 0.0 1/25/2023 16:00 1/25/2023 17:00 1.00 MIRU, MOVE RURD P Lower C section and install cushing and chinking. SIMOPS: Installing mud lines in pump room. 0.0 0.0 1/25/2023 17:00 1/25/2023 18:30 1.50 MIRU, MOVE RURD P Raise cattle chute, install roof covers. SIMOPS: installing pit room lines, energize steam to rig and plugging in modules. 0.0 0.0 1/25/2023 18:30 1/25/2023 20:00 1.50 MIRU, MOVE RURD P Lower cellar and unpin and raise cylinders in close position. SIMOPS: PJSM on scoping derrick, Installed well sign, continue installing mud lines. 0.0 0.0 1/25/2023 20:00 1/25/2023 21:30 1.50 MIRU, MOVE RURD P Bridle up and scope up derrick, Secure derrick and R/D bridle lines. 0.0 0.0 1/25/2023 21:30 1/26/2023 00:00 2.50 MIRU, MOVE RURD P Hook up kelly hose and install shock hose on rig floor. SIMOPS: Install floor in well house and continue hooking up interconnects lines. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 2/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/26/2023 00:00 1/26/2023 01:00 1.00 MIRU, MOVE RURD P Continue R/U and working on rig acceptance checklist. Rig Accepted at 0100hrs 01/26/23 0.0 0.0 1/26/2023 01:00 1/26/2023 07:30 6.50 MIRU, MOVE NUND P N/U 21-1/4" riser and annular, Install bell nipple, seal rotary pan, Install drain lines and flow line. SIMOPS: Taking on mud to pits. Loading casing shed with BHA, change liners in #2 mud pump tp 6.5" 0.0 0.0 1/26/2023 07:30 1/26/2023 08:30 1.00 MIRU, MOVE RURD P Re-aline kelly hose on top drive, Install master bushings, Install 2" 1502 plug valve on riser adaptor port. 0.0 0.0 1/26/2023 08:30 1/26/2023 11:00 2.50 MIRU, MOVE RURD P Move all 5" handling equipment to rig floor and take RKB's. SIMOPS: install 90' mouse hole. 0.0 0.0 1/26/2023 11:00 1/26/2023 11:30 0.50 MIRU, MOVE SVRG P Service ST-80 0.0 0.0 1/26/2023 11:30 1/26/2023 13:00 1.50 MIRU, MOVE BHAH P P/U and rack back 4 stands 5" HWT and jars. 0.0 0.0 1/26/2023 13:00 1/26/2023 16:15 3.25 MIRU, MOVE BHAH P P/U and build spud BHA, tag at 90' MD, Pump and fill hole wit 40bbls, Pressure test surface lines to 3500psi. 0.0 90.0 1/26/2023 16:15 1/26/2023 17:30 1.25 MIRU, MOVE RGRP T Repair leak on cutting pit discharge line. 90.0 90.0 1/26/2023 17:30 1/26/2023 18:00 0.50 MIRU, MOVE WASH P Wash in hole sit 16" bit and clean out assy from 90' MD to 120' MD. WOB: 0k GPM: 550 PSI: 740 RPM: 55 TQ on: 5k ft/lbs TQ off: 5k ft/lbs F/O: 42% MW: 8.8 to 9.0 ppg PU: 48k SO: 55k ROT: 50k 90.0 120.0 1/26/2023 18:00 1/26/2023 19:30 1.50 SURFAC, DRILL DRLG P Drill 16" hole from 120' MD to 244' MD. WOB: 6k GPM: 550 PSI: 740 RPM: 55 TQ on: 5k ft/lbs TQ off: 5k ft/lbs F/O: 42% MW: 8.8 to 9.0 ppg PU: 48k SO: 55k ROT: 50k 120.0 244.0 1/26/2023 19:30 1/26/2023 20:00 0.50 SURFAC, DRILL BKRM P BROOH from 244' MD to 64' MD GPM: 500 PSI: 620 RPM: 55 244.0 64.0 1/26/2023 20:00 1/27/2023 00:00 4.00 SURFAC, DRILL BHAH P Continue P/U BHA #1 64.0 64.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 3/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/27/2023 00:00 1/27/2023 01:00 1.00 SURFAC, DRILL BHAH P Continue P/U BHA #1, Survey at conductor. 64.0 244.0 1/27/2023 01:00 1/27/2023 03:30 2.50 SURFAC, DRILL DDRL P Drill 16" hole from 244' MD to 514' MD. WOB: 6k GPM: 700 PSI: 1450 RPM: 56 TQ on: 5k ft/lbs TQ off: 5k ft/lbs F/O: 100% MW: 11.0 ppg PU: 48k SO: 55k ROT: 50k 244.0 514.0 1/27/2023 03:30 1/27/2023 04:30 1.00 SURFAC, DRILL CIRC T Circulate at 514' MD, Lost 104bbls down hole. Checked cellars (all ok) Reduce pump to 500gpm 750psi, Stage pump rate back to 700gpm 1315psi. 514.0 514.0 1/27/2023 04:30 1/27/2023 06:00 1.50 SURFAC, DRILL LOSU P Drill 16" hole from 514' MD to 610' MD. WOB: 5k GPM: 710 PSI: 1330 RPM: 55 TQ on: 6k ft/lbs TQ off: 3k ft/lbs F/O: 99% MW: 11.0 ppg PU: 84k SO: 87k ROT: 85k AST: 0.7hrs ART: 2.0hrs ADT: 2.7hrs 514.0 610.0 1/27/2023 06:00 1/27/2023 12:00 6.00 SURFAC, DRILL DDRL P Drill 16" hole from 610' MD to 1,054' MD 1,050' TVD. WOB: 8k GPM: 850 PSI: 2125 RPM: 55 TQ on: 5k ft/lbs TQ off: 3k ft/lbs F/O: 45% MW: 11.0 ppg PU: 98k SO: 102k ROT: 100k AST: 1.0hrs ART: 2.8hrs ADT: 3.8hrs Total bit: 53.3hrs Total jar: 8.3hrs 610.0 1,054.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 4/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/27/2023 12:00 1/27/2023 18:00 6.00 SURFAC, DRILL DDRL P Drill 16" hole from 1,054' MD 1,050' TVD to 1,457' MD 1,450' TVD. WOB: 8k GPM: 850 PSI: 2125 RPM: 55 TQ on: 5k ft/lbs TQ off: 3k ft/lbs F/O: 45% MW: 11.0 ppg PU: 98k SO: 102k ROT: 100k AST: 1.0hrs ART: 2.8hrs ADT: 3.8hrs Total bit: 53.3hrs Total jar: 8.3hrs 1,054.0 1,457.0 1/27/2023 18:00 1/28/2023 00:00 6.00 SURFAC, DRILL DDRL P Drill 16" hole from 1,457' MD 1,450' TVD to 2,198' MD 2,162' TVD. WOB: 4k GPM: 900 PSI: 2445 RPM: 65 TQ on: 7k ft/lbs TQ off: 5k ft/lbs F/O: 49% MW: 11.1 ppg PU: 98k SO: 102k ROT: 100k AST: 1.6hrs ART: 3.0hrs ADT: 4.6hrs Total bit: 57.9hrs Total jar: 12.9hrs 1,457.0 2,198.0 1/28/2023 00:00 1/28/2023 06:00 6.00 SURFAC, DRILL DDRL P Drill 16" hole from 2,198' MD 2,162' TVD to 2898' MD 2,788' TVD. WOB: 21k GPM: 900 PSI: 2760 RPM: 65 TQ on: 9k ft/lbs TQ off: 3k ft/lbs F/O: 71% MW: 11.0 ppg PU: 118k SO: 121k ROT: 122k AST: 0.6hrs ART: 3.4hrs ADT: 4.0hrs Total bit: 61.9hrs Total jar: 16.9hrs 2,198.0 2,898.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 5/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/28/2023 06:00 1/28/2023 09:00 3.00 SURFAC, DRILL DDRL P Drill 16" hole from 2898' MD 2,788' TVD. TVD to 3,201' MD 3,067' TVD. (TD of hole section) WOB: 14k GPM: 900 PSI: 2690 RPM: 65 TQ on: 8k ft/lbs TQ off: 3k ft/lbs F/O: 71% MW: 11.0 ppg PU: 118k SO: 121k ROT: 126k AST: 0.0hrs ART: 2.1hrs ADT: 2.1hrs Total bit: 64.0hrs Total jar: 19.0hrs 2,898.0 3,201.0 1/28/2023 09:00 1/28/2023 10:30 1.50 SURFAC, TRIPCAS CIRC P Circulate and pump 2-low vis NP sweeps whild racking back 1std/BTM's up. GPM: 900 PSI: 2530 RPM: 40 TQ: 3.5k ft/lbs 3,201.0 3,050.0 1/28/2023 10:30 1/28/2023 11:00 0.50 SURFAC, TRIPCAS OWFF P OWFF (Static) 3,050.0 3,050.0 1/28/2023 11:00 1/28/2023 12:00 1.00 SURFAC, TRIPCAS BKRM P BROOH from 3,050' MD to 2,750' MD GPM: 900 PSI: 2500 RPM: 40 TQ: 4.5k ft/lbs 3,050.0 2,750.0 1/28/2023 12:00 1/28/2023 20:00 8.00 SURFAC, TRIPCAS BKRM P BROOH from 2,750' MD to 610' MD, CIRC 2 BTM's up while pulling last stand. GPM: 900/700 in permafrost. PSI: 2500 RPM: 40 TQ: 4.5k ft/lbs 2,750.0 610.0 1/28/2023 20:00 1/28/2023 20:15 0.25 SURFAC, TRIPCAS OWFF P OWFF (Static) 610.0 610.0 1/28/2023 20:15 1/28/2023 22:00 1.75 SURFAC, TRIPCAS BKRM P Attempt to pull, Mud moving with pipe. Continue BROOH from 608' MD to 242' MD. Encountered 40bbls mud loss down hole at 480' MD, Pumped 30bbls 5#/bbls NP,SAP and Soap, Extingushed losses. Increase of cutting out hole. Continue BROOH to DC. Cuttings minimum at shakers at 242' MD. GPM: 900/700 PSI: 2530/1180 RPM: 40 TQ: 3.5k ft/lbs 610.0 242.0 1/28/2023 22:00 1/29/2023 00:00 2.00 SURFAC, TRIPCAS BHAH P OWFF (static) L/D surface BHA #1, All BHA componets were clean. 242.0 0.0 1/29/2023 00:00 1/29/2023 01:00 1.00 SURFAC, CASING CLEN P Clean and clear rig floor. 0.0 0.0 1/29/2023 01:00 1/29/2023 02:30 1.50 SURFAC, CASING RURD P R/U 13-3/8" casing running equipment. PJSM-running surface casing. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 6/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/29/2023 02:30 1/29/2023 06:00 3.50 SURFAC, CASING PUTB P Make up 13-5/8" 68ppf L-80 H563 shoe track, Baker-loc to joint #4 and circulate shoe track. (all ok) Increased MU torque to 30k. Continue RIH to 980' MD. 0.0 980.0 1/29/2023 06:00 1/29/2023 12:00 6.00 SURFAC, CASING PUTB P Continue run 13-3/8" 68ppf L-80 H563 casing from 980' MD to 2,580' MD SO: 167k 980.0 2,580.0 1/29/2023 12:00 1/29/2023 13:45 1.75 SURFAC, CASING PUTB P Continue run 13-3/8" 68ppf L-80 H563 casing from 2,580' MD to 3,131' MD SO: 185k 2,580.0 3,131.0 1/29/2023 13:45 1/30/2023 00:00 10.25 SURFAC, CASING OTHR T Stage pumps up from 1bpm to 6bpm 94psi/140psi, Wash and rotate casing down from 3,131' MD to 3,190' MD. Pumped 2 - 40bbl sweeps (3p/bbls NP, SAP and Soap) PU: 275k SO: 187k ROT: 212k GPM: 248/294 PSI: 140/156 ROT: 15 TQ: 12/15k ft/lbs 3,131.0 3,190.0 1/30/2023 00:00 1/30/2023 01:00 1.00 SURFAC, CASING OTHR T Wash and rotate casing down from 3,190' MD to 3,194' MD. PU: 275k SO: 187k ROT: 212k GPM: 248/294 PSI: 140/156 ROT: 15 TQ: 12/15k ft/lbs 3,190.0 3,194.0 1/30/2023 01:00 1/30/2023 02:30 1.50 SURFAC, CASING PULD P POOH and L/D 2- joints 13-3/8" casing, M/U FMC hanger. Break circulation at 3bpm 102psi and land hanger with 188k. 3,194.0 3,189.0 1/30/2023 02:30 1/30/2023 03:30 1.00 SURFAC, CEMENT CIRC P Stage pumps up to 7 BPM. Circulate and condition mud. Reciprocating casing 5/10' 7bpm PSI 213k PU 185k SO 3,189.0 3,189.0 1/30/2023 03:30 1/30/2023 04:00 0.50 SURFAC, CEMENT PRTS P R/U cement lines, Break circulation and test lines to 4500psi. 3,189.0 3,189.0 1/30/2023 04:00 1/30/2023 07:30 3.50 SURFAC, CEMENT CMNT P Mix and pump 100 bbls of 11.0 ppg Mud Push II @ 4.5 bbls/min, 400 psi, Dropped bottom plug, Add two gallions dye. Start batching lead. Pump 361.5 bbls of 11.0 ppg DeepCRETE cement at 5.3 bbls/min, 470 psi ICP. Batch and pump 72 bbls of G Blend Tail 15.8 ppg cement @ 4.0 bbls/min, 312 psi. Drop top plug & kick out with 20 bbls of fresh H2O. Swap to rig & displace @ 8 bbls/min, 222 psi ICP, 563 psi FCP. Slow pumps 20 bbls prior to calculated bump to 3 bbls/min, 353 psi ICP, Bump plug with 914 psi (444 bbls + 20 bbls). 3751 strokes, final circ. PSI 353 Pressure up to 915 psi & hold for 5 minutes. Bleed off pressure, Check floats good. 120 bbls cement to surface. Cement in place @ 07:17hrs 1/30/23 3,189.0 3,189.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 7/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/30/2023 07:30 1/30/2023 09:00 1.50 SURFAC, CEMENT PRTS P Drain and flush stack with black water, Pressure test casing to 3575psi 30min. pressure 3530psi. pumped 12.3bbls returned 7.0bbls Final pressure 3130psi 3,189.0 3,189.0 1/30/2023 09:00 1/30/2023 10:30 1.50 SURFAC, CEMENT RURD P Remove landing joint and R/D casing equipment. Clear rig floor. 3,189.0 3,189.0 1/30/2023 10:30 1/30/2023 11:00 0.50 SURFAC, CEMENT CLEN P Remove master bushings and clean flow box and jet flow line. Blow down surface equipment. 3,189.0 3,189.0 1/30/2023 11:00 1/30/2023 14:00 3.00 SURFAC, WHDBOP NUND P Flush riser and cap 4" conductor lines, N/D surface riser. 3,189.0 0.0 1/30/2023 14:00 1/30/2023 16:30 2.50 SURFAC, WHDBOP NUND P NU and orientate WH. Test seals to 1000psi (CPAI witnessed) 0.0 0.0 1/30/2023 16:30 1/30/2023 22:00 5.50 SURFAC, WHDBOP NUND P Nipple up drilling riser & BOPE SIMOPS- Clean pits, slide Joe's box, install flow line, choke & kill lines, N/U MPD equipment NOTE: Rig contract 15hrs to N/U and test BOPs Time started at 1630hrs 1-30- 23 0.0 0.0 1/30/2023 22:00 1/31/2023 00:00 2.00 SURFAC, WHDBOP PRTS P Set test plug and install MPD test cap. Attempt to test to 250/1250psi, pressure bleeding off. Trouble shoot same. 0.0 0.0 1/31/2023 00:00 1/31/2023 02:00 2.00 SURFAC, WHDBOP PRTS P Tighted Annular cap, Attempt to retest to 250/1250psi, Slight leak. 0.0 0.0 1/31/2023 02:00 1/31/2023 03:00 1.00 SURFAC, WHDBOP RURD P Pull MPD test cap and install trip nipple 0.0 0.0 1/31/2023 03:00 1/31/2023 04:00 1.00 SURFAC, WHDBOP BOPE P Install 9-5/8" test joint, Attempt to test annular to 3500psi, Annular cap leaking. Continue trouble shooting leak. Leak on Oteco connection on kill line. 0.0 0.0 1/31/2023 04:00 1/31/2023 06:00 2.00 SURFAC, WHDBOP BOPE P Continue shell test to 3500psi, Leak on Oteco connection. Isolate kill line and retest. Retest Annular to 3500psi, (good test but still leaking on annular cap above annular seal) 0.0 0.0 1/31/2023 06:00 1/31/2023 07:30 1.50 SURFAC, WHDBOP OTHR P Blow down surface lines and change out Oteco ring on kill line. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 8/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/31/2023 07:30 1/31/2023 09:30 2.00 SURFAC, WHDBOP BOPE P Continue test BOP's while gathering equipment to change annular element and seals. Set 9-5/8" test joint and test annular 250/3500psi 5/10min. test choke valves 1,2,3,5,6,7,8,9,10,11,12,13,14,15, UPR 9 5/8" SBR, Kill manual and HCR, 4" kill line valve, 2 5" FOSV 1- 5" IBOP, Upper and lower IBOP on top drive, Perform KOOMEY drawdown, ACC = 2950 PSI. MANIF. = 1450 PSI. ACC = 1800 PSI After all functions on bottles, 13 sec for 200 psi. Build W/ 2 Elec. pumps, 76 sec T/ Build full system. Pressure W/ 2 Elec. & 2 Air pumps, Closing times, Annular = 22 sec. UPR = 17 sec. Blind / Shears = 16 sec. LPR = 16 sec. Choke HCR = 2 Ssec. Kill HCR = 2 sec; Test PVT G/L and flow out alarms, Test LEL and H2S alarms. NOTE: Rig contract 15hrs for N/U and test BOPs. Time started at 1630hrs 1-30-23, Two hours were spent working on MPD per CPAI request. Start of Down Time as per contract start 0930 hrs 1-31- 2023. 0.0 1/31/2023 09:30 1/31/2023 12:00 2.50 SURFAC, WHDBOP RGRP T Continue test BOP's while gathering equipment to change annular element and seals. Set 9-5/8" test joint and test annular 250/3500psi 5/10min. test choke valves 1,2,3,5,6,7,8,9,10,11,12,13,14,15, UPR 9 5/8" SBR, Kill manual and HCR, 4" kill line valve, 2 5" FOSV 1- 5" IBOP, Upper and lower IBOP on top drive, Perform KOOMEY drawdown, ACC = 2950 PSI. MANIF. = 1450 PSI. ACC = 1800 PSI After all functions on bottles, 13 sec for 200 psi. Build W/ 2 Elec. pumps, 76 sec T/ Build full system. Pressure W/ 2 Elec. & 2 Air pumps, Closing times, Annular = 22 sec. UPR = 17 sec. Blind / Shears = 16 sec. LPR = 16 sec. Choke HCR = 2 Ssec. Kill HCR = 2 sec; Test PVT G/L and flow out alarms, Test LEL and H2S alarms. NOTE: Rig contract 15hrs for N/U and test BOPs. Time started at 1630hrs 1-30-23, Two hours were spent working on MPD per CPAI requiest. Start of Down Time as per contract start 0930 hrs 1-31- 2023. 0.0 0.0 1/31/2023 12:00 1/31/2023 20:00 8.00 SURFAC, WHDBOP RGRP T Blow down surface eqiopment. R/D MPD housing and remove annular cap. Observe top seal rolled and damaged. Clean and replace element and seals. Install annular cap and torque same. 0.0 0.0 1/31/2023 20:00 1/31/2023 22:00 2.00 SURFAC, WHDBOP RGRP T Fill BOP's with water and perge air from system. Trouble shoot leak. Top off OA with water, (no leak on test plug) 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 9/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 1/31/2023 22:00 2/1/2023 00:00 2.00 SURFAC, WHDBOP RGRP T Pressure up BSR to 250psi 5 min good test, 5000psi, Pressure bleeding down at 5000psi, Trouble shoot and found BSR leaking. Drained stack and pull BSR, seal cut on BSR top seal. 0.0 0.0 2/1/2023 00:00 2/1/2023 03:00 3.00 SURFAC, WHDBOP RGRP T Pull BSR, seal cut on BSR top seal. Change out ram elements and Inspect ram cavity. Found blind/Shear ram blocked cracked. 0.0 0.0 2/1/2023 03:00 2/1/2023 05:00 2.00 SURFAC, WHDBOP RGRP T Consult with town, Change UPR from 9- 5/8" fix to 2-7/8" X 5-1/2" VBR's. Install Blind ram in place of blind/shear rams. Install test plug, fill stack with water. Purge air from system. 0.0 0.0 2/1/2023 05:00 2/1/2023 12:00 7.00 SURFAC, WHDBOP RGRP T Test BOPE: all tests 250 psi low for 5 min, 5,000 psi high for 10 minutes with exception to annular preventor and manual and super choke - test annular to 250 psi low for 5 min and 5000 psi high for 10 min, test manual and super choke to 250 psi low and 2,000 psi high for 5 min each test. Test annular and 2 7/8" x 5 1/2" UPR and LPR with 5" test joint, test choke valves 1-15, manual and super choke. kill line manual's and HCR's, 4" valve on kill line, 2 x 4" FOSV, IBOP dart valve, upper and lower IBOP, blind/shear rams. Perform Koomey drawdown, ACC=3000 psi, manifold=1450 psi initial. After all functions, accumulator=1650 psi, 16 sec's to 200 psi with two electric pumps, 96 sec's to build to full system pressure with two electric and two air pumps. Closing times, annular=26 sec's, UPR=14 sec's, blind/shears=14 sec's, LPR=14 sec's, choke HCR=3 sec's, kill HCR=3 sec's. 6 Nitrogen bottles back- up avg=2091 psi, CPAI witnessed. Tested PVT, gain/loss, flow out, LEL and H2S alarms. AOGCC waived witness per Ken ST. John @ 06:40hrs on 1-27- 23 per email.BLM Quinn M Sawyer waived witness 1-27-23 at 0709hrs. Note: HCR valve failed. Replaced valve. 0.0 0.0 2/1/2023 12:00 2/1/2023 16:30 4.50 SURFAC, WHDBOP RGRP T Attempt to test HCR valve on choke line. Failed greased and attempt again. Blow down lines and replace HCR valve. 0.0 0.0 2/1/2023 16:30 2/1/2023 19:30 3.00 SURFAC, WHDBOP RGRP T Test choke line manual and HCR valve. 250psi/5000psi 5/10 min ea. Bleed off pressure. Rig down test equipment. Blow down choke/kill lines and manifold. 0.0 0.0 2/1/2023 19:30 2/1/2023 21:00 1.50 SURFAC, WHDBOP MPDA P Retrieve trip nipple. Install MPD test cap. RU to test. Flood lines. Observed leak at flange on Orbit valve. SD and tighten flange. Test MPD 250psi/1250psi low/high 5/10 min ea. Bleed off pressure. Rig down test equipment. Retrieve test cap and install trip nipple. 0.0 0.0 2/1/2023 21:00 2/1/2023 22:00 1.00 SURFAC, WHDBOP NUND P Retrieve test plug. Drain stack. Install 12.375" wear bushing. 0.0 0.0 2/1/2023 22:00 2/2/2023 00:00 2.00 SURFAC, DRILLOUT BHAH P PJSM. MU and RIH w/ BHA #2. Interm 1 to 98'. 0.0 98.0 2/2/2023 00:00 2/2/2023 01:00 1.00 SURFAC, DRILLOUT BHAH P RIH w/ Interm 1 BHA f/ 98' to 559' 98.0 559.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 10/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/2/2023 01:00 2/2/2023 02:00 1.00 SURFAC, DRILLOUT TRIP P RIH Interm 1 BHA on DP f/ 559' to 2900'. 559.0 2,900.0 2/2/2023 02:00 2/2/2023 02:30 0.50 SURFAC, DRILLOUT DHEQ P Shallow test MWD. 2,900.0 2,900.0 2/2/2023 02:30 2/2/2023 03:00 0.50 SURFAC, DRILLOUT SFTY P Perform choke drill w/ crew. 2,900.0 2,900.0 2/2/2023 03:00 2/2/2023 03:30 0.50 SURFAC, DRILLOUT WASH P Wash down and tag @ 3070'. 84 GPM 85 PSI 2,900.0 3,070.0 2/2/2023 03:30 2/2/2023 08:30 5.00 SURFAC, DRILLOUT DRLG P Drill out cement/FC shoetrack/FS. Clean out rathole and drill 20' new formation to 3221' 645 GPM 1180 PSI 70 RPM 7k TQ 5-10k WOB 11.20ppg ECD 3,070.0 3,221.0 2/2/2023 08:30 2/2/2023 09:00 0.50 SURFAC, DRILLOUT CIRC P Circulate and BROOH to back inside casing @ 3130 3,221.0 3,130.0 2/2/2023 09:00 2/2/2023 10:00 1.00 SURFAC, DRILLOUT FIT P RU test equipment. Perform FIT to 18.6ppg EMW. 2.1 bbls pumped. 2.1 bbls back. RD test equipment. 3,130.0 3,130.0 2/2/2023 10:00 2/2/2023 10:30 0.50 SURFAC, DRILLOUT WASH P Wash back to bottom @ 3221' MD. 3,130.0 3,221.0 2/2/2023 10:30 2/2/2023 15:00 4.50 INTRM1, DRILL DDRL P Drill 3221' MD to 3465' MD/ 3306' TVD 15k WOB 800 GPM 1370 PSI on bottom 1350PSI off bottom 140 RPM 8k TQ on bottom 5k TQ off botom 11.0ppg MW 11.5ppg ECD 124k PU 112k SO 127k ROT 3,221.0 3,465.0 2/2/2023 15:00 2/2/2023 16:30 1.50 INTRM1, DRILL CIRC T Circulate and condition mud. Due to losing mud across shakers. 500 GPM 600 PSI 100 RPM 5k TQ 3,465.0 3,465.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 11/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/2/2023 16:30 2/3/2023 00:00 7.50 INTRM1, DRILL DDRL P Drill 3221' MD to 4087' MD/ 3865' TVD 18k WOB 950 GPM 1878 PSI on bottom 140 RPM 7k TQ on bottom 3k TQ off botom 10.5ppg MW 11.1ppg ECD 133k PU 141k SO 128k ROT Note: Slow ROP due to losing mud over shakers. Varying rates and ROP. Changing screens on shakers. Ended up with 140 screens on all shakers. 3,465.0 4,087.0 2/3/2023 00:00 2/3/2023 06:30 6.50 INTRM1, DRILL DDRL P Drill 4087' MD to 4856' MD 18k WOB 950 GPM 1878 PSI on bottom 140 RPM 7k TQ on bottom 3k TQ off botom 10.5ppg MW 11.1ppg ECD 133k PU 141k SO 128k ROT Note: Staged rate and ROP up. Ball mill still having issues with screens blinding off. 4,087.0 4,851.0 2/3/2023 06:30 2/3/2023 07:30 1.00 INTRM1, DRILL CIRC T Cuttings pit packed off. PU and circulate and reciprocate std while clearing cuttings pit. 715 GPM 1410 PSI 80 RPM 5k TQ 4,851.0 4,851.0 2/3/2023 07:30 2/3/2023 12:00 4.50 INTRM1, DRILL DDRL P Drill 4856' MD to 5365' MD/ 5013' TVD 15k WOB 1030 GPM 2650 PSI on bottom 140 RPM 11k TQ on bottom 3k TQ off botom 10.9ppg MW 11.5ppg ECD 164k PU 143k SO 147k ROT 4,851.0 5,365.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 12/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/3/2023 12:00 2/3/2023 18:00 6.00 INTRM1, DRILL DDRL P Drill 5365' MD to 6213' MD/ 5776' TVD 26k WOB 1030 GPM 2800 PSI on bottom 140 RPM 16k TQ on bottom 6k TQ off botom 11.0ppg MW 11.7ppg ECD 178k PU 174k SO 161k ROT 22.1 Bit Hrs 41.1 Jar hrs 5,365.0 6,213.0 2/3/2023 18:00 2/4/2023 00:00 6.00 INTRM1, DRILL DDRL P Drill 6213' MD to 7023' MD/ 6507' TVD 34k WOB 1030 GPM 3140 PSI on bottom 140 RPM 16k TQ on bottom 6k TQ off botom 11.0ppg MW 11.8ppg ECD 185k PU 182k SO 178k ROT 26.6 Bit Hrs 45.6 Jar hrs 6,213.0 7,023.0 2/4/2023 00:00 2/4/2023 06:00 6.00 INTRM1, DRILL DDRL P Drill 7023' MD to 7720' MD/ 7117' TVD 28k WOB 1030 GPM 3760 PSI on bottom 140 RPM 18k TQ on bottom 9k TQ off botom 12.0ppg MW 12.7ppg ECD 213k PU 189k SO 190k ROT 31.3 Bit Hrs 50.3 Jar hrs Note: Start weighting up @ 7180' f/ 11.0 to 12.0ppg 7,023.0 7,720.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 13/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/4/2023 06:00 2/4/2023 11:00 5.00 INTRM1, DRILL DDRL P Drill 7720' MD to 8244' MD/ 7536' TVD. Casing point. 16k WOB 1010 GPM 3850 PSI on bottom 140 RPM 18k TQ on bottom 9k TQ off botom 12.0ppg MW 12.8ppg ECD 217k PU 186k SO 197k ROT 35.4 Bit Hrs 54.4 Jar hrs 7,720.0 8,244.0 2/4/2023 11:00 2/4/2023 13:30 2.50 INTRM1, TRIPCAS BKRM P Take final survey. Circulate to clear HRZ. BROOH f/ 8244' MD to 8033' MD at 1 bu per std for 3 stds. 8,244.0 8,003.0 2/4/2023 13:30 2/4/2023 14:00 0.50 INTRM1, TRIPCAS OWFF P Flow check. Static. 8,003.0 8,003.0 2/4/2023 14:00 2/5/2023 00:00 10.00 INTRM1, TRIPCAS BKRM P BROOH f/ 8003' to 5663' 1018 GPM 3290 PSI 120 RPM 12k TQ 12.6ppg ECD 8,003.0 5,663.0 2/5/2023 00:00 2/5/2023 06:00 6.00 INTRM1, TRIPCAS BKRM P BROOH f/ 5663' to 4491' 1018 GPM 2920 PSI 120 RPM 12k TQ 12.6ppg ECD Note: Observed pressure spike @ 4918' and shakers loaded up right after. Slowed pulling speed and circulated BU while BROOH. Shakers were better but still had large plate sized cuttings coming across. Pumped 1 50bbl low vis sweep. 5,663.0 4,491.0 2/5/2023 06:00 2/5/2023 14:00 8.00 INTRM1, TRIPCAS BKRM P BROOH f/ 4491' to 3190'. No overpull observed pulling into shoe. 1018 GPM 2560 PSI 120 RPM 7k TQ 12.6ppg ECD Note: Pumped 2 50bbl low vis sweeps. 4,491.0 3,190.0 2/5/2023 14:00 2/5/2023 16:30 2.50 INTRM1, TRIPCAS CIRC P Circulate and clean hole. Pumped low/hi vis sweeps. 100 RPM 7k TQ 1013 GPM 2540 PSI 3,190.0 3,190.0 2/5/2023 16:30 2/5/2023 17:00 0.50 INTRM1, TRIPCAS OWFF P Flow check. Slight drop observed. 3,190.0 3,190.0 2/5/2023 17:00 2/5/2023 19:00 2.00 INTRM1, TRIPCAS TRIP P POOH to BHA @ 650' 3,190.0 650.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 14/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/5/2023 19:00 2/5/2023 19:30 0.50 INTRM1, TRIPCAS OWFF P Flow check. Slight drop observed. PJSM f/ BHA. 650.0 650.0 2/5/2023 19:30 2/5/2023 22:00 2.50 INTRM1, TRIPCAS BHAH P Rack back HWDP and LD BHA. 650.0 0.0 2/5/2023 22:00 2/5/2023 22:30 0.50 INTRM1, CASING WWWH P Retrieve wear bushing. 0.0 0.0 2/5/2023 22:30 2/5/2023 23:30 1.00 INTRM1, CASING WWWH P MU jetting tool and wash stack/wellhead. 0.0 0.0 2/5/2023 23:30 2/6/2023 00:00 0.50 INTRM1, CASING BOPE P Change UPR to 9 5/8 fixed rams. 0.0 0.0 2/6/2023 00:00 2/6/2023 00:30 0.50 INTRM1, CASING BOPE P Install 9 5/8" fixed rams in UPR. 0.0 2/6/2023 00:30 2/6/2023 02:30 2.00 INTRM1, CASING BOPE P Test annular 250/2500PSI f/ 5/10 m in each. Test 9 5/8" casing rams 250/3500PSI f/ 5/10 min ea. Good test. RD test equipment. Test witnessed by Quinn Sawyer (BLM) AOGCC witness waived per Guy Cook email 18:31hrs 2/4/23 0.0 0.0 2/6/2023 02:30 2/6/2023 04:30 2.00 INTRM1, CASING RURD P RU 9 5/8" casing equipment. 0.0 0.0 2/6/2023 04:30 2/6/2023 05:00 0.50 INTRM1, CASING OTHR P Perform dummy run w/ hanger and landing joint. PJSM f/ csg run. 0.0 0.0 2/6/2023 05:00 2/6/2023 05:30 0.50 INTRM1, CASING PUTB P MU 9 5/8" FS/shoetrack and FC and RIH to 92'. Threadlock connections. Test floats. Good. 0.0 178.0 2/6/2023 05:30 2/6/2023 10:00 4.50 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# L-80 casing f/ 178' to 3180'. Filling on the fly and topping off every 10 jts. 15.8k MU TQ 47# 178.0 3,180.0 2/6/2023 10:00 2/6/2023 11:00 1.00 INTRM1, CASING CIRC P CBU. Stage pumps to 8 BPM 336 GPM 245 PSI 157k PU 156k SO 3,180.0 3,180.0 2/6/2023 11:00 2/6/2023 14:30 3.50 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# L-80 casing f/ 3180' to 5715'. Filling on the fly and topping off every 10 jts. 15.8k MU TQ 47# 14.3k MU TQ 43.50# 3,180.0 5,715.0 2/6/2023 14:30 2/6/2023 16:00 1.50 INTRM1, CASING CIRC P CBU. Stage pumps to 6 BPM 336 GPM 245 PSI 157k PU 156k SO 5,715.0 5,715.0 2/6/2023 16:00 2/6/2023 19:00 3.00 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# L-80 casing f/ 5715' to 8200'. Filling on the fly and topping off every 10 jts. 15.8k MU TQ 47# 5,715.0 8,200.0 2/6/2023 19:00 2/6/2023 19:30 0.50 INTRM1, CASING PUTB P PU hanger/LJ. MU and land casing. FS @ 8232.55' 8,200.0 8,232.0 2/6/2023 19:30 2/6/2023 21:30 2.00 INTRM1, CEMENT CIRC P Circulate and condition mud f/ cement job. Stage rates up to 6 BPM. 8,232.0 8,232.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 15/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/6/2023 21:30 2/7/2023 00:00 2.50 INTRM1, CEMENT CMNT P Line up cement unit. flush w/ 2 bbls FW. Test lines to 3700psi. Good test. Mix and pump 60bbls 12.5ppg mud push II at 4 bpm. SD and drop bottom plug. Mix and pump 69bbls 13.0 ppg G lead cement at 4.5bpm, Mix and pump 153bbls 15.8 ppg G Tail cement at 4.5 bpm. SD and drop top plug. Pump 20 bbls FW w/ cement unit. Swap over to rig pumps and begin displace cement at 8bpm. 8,232.0 8,232.0 2/7/2023 00:00 2/7/2023 02:00 2.00 INTRM1, CEMENT CMNT P Swapped over to rig pumps. Displace cement w/ 11.8ppg OBM @ 8BPM. Slow to 6BPM f/ bottom plug. Observed bottom plug shear. Continue displacing @ 6BPM. Slow to 3 BPM with 20bbls left. Pump maximum strokes (6978). Final circulating pressure 998 PSI. Did not bump plug. Hold pressure for 5 minutes and check floats. Floats held. Cement in place @ 01:30hrs 2/7/23. 8,232.0 8,232.0 2/7/2023 02:00 2/7/2023 04:00 2.00 INTRM1, WHDBOP RURD P Blow down cement line. Pump out stack.RD Csg equipment. LD landing joint. Clean and clear rig floor. 0.0 0.0 2/7/2023 04:00 2/7/2023 05:00 1.00 INTRM1, WHDBOP WWSP P Install pack off and test 5000psi f/ 10 minutes. 0.0 0.0 2/7/2023 05:00 2/7/2023 09:30 4.50 INTRM1, WHDBOP BOPE P CO UPR f/ 9 5/8" fixed to 4 1/2" x 7" VBR and test w/ 5" and 7" test joints 250/3500psi 5/10 min ea.Test annular w/ 7" test joint 250/2500psi 5/10 min ea. RD test equipment. 0.0 0.0 2/7/2023 09:30 2/7/2023 11:00 1.50 INTRM1, WHDBOP SLPC P Slip/Cut drill line. 86'. 0.0 0.0 2/7/2023 11:00 2/7/2023 13:00 2.00 INTRM1, DRILLOUT BHAH P PJSM. MU and RIH w/ Interm 2 BHA to 547'. 0.0 547.0 2/7/2023 13:00 2/7/2023 15:00 2.00 INTRM1, DRILLOUT TRIP P RIH w/ BHA #3 f/ 547' to 2900' 547.0 2,900.0 2/7/2023 15:00 2/7/2023 15:30 0.50 INTRM1, DRILLOUT CIRC P Shallow test MWD. Good. 2,900.0 2,900.0 2/7/2023 15:30 2/7/2023 18:30 3.00 INTRM1, DRILLOUT TRIP P RIH w/ BHA # 2 f/ 2900' to 7895' 2,900.0 7,895.0 2/7/2023 18:30 2/7/2023 19:30 1.00 INTRM1, DRILLOUT CIRC P Circulate and condition mud f/ casing test. 548 GPM 2865 PSI 20 RPM 7k TQ 12.6ppg ECD 7,895.0 7,895.0 2/7/2023 19:30 2/7/2023 21:00 1.50 INTRM1, DRILLOUT PRTS P RU to test casing.Pressure test casing to 3500 PSI. Good test.8.4bbls pumped. RD test equipment. 7,895.0 7,895.0 2/7/2023 21:00 2/7/2023 22:00 1.00 INTRM1, DRILLOUT WASH P Wash down f/ 7985'. Tag cement @ 8124' MD (15' high). 455 GPM 2060 PSI 21 RPM 7k TQ 12.40ppg ECD 7,895.0 8,124.0 2/7/2023 22:00 2/8/2023 00:00 2.00 INTRM1, DRILLOUT DRLG P Drill out cement/plugs to 8135' 8,124.0 8,135.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 16/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/8/2023 00:00 2/8/2023 03:00 3.00 INTRM1, DRILLOUT DRLG P Drill cement plugs/float collar/shoetrack/float shoe to 8233'. Clean out rathole to 8244'. Dril 20' new formation to 8264' MD. 100 RPM 8k TQ 500 GPM 2355 PSI 11.8ppg MW 12.5ppg ECD 8,135.0 8,264.0 2/8/2023 03:00 2/8/2023 03:30 0.50 INTRM1, DRILLOUT CIRC P Circulate and BROOH back into shoe. Condition mud f/ FIT. 8,264.0 8,264.0 2/8/2023 03:30 2/8/2023 04:00 0.50 INTRM1, DRILLOUT FIT P RU test equipment. Perform FIT to 14.0ppg EMW. RD test equipment. 8,264.0 8,264.0 2/8/2023 04:00 2/8/2023 05:30 1.50 INTRM2, DRILL MPDA P Retrieve trip nipple. Install MPD bearing assembly. 8,264.0 8,264.0 2/8/2023 05:30 2/8/2023 07:30 2.00 INTRM2, DRILL WASH P Wash down to 8264'. Attempt to send downlinks. MWD tools not communicating. Troubleshoot. Decision made to SOOH. 8,264.0 8,264.0 2/8/2023 07:30 2/8/2023 13:00 5.50 INTRM2, DRILL SMPD T SOOH per MPD schedule. Holding 12.5ppg EMW w/ MPD. 400psi in slips/475psi out of slips. SimOps: Performed annular LOT and freeze protect. 8,264.0 637.0 2/8/2023 13:00 2/8/2023 13:30 0.50 INTRM2, DRILL OWFF T Flow check. Static 637.0 637.0 2/8/2023 13:30 2/8/2023 14:30 1.00 INTRM2, DRILL MPDA T Retrieve MPD bearing assembly and install trip nipple. 637.0 637.0 2/8/2023 14:30 2/8/2023 16:30 2.00 INTRM2, DRILL BHAH T Rack back HWDP and swap out BHA. 637.0 0.0 2/8/2023 16:30 2/8/2023 17:00 0.50 INTRM2, DRILL CLEN T Clean and clear rig floor. 637.0 0.0 2/8/2023 17:00 2/8/2023 19:00 2.00 INTRM2, DRILL BHAH T MU and RIH w/ BHA #4 to 556'. 0.0 556.0 2/8/2023 19:00 2/8/2023 19:30 0.50 INTRM2, DRILL MPDA T Retrieve trip nipple and install MPD bearing asembly. 0.0 547.0 2/8/2023 19:30 2/8/2023 21:00 1.50 INTRM2, DRILL SMPD T SIH f/ 547' to 2899' MD. 547.0 2,899.0 2/8/2023 21:00 2/8/2023 21:30 0.50 INTRM2, DRILL CIRC T Shallow test MWD. Good test. 2,808.0 2,808.0 2/8/2023 21:30 2/9/2023 00:00 2.50 INTRM2, DRILL SMPD T SIH f/ 2808' to 6018' 2,808.0 6,018.0 2/9/2023 00:00 2/9/2023 01:30 1.50 INTRM2, DRILL SMPD T SIH f/ 6018' to 8087'. 6,018.0 8,087.0 2/9/2023 01:30 2/9/2023 03:30 2.00 INTRM2, DRILL WASH T Take parameters before going into open hole. Wash down to bottom at 8264' MD. (4' fill) 8,087.0 8,264.0 2/9/2023 03:30 2/9/2023 05:30 2.00 INTRM2, DRILL DDRL P Control drill Interm 2 section f/ 8264' MD to 8346' MD. 120 RPM 9k TQ 595 GPM 3200 PSI 11.6ppg MW 12.80ppg ECD 8,264.0 8,346.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 17/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/9/2023 05:30 2/9/2023 07:00 1.50 INTRM2, DRILL CIRC P Take base parameters f/ underreamer. Drop 1.25" Torlon ball. Pump down string. Pump down at 250 GPM f/ 10 minutes and reduce rate to 100 GPM. Did not observe ball land. Pump 50 bbls more. Check parameters to confirm under reamer open. Perform ledge test. Good test Base parameters: 4500 Turbine RPM 598 GPM 3157 PSI Post parameters: 3960 Turbine RPM 598 GPM 2850 PSI 8,346.0 8,346.0 2/9/2023 07:00 2/9/2023 12:00 5.00 INTRM2, DRILL DDRL P Drill 9 7/8" x 8 1/2" Interm 2 hole f/ 8346' MD to 8651' MD/ 7828' TVD. 28k WOB 650 GPM 3175 PSI 150 RPM 19k TQ on bottom 10k TQ off bottom 11.5ppg MW 12.9ppg ECD 5.5hrs Bit 60.3hrs Jars 8,346.0 8,651.0 2/9/2023 12:00 2/9/2023 18:00 6.00 INTRM2, DRILL DDRL P Drill 9 7/8" x 8 1/2" Interm 2 hole f/ 8651' MD to 9213' MD/ 8133' TVD. Holding 450psi on connections w/ MPD. 23k WOB 650 GPM 3130 PSI 150 RPM 17k TQ on bottom 7k TQ off bottom 11.5ppg MW 12.7ppg ECD 10hrs Bit 64.8hrs Jars 8,651.0 9,213.0 2/9/2023 18:00 2/10/2023 00:00 6.00 INTRM2, DRILL DDRL P Drill 9 7/8" x 8 1/2" Interm 2 hole f/ 9213' MD to 9670' MD/ 8283' TVD. Holding 450psi on connections w/ MPD. 15k WOB 650 GPM 3140 PSI 150 RPM 13k TQ on bottom 9k TQ off bottom 11.5ppg MW 12.7ppg ECD 14.8hrs Bit 69.6hrs Jars Note: Slow ROP to 60 ft/hr @ 9560'. 9,213.0 9,670.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 18/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/10/2023 00:00 2/10/2023 02:30 2.50 INTRM2, DRILL DDRL P Drill 9 7/8" x 8 1/2" Interm 2 hole f/ 9670' MD to 9779' MD. Holding 450psi on connections w/ MPD. (9779' MD casing point) Take final survey. Downlink and close ribs. 15k WOB 650 GPM 3140 PSI 150 RPM 13k TQ on bottom 9k TQ off bottom 11.5ppg MW 12.7ppg ECD 215k PU 170k SO 190k ROT 14.8hrs Bit 69.6hrs Jars Note: Slow ROP to 60 ft/hr @ 9560'. 9,670.0 9,779.0 2/10/2023 02:30 2/10/2023 03:30 1.00 INTRM2, TRIPCAS CIRC P Take baseline parameters. Drop 1.625" Torlon closing ball. Pump down string. Land ball and shear closed (2025psi). Confirm closed with parameters. 9,779.0 9,779.0 2/10/2023 03:30 2/10/2023 05:00 1.50 INTRM2, TRIPCAS CIRC P Circulate 3 BU cleaning hole. Shakers clean after 1.5 BU.Reciprocating pipe 9760'-9716'. 125 RPM 8k TQ 650 GPM 3300 PSI 9,779.0 9,683.0 2/10/2023 05:00 2/10/2023 05:30 0.50 INTRM2, TRIPCAS OWFF P Flow check. Static 9,683.0 9,683.0 2/10/2023 05:30 2/10/2023 08:00 2.50 INTRM2, TRIPCAS SMPD P SOOH f/ 9683' to 8179'. Holding 12.5ppg EMW w/ MPD. 9,683.0 8,179.0 2/10/2023 08:00 2/10/2023 08:30 0.50 INTRM2, TRIPCAS CIRC P Circulate BU inside shoe. 650 GPM 3030 PSI 30 RPM 6k TQ 8,179.0 8,179.0 2/10/2023 08:30 2/10/2023 09:00 0.50 INTRM2, TRIPCAS OWFF P Flow check. Static. Drop 2.8" hollow drift w/ tail down string. 8,179.0 8,179.0 2/10/2023 09:00 2/10/2023 16:30 7.50 INTRM2, TRIPCAS SMPD P SOOH f/ 8179' to BHA 8,179.0 650.0 2/10/2023 16:30 2/10/2023 17:00 0.50 INTRM2, TRIPCAS OWFF P Flow check. Static. 650.0 650.0 2/10/2023 17:00 2/10/2023 18:00 1.00 INTRM2, TRIPCAS MPDA P Retrieve MPD bearing assembly. Install trip nipple. Retrieve hollow drift. 650.0 550.0 2/10/2023 18:00 2/10/2023 21:00 3.00 INTRM2, TRIPCAS BHAH P POOH LD BHA. 550.0 0.0 2/10/2023 21:00 2/10/2023 22:30 1.50 INTRM2, CASING CLEN P Clean and clear rig floor 0.0 0.0 2/10/2023 22:30 2/10/2023 23:00 0.50 INTRM2, CASING RURD P RU csg equipment. 0.0 0.0 2/10/2023 23:00 2/11/2023 00:00 1.00 INTRM2, CASING PUTB P PJSM. MU and RIH w/ 7" liner shoetrack. Threadlock connections. Check floats. Good. RIH w/ 7" 29# liner to 248'. 0.0 248.0 2/11/2023 00:00 2/11/2023 02:00 2.00 INTRM2, CASING PUTB P RIH w/ 7" 29# TN110 and L80 liner f/ 248' to 1650'. 248.0 1,650.0 2/11/2023 02:00 2/11/2023 03:00 1.00 INTRM2, CASING PUTB P CO handling equipment.MU liner hanger. Fill w/ Zanplex D. RIH to 1850' 1,650.0 1,850.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 19/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/11/2023 03:00 2/11/2023 03:30 0.50 INTRM2, CASING CIRC P Circulate 1.5 liner volume. 174 GPM 175 PSI 1,850.0 1,850.0 2/11/2023 03:30 2/11/2023 04:30 1.00 INTRM2, CASING MPDA P Retrieve trip nipple. Install MPD bearing assembly. 1,850.0 1,850.0 2/11/2023 04:30 2/11/2023 11:30 7.00 INTRM2, CASING RUNL P SIH w/ 7" liner w/ 5" DP f/ 1850' to 9672'. Maintain 12.5ppg EMW w/ MPD. 1,850.0 9,672.0 2/11/2023 11:30 2/11/2023 12:00 0.50 INTRM2, CASING WASH P Wash down f/ 9672' to 9774' 9,672.0 9,775.0 2/11/2023 12:00 2/11/2023 12:30 0.50 INTRM2, CEMENT RURD P MU cement head/swivel and space out @ 9774'. 9,775.0 9,775.0 2/11/2023 12:30 2/11/2023 14:00 1.50 INTRM2, CEMENT CIRC P Stage pumps up to 249 GPM/679 PSI. Circulate and condition mud. 9,775.0 9,775.0 2/11/2023 14:00 2/11/2023 16:00 2.00 INTRM2, CEMENT PRTS P Blow down TD and RU cement line. Pressure test line to 4500psi. Pump70bbls KCL w/ rig.Drop bottom dart. Swap to cementers.Mix and pump 70bbls 15.8ppg cement @ 4BPM. Sd and drop top dart.Pump 20bbl FW w/ cementers. Sawap over to rig pumps and displace cement w/ 173bls 11.5ppg OBM. 2043stks pumped.FCP 281 PSI. Pressure up to 1000 PSI and hold f/ 5 min. Bleed off and check floats. Good. Cement in place. @ 15:54hrs 2-11-23 TOL @ 8078'. FS @ 9779'. 9,775.0 9,775.0 2/11/2023 16:00 2/11/2023 17:00 1.00 INTRM2, CEMENT PACK P Pressure up to 2300 psi on DP & set hanger. Set down on hanger did not appear set. PU and appeared released. Pressure up to 2500psi. Set down and appeared set on depth. Pressure up to 3500 psi to release running tool, bleed off pressure. P/U 6' to expose dog sub, slack off to set packer.Set down 50k, p/u & set 70k down, rotate 10 rpm, 10k TQ to confirm packer set. Top of packer (Baker 7"x9.625" HRDE SLZXP-HD liner top at 8,078'. 9,775.0 9,775.0 2/11/2023 17:00 2/11/2023 17:30 0.50 INTRM2, CEMENT PRTS P Pressure test liner top to 1000PSI f/ 10 min. Good test. Bleed off pressure. Pressure up to 500 PSI and sting out. Observed pressure loss when coming out of liner top. PU 22'. TOL @ 8078'. 9,775.0 9,775.0 2/11/2023 17:30 2/11/2023 18:30 1.00 INTRM2, CEMENT RURD P LD single and cement swivel. BD cement line and kill line. 9,775.0 9,775.0 2/11/2023 18:30 2/11/2023 19:30 1.00 INTRM2, CEMENT CIRC P Install nerf ball and circulate surface to surface. 10 BPM @ 870 PSI. 9,775.0 9,775.0 2/11/2023 19:30 2/11/2023 21:00 1.50 INTRM2, CEMENT MPDA P Retrieve MPD bearing assembly and install trip nipple. Pump slug and prep to POOH. 9,775.0 9,775.0 2/11/2023 21:00 2/12/2023 00:00 3.00 INTRM2, CEMENT TRIP P POOH f/ 8070' to 2993'. 9,775.0 2,993.0 2/12/2023 00:00 2/12/2023 01:30 1.50 INTRM2, CEMENT TRIP P POOH w/ running tool f/ 2993' to 30'. 2,993.0 30.0 2/12/2023 01:30 2/12/2023 03:00 1.50 INTRM2, WHDBOP PULD P Flow check and LD running tool. All looked good. SimOps: Drain stack and start swapping out UPR. 30.0 0.0 2/12/2023 03:00 2/12/2023 04:00 1.00 INTRM2, WHDBOP CLEN P Clean and clear rig floor. CO UPR. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 20/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/12/2023 04:00 2/12/2023 05:00 1.00 INTRM2, WHDBOP BOPE P Retrieve wear bushing. Install test plug. RU test BOPE 0.0 0.0 2/12/2023 05:00 2/12/2023 13:30 8.50 INTRM2, WHDBOP BOPE P BOPE Test All tests to 250psi/5min 3500psi/10min Annular 250psi/5min 2500psi/10min w/ exception of manual and super choke t/ 2000 psi. 5” Test jt: test annular/2 7/8" x 5 1/2" UPR/2 7/8" 5 1/2" LPR, W/ 4" Test jt: test annular/2 7/8" x 5 1/2" UPR/2 7/8" 5 1/2" LPR,Test choke valves 1-15. Manual operated and super choke. Choke manuals and HCR valves. 4" kill line valve. Test 2x 4" FO safety valves. 4" dart valve. 2x 5" FO safety valves. 5" dart valve. Test upper and lower IBOP. Blind ram. Performed Koomey draw down, ACC = 3050 psi, Manifold = 1475 psi, ACC = 1600 psi after all functions on bottles,15 sec for 200 psi. Build w/ 2 electric pumps, 131 sec to build full system pressure w/ 2 electrical and 2 air pumps, closing times annular = 26 sec. UPR = 17 sec, Blind ram = 18 sec, LPR = 18 sec, choke HCR = 3 sec, Kill HCR = 3 sec. Test PVT gain/loss and flow out alarms. Test LEL and H2S alarms AOGCC and BLM waived witness. Note: Dart valve failed. Replace and test. Good. Upper IBOP failed. Replace and test good. 0.0 0.0 2/12/2023 13:30 2/12/2023 14:30 1.00 INTRM2, WHDBOP BOPE P RD test equipment. Retrieve test plug and install wear bushing. 0.0 0.0 2/12/2023 14:30 2/12/2023 16:00 1.50 INTRM2, WHDBOP PRTS P Test casing to 4200 PSI f/ 30 minutes. Charted. 0.0 0.0 2/12/2023 16:00 2/12/2023 18:30 2.50 INTRM2, WHDBOP BOPE P Replace Upper and Lower IBOP. 0.0 0.0 2/12/2023 18:30 2/12/2023 19:00 0.50 INTRM2, WHDBOP SVRG P Service rig. 0.0 0.0 2/12/2023 19:00 2/12/2023 19:30 0.50 INTRM2, DRILLOUT CLEN P CO elevators. Stage BHA to rig floor. PJSM f/ BHA. 0.0 0.0 2/12/2023 19:30 2/12/2023 22:30 3.00 INTRM2, DRILLOUT BHAH P MU and RIH w/ Production BHA to 237'. 0.0 237.0 2/12/2023 22:30 2/13/2023 00:00 1.50 INTRM2, DRILLOUT PULD P Install PS21 slips and single in hole w/ 4" DP to 366' 237.0 366.0 2/13/2023 00:00 2/13/2023 02:30 2.50 INTRM2, DRILLOUT PULD P Single in hole w/ production BHA with 4" DP f/ 366' to 2603'. 366.0 2,603.0 2/13/2023 02:30 2/13/2023 03:00 0.50 INTRM2, DRILLOUT CIRC P Shallow test MWD tools. Good test. 2,603.0 2,603.0 2/13/2023 03:00 2/13/2023 04:00 1.00 INTRM2, DRILLOUT PULD P Single in hole w/ production BHA with 4" DP f/ 2603' to 3653'. 2,603.0 3,653.0 2/13/2023 04:00 2/13/2023 05:00 1.00 INTRM2, DRILLOUT PULD P Single in hole f/ 3653' to 3846' Logging @ 1800 FPH. Continue singling in f/ 3846' to 4200' @ normal speed. 3,653.0 4,200.0 2/13/2023 05:00 2/13/2023 13:00 8.00 INTRM2, DRILLOUT PULD P Single in hole w/ 4" DP logging @ 1800 FPH f/ 4200' to 9530'. 4,200.0 9,530.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 21/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/13/2023 13:00 2/13/2023 14:30 1.50 INTRM2, DRILLOUT WASH P Wash down f/ 9530' to 9690'. Tag Plug/LC. 50 RPM 7k TQ 250 GPM 2560 PSI 9,530.0 9,690.0 2/13/2023 14:30 2/13/2023 22:00 7.50 INTRM2, DRILLOUT DRLG P Drill out plugs/LC/Shoetrack/FC/ Shoetrack to 9775' MD. (5' above FS). SimOps: PJSM for displacement Note: Plugs and landing collar-5.5hrs SimOps: LD excess stds of 5" DP. 9,690.0 9,775.0 2/13/2023 22:00 2/14/2023 00:00 2.00 INTRM2, DRILLOUT CIRC P Displace 11.5ppg OBM to 8.8ppg FloPro. 30 RPM 4k TQ 260 GPM 1350 PSI 9,775.0 9,775.0 2/14/2023 00:00 2/14/2023 01:00 1.00 INTRM2, DRILLOUT CIRC P Displace 11.5ppg OBM to 8.8ppg FloPro. 30 RPM 4k TQ 260 GPM 1350 PSI 68bbls interface. 9,775.0 9,775.0 2/14/2023 01:00 2/14/2023 03:30 2.50 INTRM2, DRILLOUT SLPC P Slip/Cut drill line. SimOps: Cleaning pits and shakers. 9,775.0 9,775.0 2/14/2023 03:30 2/14/2023 05:30 2.00 INTRM2, DRILLOUT MPDA P Install MPD bearing assembly. SimOps: Clean pits and shakers. 9,775.0 9,775.0 2/14/2023 05:30 2/14/2023 06:30 1.00 INTRM2, DRILLOUT CLEN P Finish cleaning pits. 9,775.0 9,755.0 2/14/2023 06:30 2/14/2023 07:00 0.50 INTRM2, DRILLOUT SVRG P Service Top Drive 9,775.0 9,775.0 2/14/2023 07:00 2/14/2023 09:00 2.00 INTRM2, DRILLOUT DRLG P Drill shoetrack and FS. Clean out rathole. Drill 20' new formation to 9799' MD. 15k WOB 280 GPM 1500 PSI 50 RPM 5k TQ 8.8ppg MW 9.1ppg ECD 9,775.0 9,799.0 2/14/2023 09:00 2/14/2023 09:30 0.50 INTRM2, DRILLOUT CIRC P Circulate and condition mud while BROOH back inside casing to 9721'. 9,799.0 9,799.0 2/14/2023 09:30 2/14/2023 11:00 1.50 INTRM2, DRILLOUT FIT P RU test equipment. Perform FIT to 12.0ppg EMW. 9,799.0 9,799.0 2/14/2023 11:00 2/14/2023 12:00 1.00 PROD1, DRILL DDRL P Drill 6 5 1/6" x 6 1/8" production section f/ 9799' to 9820' MD 9,799.0 9,820.0 2/14/2023 12:00 2/14/2023 13:00 1.00 PROD1, DRILL DDRL T Troubleshoot MWD. Pulser. Cycle pumps. No success. Decision made to POOH. 9,820.0 9,820.0 2/14/2023 13:00 2/14/2023 13:30 0.50 PROD1, DRILL OWFF T Flow check. Static. 9,820.0 9,820.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 22/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/14/2023 13:30 2/14/2023 21:00 7.50 PROD1, DRILL SMPD T Line up to SOOH. SOOH f/ 9813' to 250'. Holding 9.0ppg EMW w/ MPD 9,820.0 250.0 2/14/2023 21:00 2/14/2023 21:30 0.50 PROD1, DRILL OWFF T Flow check. Static. 9,820.0 250.0 2/14/2023 21:30 2/14/2023 22:30 1.00 PROD1, DRILL MPDA T Retrieve MPD bearing assembly. Install trip nipple. 250.0 250.0 2/14/2023 22:30 2/15/2023 00:00 1.50 PROD1, DRILL BHAH T POOH LD BHA 76' 250.0 76.0 2/15/2023 00:00 2/15/2023 01:30 1.50 PROD1, DRILL BHAH T POOH LD BHA 76' to surface. 76.0 0.0 2/15/2023 01:30 2/15/2023 04:30 3.00 PROD1, DRILL BHAH T PU and RIH w/ BHA #6 from surface to 257' 0.0 257.0 2/15/2023 04:30 2/15/2023 11:30 7.00 PROD1, DRILL TRIP T RIH w/ BHA #6 f/ 257' to 9405' MD. Note: set down 25k @ 9369'. 257.0 9,405.0 2/15/2023 11:30 2/15/2023 12:30 1.00 PROD1, DRILL MPDA T Retrieve trip nipple and install MPD bearing assembly. 9,405.0 9,405.0 2/15/2023 12:30 2/15/2023 15:30 3.00 PROD1, DRILL WASH T Wash down f/ 9405' to 9820' 285 GPM 1500 PSI 9,405.0 9,820.0 2/15/2023 15:30 2/16/2023 00:00 8.50 PROD1, DRILL DDRL P Drill 9820' MD to 10620' MD / 8568' TVD. 18k WOB 300 GPM 1780 PSI on bottom 1750 PSI off bottom 130 RPM 8k TQ on bottom 4k TQ off bottom 8.8ppg MW 9.4ppg ECD 9,820.0 10,620.0 2/16/2023 00:00 2/16/2023 01:00 1.00 PROD1, DRILL DDRL P Drill 10620'' MD to 10672' MD / 8424' TVD. Observed losses @ 10650' of 20/30bbls/hr. At 10670' losses went to 200-300blls/hr. 18k WOB 300 GPM 1780 PSI on bottom 1750 PSI off bottom 130 RPM 8k TQ on bottom 4k TQ off bottom 8.8ppg MW 9.4ppg ECD 10,620.0 10,672.0 2/16/2023 01:00 2/16/2023 03:00 2.00 PROD1, DRILL CIRC T Slow rates and pump/backream out of hole to 10550' while building 35ppb LCM pill. 1bpm down DP and 5BPM down annulus to keep hole full. Pump 95bbls of 35ppb LCM pill.Observed losses slowing after pill exited bit. 10,672.0 10,550.0 2/16/2023 03:00 2/16/2023 06:30 3.50 PROD1, DRILL BKRM T BROOH f/ 10560' to 9770'. 1BPM down DP and 1 BPM down annulus to keep hole full. Stopped at 10066' and increase rates to downlink and turn off MWD tools. SimOps. Building and hauling mud to build volume. 10,550.0 9,770.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 23/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/16/2023 06:30 2/16/2023 07:30 1.00 PROD1, DRILL CIRC T Stage up rates to 270 GPM / 1350 PSI. Loss rate at 30 bbls/hr. SimOps: Continue building and hauling mud f/ volume and building 35ppb LCM pill. 9,770.0 9,770.0 2/16/2023 07:30 2/16/2023 07:45 0.25 PROD1, DRILL TRIP T RIH to 10672' MD. SimOps: Building 35ppb LCM pill 9,770.0 10,672.0 2/16/2023 07:45 2/16/2023 08:30 0.75 PROD1, DRILL OTHR T Troubleshoot Pulser. cycle pumps and send downlinks to reduce data rate. Cycle pumps again and BCPM back alive. 10,672.0 10,672.0 2/16/2023 08:30 2/16/2023 09:00 0.50 PROD1, DRILL DDRL P Drill 10672' MD to 10722' MD / 8422' TVD. Observed Hi torque @ 10670' and full losses @ 10672' 18k WOB 300 GPM 1780 PSI on bottom 1750 PSI off bottom 130 RPM 8k TQ on bottom 4k TQ off bottom 8.8ppg MW 9.4ppg ECD 10,672.0 10,722.0 2/16/2023 09:00 2/16/2023 12:00 3.00 PROD1, DRILL CIRC T Line up and pump 100bbls of 35ppb LCM pill. Line up injection pump on annulus to keep hole full. 10,722.0 10,722.0 2/16/2023 12:00 2/16/2023 15:00 3.00 PROD1, DRILL DDRL P Drill 10722' MD to 10921' MD / 8424' TVD. 18k WOB 280 GPM 1520 PSI on bottom 1500 PSI off bottom 130 RPM 8k TQ on bottom 6k TQ off bottom 8.8ppg MW 9.2ppg ECD 10,722.0 10,921.0 2/16/2023 15:00 2/16/2023 17:00 2.00 PROD1, DRILL PMPO T Pump out of hole f/ 10921' to 10447' MD. 84 GPM 180 PSI 10,921.0 10,447.0 2/16/2023 17:00 2/16/2023 19:30 2.50 PROD1, DRILL CIRC T Open well commander by pumping down 1.750" opening ball and isolate BHA by pumping down 1.698" isolation ball. 10,447.0 10,447.0 2/16/2023 19:30 2/16/2023 20:00 0.50 PROD1, DRILL CIRC T Pump 65 bbls of 70ppb Procore LCM pill to WC. 84 GPM 350 PSI 10,447.0 10,447.0 2/16/2023 20:00 2/16/2023 22:00 2.00 PROD1, DRILL PMPO T Pump out of hole f/ 10447' to 9691' Laying in LCM pill while pulling out of hole. 10,447.0 9,691.0 2/16/2023 22:00 2/16/2023 22:30 0.50 PROD1, DRILL RURD T Blow down top drive and RU circulating line to DS. 9,691.0 9,691.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 24/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/16/2023 22:30 2/17/2023 00:00 1.50 PROD1, DRILL CIRC T Line up and fill annulus. Attempt hesitation squeeze on formation. 1st: 1BPM- 4bbls-48psi/ 7bbls- 75psi/10.5bbls101psi. Monitor 10 minutes bled to 5psi. 2nd: 1 BPM- 5bbls-17psi/ 10bbls - 80psi/15bbls max of 93psi and fell to 80psi. Monitor f/ 7 minutes bled off to 11psi. 3rd: 1BPM- 5bbls-17psi/ 10bbls- 83psi/ 12.2bbls- 100psi. Monitor f/ 5 minutes bled to 14psi. 4th: 1BPM- 5bbls 15psi/ 10bbls 80psi. Monitor f/ 5 minutes bled to 10psi. 9,691.0 9,691.0 2/17/2023 00:00 2/17/2023 05:30 5.50 PROD1, DRILL CIRC T Finished hesitation squeeze. Unsuccessful. Discuss plan forward with town. Build 100bbl of 80ppb ProCor LCM pill. Circulate across top of hole while building pill. 2 BPM 80 PSi. Static losses @ 30bbls/hr. 9,691.0 9,691.0 2/17/2023 05:30 2/17/2023 07:30 2.00 PROD1, DRILL CIRC T Pump 96bbls of 80ppb ProCore pill 3.5BPM/430PSI. Slow rate to 1/2 BPM and close chokes on MPD once pill starts exiting well commander. Bullhead pill @ 1BPM 228PSI on DP. Bullhead until pill is out of drill string. 1 BPM/ 358PSI SPP/289PSI MPD. SD and monitor pressure. Bled to 0PSI in 15 minutes 9,691.0 9,691.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 25/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/17/2023 07:30 2/17/2023 11:00 3.50 PROD1, DRILL CIRC T Perform hesitation squeeze. 1st: STKS- 101 PSI-171 15 MIN PSI- 0psi 2nd: STKS- 53 PSI-101 15 MIN PSI- 0psi 3rd: STKS- 73 PSI-104 15 MIN PSI- 5psi 4th: STKS- 44 PSI-101 15 MIN PSI- 0psi 5th: STKS- 46 PSI-103 15 MIN PSI- 0psi 6th: STKS- 43 PSI-103 15 MIN PSI- 0psi 7th: STKS- 43 PSI-103 15 MIN PSI- 0psi 8th: STKS- 38 PSI-103 15 MIN PSI- 0psi 9th: STKS- 48 PSI-102 15 MIN PSI- 0psi 9,691.0 9,691.0 2/17/2023 11:00 2/17/2023 21:00 10.00 PROD1, DRILL CIRC T Circulate across top of hole while discussing plan forward with town. Decision made to build 2 x 100bbl LCM pills. Stage material and build 1 x 100bbl of 120ppb conventional LCM pill and 1 x 100bbl of formabloc pill. 9,691.0 9,691.0 2/17/2023 21:00 2/18/2023 00:00 3.00 PROD1, DRILL CIRC T Line up and pump 98bbl of 120ppb LCM pill. 153 GPM/160 PSI to well commander. Slow rate and close choke on MPD as pill exits wel commander. Bullhead @ 1 BPM. pressure gradually increased to 500 PSI. Use MPD choke to hold 500 PSI on annulus and take returns back to pits (43bbls calculated) until pill out of drill string. SD and monitor pressure. 9,691.0 9,691.0 2/18/2023 00:00 2/18/2023 01:00 1.00 PROD1, DRILL CIRC T Continue displacing LCM pill. Use MPD choke to hold 500 PSI on annulus and take returns back to pits (43bbls calculated) until pill out of drill string. SD and monitor pressure. 9,691.0 9,691.0 2/18/2023 01:00 2/18/2023 02:30 1.50 PROD1, DRILL CIRC T Monitor well. Pressure bled to 92psi in 30 minutes. Attempt to perform hesitation squeeze. Troubleshoot mud pumps. 9,691.0 9,691.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 26/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/18/2023 02:30 2/18/2023 07:30 5.00 PROD1, DRILL CIRC T Unable to build pressure with mud pumps. Swap pumps. Still unable to build pressure. Go through surface system. Clean out suction systems. Fill pit with FW and circulate surface system. system loaded with LCM product. Note: 100bbl formablock pill ready 9,691.0 9,691.0 2/18/2023 07:30 2/18/2023 12:00 4.50 PROD1, DRILL CIRC T Attempt hesitation squeeze to 450psi staging up in 50psi increments. Dynamically squeeze away remainder of LCM pill using MPD to maintain 400- 500psi on annulus. 9,691.0 9,691.0 2/18/2023 12:00 2/18/2023 13:00 1.00 PROD1, DRILL CIRC T Circulate hole clean through well commander. 450 GPM/ 1230 PSI. No losses. 9,691.0 9,691.0 2/18/2023 13:00 2/18/2023 15:30 2.50 PROD1, DRILL CIRC T Drop well commander closing ball and pump down. Close well commander. Bring up rates for tools to power in. Had to cycle pumps and pump FW sweeps to power on tools. Tools working properly. 9,691.0 9,691.0 2/18/2023 15:30 2/18/2023 20:00 4.50 PROD1, DRILL REAM T Wash/ream back to bottom. 9,691.0 10,921.0 2/18/2023 20:00 2/19/2023 00:00 4.00 PROD1, DRILL DDRL P Drill 10921' MD to 11285' MD /8431' TVD. 16k WOB 320 GPM 2000 PSI on bottom 1660 PSI off bottom 140 RPM 8k TQ on bottom 3k TQ off bottom 8.8ppg MW 9.2ppg ECD 10,921.0 11,285.0 2/19/2023 00:00 2/19/2023 06:30 6.50 PROD1, DRILL DDRL P Drill 10921' MD to 11890' MD /8437' TVD. Losses increased to 50+/- bbls/hr at 11750'. Start adding background LCM. 12k WOB 320 GPM 1960 PSI on bottom 1550 PSI off bottom 140 RPM 8k TQ on bottom 3k TQ off bottom 8.8ppg MW 9.5ppg ECD 157k PU 140k SO 146k ROT 11,285.0 11,890.0 2/19/2023 06:30 2/19/2023 07:15 0.75 PROD1, DRILL OTHR T Troubleshoot MWD pulser, likely LCM related. Cycle pumps and downlink. Cycle repeatedly and tools came back on. 11,890.0 11,890.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 27/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/19/2023 07:15 2/19/2023 12:45 5.50 PROD1, DRILL DDRL P Drill 11890' MD to 12516' MD /8439' TVD. 12k WOB 300 GPM 1900 PSI on bottom 1480 PSI off bottom 140 RPM 8k TQ on bottom 3k TQ off bottom 8.8ppg MW 9.5ppg ECD 150k PU 139k SO 146k ROT 11,890.0 12,516.0 2/19/2023 12:45 2/19/2023 19:15 6.50 PROD1, DRILL DDRL P Drill 12516' MD to 13165' MD /8444' TVD. 12k WOB 300 GPM 2050 PSI on bottom 1590 PSI off bottom 140 RPM 7k TQ on bottom 3k TQ off bottom 8.8ppg MW 9.4ppg ECD 162k PU 143k SO 143k ROT 12,516.0 13,165.0 2/19/2023 19:15 2/19/2023 21:45 2.50 PROD1, DRILL CIRC T Trouble shoot directional tools. Recycle pumps several times. Attempt different downlinks. Pump 25bbl FW sweep. No success. Went back to bottom and drill 2' and tools came on. 13,165.0 13,165.0 2/19/2023 21:45 2/19/2023 23:15 1.50 PROD1, DRILL MPDA P Flow check.Retrieve 4" bearing assembly and install 5" bearing assembly. 13,165.0 13,165.0 2/19/2023 23:15 2/20/2023 00:00 0.75 PROD1, DRILL DDRL P Drill 13165' MD to 13391' MD /8447' TVD. 16k WOB 300 GPM 1965 PSI on bottom 1505 PSI off bottom 140 RPM 8k TQ on bottom 4k TQ off bottom 8.8ppg MW 9.5ppg ECD 162k PU 143k SO 143k ROT 13,165.0 13,391.0 2/20/2023 00:00 2/20/2023 06:00 6.00 PROD1, DRILL DDRL P Drill 13391' MD to 14012' MD /8456' TVD. 9k WOB 300 GPM 2100 PSI on bottom 1720 PSI off bottom 140 RPM 9k TQ on bottom 3k TQ off bottom 8.8ppg MW 9.5ppg ECD 164k PU 146k SO 146k ROT 13,391.0 14,012.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 28/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/20/2023 06:00 2/20/2023 12:00 6.00 PROD1, DRILL DDRL P Drill 14012' MD to 14581' MD /8456' TVD. 10k WOB 300 GPM 2100 PSI on bottom 1630 PSI off bottom 140 RPM 9k TQ on bottom 5k TQ off bottom 8.8ppg MW 9.6ppg ECD 168k PU 148k SO 144k ROT 14,012.0 14,581.0 2/20/2023 12:00 2/20/2023 18:00 6.00 PROD1, DRILL DDRL P Drill 14581' MD to 15181' MD /8478' TVD. 12k WOB 320 GPM 2150 PSI on bottom 1680 PSI off bottom 140 RPM 11k TQ on bottom 5k TQ off bottom 8.8ppg MW 9.6ppg ECD 167k PU 151k SO 145k ROT 14,581.0 15,021.0 2/20/2023 18:00 2/20/2023 18:45 0.75 PROD1, DRILL OTHR T Troubleshoot MWD pulser, likely LCM related. Cycle pumps and downlink. Cycle repeatedly and tools came back on. 15,021.0 15,021.0 2/20/2023 18:45 2/21/2023 00:00 5.25 PROD1, DRILL DDRL P Drill 15181' MD to 15800' MD /8478' TVD. 10k WOB 320 GPM 2410 PSI on bottom 1945 PSI off bottom 140 RPM 10k TQ on bottom 6k TQ off bottom 8.8ppg MW 9.7ppg ECD 171k PU 154k SO 150k ROT 15,021.0 15,800.0 2/21/2023 00:00 2/21/2023 06:00 6.00 PROD1, DRILL DDRL P Drill 15800' MD to 16347' MD /8482' TVD. 9k WOB 320 GPM 2500 PSI on bottom 2000 PSI off bottom 140 RPM 9k TQ on bottom 6k TQ off bottom 8.8ppg MW 9.8ppg ECD 174k PU 155k SO 156k ROT 15,800.0 16,347.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 29/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/21/2023 06:00 2/21/2023 12:00 6.00 PROD1, DRILL DDRL P Drill 16347' MD to 17053' MD /8482' TVD. 8k WOB 288 GPM 2095 PSI on bottom 1568 PSI off bottom 140 RPM 10k TQ on bottom 6k TQ off bottom 8.8ppg MW 9.8ppg ECD 185k PU 155k SO 156k ROT 16,347.0 17,053.0 2/21/2023 12:00 2/21/2023 18:00 6.00 PROD1, DRILL DDRL P Drill 17053' MD to 17560' MD /8494' TVD. 9k WOB 290 GPM 2220 PSI on bottom 1700 PSI off bottom 140 RPM 10k TQ on bottom 7k TQ off bottom 8.8ppg MW 9.9ppg ECD 190k PU 156k SO 176k ROT 17,053.0 17,560.0 2/21/2023 18:00 2/22/2023 00:00 6.00 PROD1, DRILL DDRL P Drill 17560' MD to 18148' MD /8496' TVD. 16k WOB 290 GPM 2330 PSI on bottom 1840 PSI off bottom 140 RPM 10k TQ on bottom 7k TQ off bottom 8.8ppg MW 9.9ppg ECD 195k PU 156k SO 172k ROT 17,560.0 18,148.0 2/22/2023 00:00 2/22/2023 06:00 6.00 PROD1, DRILL DDRL P Drill 18148' MD to 18595' MD /8474' TVD. 8k WOB 290 GPM 2330 PSI on bottom 1840 PSI off bottom 140 RPM 12k TQ on bottom 7k TQ off bottom 8.8ppg MW 10.0ppg ECD 196k PU 160k SO 170k ROT 18,148.0 18,595.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 30/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/22/2023 06:00 2/22/2023 12:00 6.00 PROD1, DRILL DDRL P Drill 18595' MD to 19184' MD /8492' TVD. 9k WOB 290 GPM 2314 PSI on bottom 1808 PSI off bottom 140 RPM 11k TQ on bottom 8k TQ off bottom 8.8ppg MW 10.2ppg ECD 210k PU 152k SO 181k ROT 18,595.0 19,184.0 2/22/2023 12:00 2/22/2023 17:00 5.00 PROD1, DRILL DDRL P Drill 19184' MD to 19517' MD /8520' TVD. 10k WOB 290 GPM 2290 PSI on bottom 11780 PSI off bottom 140 RPM 11k TQ on bottom 8k TQ off bottom 8.8ppg MW 10.1ppg ECD 210k PU 152k SO 181k ROT 19,184.0 19,517.0 2/22/2023 17:00 2/22/2023 19:00 2.00 PROD1, TRIPCAS CIRC P Circulate and condition mud. 19,517.0 19,517.0 2/22/2023 19:00 2/22/2023 19:30 0.50 PROD1, TRIPCAS OWFF P Attempt to fingerprint well. Not building pressure. Open valve and flow check. Static. 19,517.0 19,517.0 2/22/2023 19:30 2/23/2023 00:00 4.50 PROD1, TRIPCAS CIRC P Circulate 4 x BU racking back 1 stand per BU to 19237'. 290 GPM 2245 PSI 19,517.0 19,237.0 2/23/2023 00:00 2/23/2023 02:30 2.50 PROD1, TRIPCAS CIRC P Continue circulating 4 x BU racking back 1 stand per BU to 19237'. 290 GPM 2245 PSI 19,237.0 19,143.0 2/23/2023 02:30 2/23/2023 03:00 0.50 PROD1, TRIPCAS WASH P Wash/Ream back to bottom. 288 GPM 2200 PSI 120 RPM 8k TQ 19,143.0 19,517.0 2/23/2023 03:00 2/23/2023 04:00 1.00 PROD1, TRIPCAS CIRC P Circulate while prep for displacement. 288 GPM 2200 PSI 125 RPM 8k TQ 19,517.0 19,517.0 2/23/2023 04:00 2/23/2023 08:00 4.00 PROD1, TRIPCAS DISP P Displace hole to 9.0ppg Vis Brine. Stage rates up to 200 GPM. 80-200 GPM 510-1060 PSI 20 RPM 8k TQ 19,517.0 19,517.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 31/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/23/2023 08:00 2/23/2023 08:30 0.50 PROD1, TRIPCAS OWFF P Flow Check. Static. 19,517.0 19,517.0 2/23/2023 08:30 2/23/2023 14:00 5.50 PROD1, TRIPCAS SMPD P SOOH f/ 19517' to 13201'. 19,517.0 13,201.0 2/23/2023 14:00 2/23/2023 15:00 1.00 PROD1, TRIPCAS MPDA P Retrieve 5" bearing assembly and install 4" bearing assembly. 13,201.0 13,201.0 2/23/2023 15:00 2/23/2023 18:00 3.00 PROD1, TRIPCAS SMPD P SOOH f/ 13201' to 9691'. Observed overpull (20k) @ 10809'. Wiped through spot 3 times. Observed no overpull coming through spot. 13,201.0 9,691.0 2/23/2023 18:00 2/23/2023 19:00 1.00 PROD1, TRIPCAS CIRC P Circulate liner volume.SD. Blow down TD. Drop well commander opening ball. 9,691.0 9,691.0 2/23/2023 19:00 2/23/2023 21:00 2.00 PROD1, TRIPCAS SMPD P SOOH f/ 9691' to 8265'. 9,691.0 8,265.0 2/23/2023 21:00 2/23/2023 22:30 1.50 PROD1, TRIPCAS CIRC P Pressure up and open well commander. Shifted open @ 2600PSI. Circulate 2 BU and clean hole f/ TOL w/ well commander. 600 GPM 1210 PSI 20 RPM 2k TQ 8,265.0 8,184.0 2/23/2023 22:30 2/24/2023 00:00 1.50 PROD1, TRIPCAS MPDA P Drop well commander closing ball. Strip 5" bearing assembly off of pup joint. 8,184.0 8,184.0 2/24/2023 00:00 2/24/2023 01:00 1.00 PROD1, TRIPCAS MPDA P Install trip nipple. Install PS-21 slips. Drop 2.25" hollow drift. 8,184.0 8,184.0 2/24/2023 01:00 2/24/2023 01:30 0.50 PROD1, TRIPCAS CIRC P Pressure up and close well commander. Shifted at 3100 PSI. 8,184.0 8,184.0 2/24/2023 01:30 2/24/2023 06:30 5.00 PROD1, TRIPCAS TRIP P POOH f/ 8184' to 210'. 8,184.0 684.0 2/24/2023 06:30 2/24/2023 09:00 2.50 PROD1, TRIPCAS BHAH P Flow check. LD BHA. 684.0 0.0 2/24/2023 09:00 2/24/2023 09:30 0.50 PROD1, TRIPCAS CLEN P Clean and clear rig floor. 0.0 0.0 2/24/2023 09:30 2/24/2023 11:00 1.50 PROD1, TRIPCAS SLPC P Slip Cut drill line. 0.0 0.0 2/24/2023 11:00 2/24/2023 11:30 0.50 COMPZN, CASING RURD P PU Cement head/swivel. MU pup joint for space out. Lay back down to pipe shed. 0.0 0.0 2/24/2023 11:30 2/24/2023 13:00 1.50 COMPZN, CASING RURD P RU tbg running equipment. Prep to run tbg. 0.0 0.0 2/24/2023 13:00 2/24/2023 13:30 0.50 COMPZN, CASING SVRG P Service Top drive/Blocks/ derrick inspection. 0.0 0.0 2/24/2023 13:30 2/25/2023 00:00 10.50 COMPZN, CASING PUTB P MU FS and RIH w/ 4.5" 12.10# P-110 Hyd 563 tbg to 9650'. 0.0 9,650.0 2/25/2023 00:00 2/25/2023 00:30 0.50 COMPZN, CASING PUTB P RIH w/ 4.5" 12.10# P-110 Hyd 563 tbg f/ 9650' to 9859'. 9,650.0 9,859.0 2/25/2023 00:30 2/25/2023 01:30 1.00 COMPZN, CASING PUTB P PU and MU 4 1/2" liner hanger and packer per Baker. Fill tie back sleeve w/ Zan Plex. 9,859.0 9,859.0 2/25/2023 01:30 2/25/2023 03:00 1.50 COMPZN, CASING RUNL P RIH w/ 1 std 4" Drill pipe. Take parameters: PU- 88k SO- 93k ROT- 85k TQ- 2.5k. Continue RIH w/ liner on 4" DP to 11590'. 9,859.0 11,590.0 2/25/2023 03:00 2/25/2023 10:30 7.50 COMPZN, CASING RUNL P Swap over to 5" DP and continue RIH to 19517'. Tag bottom. PU 213k. SO 155k. Note: Drift 5" DP out of derrick. 11,590.0 19,517.0 2/25/2023 10:30 2/25/2023 16:00 5.50 COMPZN, CEMENT CIRC P Pressure up at 1/2 bpm and shear flotation sub @ 1348psi. Pump @ 6bpm till pressure observed. SD and stage rates rate up f/ 1bpm to 3.5 bpm. 19,517.0 19,517.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 32/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/25/2023 16:00 2/25/2023 17:00 1.00 COMPZN, CEMENT RURD P SD. PU and MU cement swivel/head and cement line. PJSM w/ cementers. 19,517.0 19,517.0 2/25/2023 17:00 2/25/2023 20:30 3.50 COMPZN, CEMENT CMNT P Pump 5bbbls FW w/ cement unit. Pressure tet lines to 4200psi. Mix and pump 30bbls of 13.5ppg MudPush. Mix and pump 239bbls of 15.3ppg cement. SD drop dart and nerf ball. Pump 20bbls FW w/ cement unit. Swap over to rig pumps. Displace w/ rig pumps. Pump @ 8bpm to catch cement (80bbls). Slow rate to 4bpm.Observed top dart shear @ 1340psi. Plug down @ 19:57hrs 2/25/23. FCP-765psi. Pressure up to 1280psi. Held 5 min and check floats. 1.7bbls back floats held. Good returns throughout job. 19,517.0 19,517.0 2/25/2023 20:30 2/25/2023 21:30 1.00 COMPZN, CEMENT PACK P Set liner hanger/packer as per Baker rep. Presure up to 2500psi f/ 5 min. Pressure up to 3500psi. Slack off to 100k.Set packer. Rotate @ 20 rpm/4k tq. work down 3 times. LD cement swivel/head. Pressure up to 500psi and sting out. Observed pressure drop stinging out. 19,517.0 19,517.0 2/25/2023 21:30 2/25/2023 22:30 1.00 COMPZN, CEMENT CIRC P Circulate nerf ball around. Stage pumps to 10bpm/570psi.5 rpm/4k tq . Observed mud push and 15bbls of cement to surface. 19,517.0 19,517.0 2/25/2023 22:30 2/26/2023 00:00 1.50 COMPZN, CEMENT PULD P POOH LD 5" DP. 9,631.0 9,166.0 2/26/2023 00:00 2/26/2023 10:30 10.50 COMPZN, CEMENT PULD P POOH LD 5" and 4" DP. 9,166.0 42.0 2/26/2023 10:30 2/26/2023 11:00 0.50 COMPZN, CEMENT PULD P LD liner running tool. 42.0 0.0 2/26/2023 11:00 2/26/2023 12:30 1.50 COMPZN, CEMENT PRTS P Close blinds and pressure test casing/liner to 3500 PSI f/ 30 minutes. Charted. Good test. 16 bbls pumped. 10.3bbls returned. RD test equipment. 0.0 0.0 2/26/2023 12:30 2/26/2023 13:30 1.00 COMPZN, WELLPR BHAH P MU scraper BHA and RIH to 90'. 0.0 90.0 2/26/2023 13:30 2/26/2023 20:00 6.50 COMPZN, WELLPR TRIP P RIH f/ 90' to 9624'. 90.0 9,624.0 2/26/2023 20:00 2/26/2023 20:30 0.50 COMPZN, WELLPR CIRC P Break circulation. Wash down to 9647' w/ muleshoe. Set 5k down on TOL. PU and circulate f/ 5 minutes 200GPM/330PSI 20 RPM/4k TQ. POOH and laydown single for spaceout to work full std. 9,624.0 9,624.0 2/26/2023 20:30 2/26/2023 21:30 1.00 COMPZN, WELLPR CIRC P Circulate and reciprocate DS f/ 9624' to 9541'. 700GPM 2210 PSI 20 RPM 3.5k TQ 9,624.0 9,624.0 2/26/2023 21:30 2/26/2023 23:00 1.50 COMPZN, WELLPR DISP P Displace hole to 9.0 CI brine. Pump 40bbl slug and chase. Perform flow check. 700GPM 2950 PSI 20 RPM 3.5k TQ 9,624.0 9,624.0 2/26/2023 23:00 2/27/2023 00:00 1.00 COMPZN, WELLPR PULD P POOH LD 4" DP f/ 9624' to 8973'. 9,624.0 8,973.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 33/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 2/27/2023 00:00 2/27/2023 09:00 9.00 COMPZN, WELLPR PULD P POOH LD 4" DP f/ 8973' to surface. Simops: Stgae upper completion equipment. 8,973.0 0.0 2/27/2023 09:00 2/27/2023 10:00 1.00 COMPZN, WELLPR BHAH P LD scraper assembly. Scrape magnets and empty junk basket. 0.0 0.0 2/27/2023 10:00 2/27/2023 11:00 1.00 COMPZN, WELLPR TRIP P MU muleshoe and RIH w/ excess stds of 4" DP (18 stds). 0.0 1,700.0 2/27/2023 11:00 2/27/2023 13:00 2.00 COMPZN, WELLPR PULD P POOH LD 4" DP 1,700.0 0.0 2/27/2023 13:00 2/27/2023 14:00 1.00 COMPZN, WELLPR NUND P Retrieve wear bushing. 0.0 0.0 2/27/2023 14:00 2/27/2023 16:00 2.00 COMPZN, WELLPR CIRC P MU jetting sub and jet BOP and wellhead area. 0.0 0.0 2/27/2023 16:00 2/27/2023 17:00 1.00 COMPZN, RPCOMP RURD P RU to run upper completion. 0.0 0.0 2/27/2023 17:00 2/27/2023 18:00 1.00 COMPZN, RPCOMP PUTB P PJSM. RIH w/ upper completion.P/U HES downhole gauge assembly & test to 9500psi. 5min Good test. CPAI witness. 0.0 240.0 2/27/2023 18:00 2/28/2023 00:00 6.00 COMPZN, RPCOMP PUTB P RIH w/ upper completion f/ 240' MD to 4210' MD. Running TEC line and installing Cannon clamps every joint. Checking control line every 1000' MD. 240.0 4,210.0 2/28/2023 00:00 2/28/2023 07:30 7.50 COMPZN, RPCOMP PUTB P RIH w/ upper completion f/ 4210' MD to 9639' MD. Running TEC line and installing Cannon clamps every joint. Checking control line every 1000' MD. Tag up calculate spaceout. 4,210.0 9,639.0 2/28/2023 07:30 2/28/2023 09:30 2.00 COMPZN, RPCOMP THGR P MU pup joints. 9.7'/9.76'/7.93'/7.84' and joint #231. MU hanger and landing joint. Terminate line through hanger and test to 5000psi. Good test. Land hanger. Drop 1 5/16" ball and rod. 9,639.0 9,639.0 2/28/2023 09:30 2/28/2023 10:30 1.00 COMPZN, RPCOMP PRTS P RU test equipment. Test hanger seals to 3000psi f/ 5 min. Good test. 9,639.0 9,639.0 2/28/2023 10:30 2/28/2023 14:00 3.50 COMPZN, RPCOMP PRTS P RU test lines.Pressure up tubing, set pkr and test tbg to 4,200 & hold for 30 minutes Bleed tubing down to 3,000 psi & bring pressure on IA to 4,200 psi & hold pressure for 30 minutes Bleed tubing to 0 psi, Shear SOV.Tubing & IA equalized & bled to 0 psi Observed IA for flow for 30 minutes, No flow 9,639.0 0.0 2/28/2023 14:00 2/28/2023 15:30 1.50 COMPZN, RPCOMP PRTS P Vac out BOP stack, Pull landing joint and install BPV, Pump down IA, Test BPV in direction of flow to 3,000psi 10min. Good test. 0.0 0.0 2/28/2023 15:30 2/28/2023 16:00 0.50 COMPZN, WHDBOP RURD P Retrieve trip nipple. Strip 5" bearing assembly off of joint. 0.0 0.0 2/28/2023 16:00 2/28/2023 18:30 2.50 COMPZN, WHDBOP RURD P LD MH. Skid Joe's box. ND BOP and skid back. 0.0 0.0 2/28/2023 18:30 2/28/2023 19:30 1.00 COMPZN, WHDBOP RURD P ND risers. 0.0 0.0 2/28/2023 19:30 2/28/2023 23:00 3.50 COMPZN, WHDBOP THGR P Move tree adapter flange to BOP deck.Terminate control line at well head, SimOps: Clear rig floor. Swap Baker BPA skid. Remove shock hoses. ND adapter flange on top of surface annular. Remove kelly hose. Blow down test pump. 0.0 0.0 2/28/2023 23:00 3/1/2023 00:00 1.00 COMPZN, WHDBOP NUND P NU tree adapter flange. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 34/34 MT7-97 Report Printed: 3/27/2023 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 3/1/2023 00:00 3/1/2023 03:00 3.00 COMPZN, WHDBOP PRTS P NU adapter flange and test to 5000psi. Good test. NU frac tree and test to 9,800psi CPAI witness. R/D test pump and lines. RU and freeze protect IA. 0.0 0.0 3/1/2023 03:00 3/1/2023 03:30 0.50 COMPZN, WHDBOP OTHR P FMC pull BPV and clean out cellar area. 0.0 0.0 3/1/2023 03:30 3/1/2023 07:30 4.00 COMPZN, WHDBOP FRZP P RU and freeze protect IA with LRS pump 82bbls down IA take returns up tubing. Shut in and R/D LRS, U-Tube tubing and IA 1 hr. Final 150psi on IA, 150 psi on tubing, 0psi on OA. SIMOPS: Thaw and clean cellar box. 0.0 0.0 3/1/2023 07:30 3/1/2023 10:00 2.50 DEMOB, MOVE RURD P R/D service lines in cellar and secure tree. SIMOPS: Prep and scope and lower derrick. Rig release at 10:00hrs 3-1-23 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 3/1/2023 Page 1/1 MT7-97 Report Printed: 3/27/2023 Cement Cement Details Description Surface String Cement Cementing Start Date 1/30/2023 03:30 Cementing End Date 1/30/2023 07:17 Wellbore Name MT7-97 Comment Mix and pump 100 bbls of 11.0 ppg Mud Push II @ 4.5 bbls/min, 400 psi, Dropped bottom plug, Add two gallions dye. Start batching lead. Pump 361.5 bbls of 11.0 ppg DeepCRETE cement at 5.3 bbls/min, 470 psi ICP. Batch and pump 72 bbls of G Blend Tail 15.8 ppg cement @ 4.0 bbls/min, 312 psi. Drop top plug & kick out with 20 bbls of fresh H2O. Swap to rig & displace @ 8 bbls/min, 222 psi ICP, 563 psi FCP. Slow pumps 20 bbls prior to calculated bump to 3 bbls/min, 353 psi ICP, Bump plug with 914 psi (444 bbls + 20 bbls). 3751 strokes, final circ. PSI 353 Pressure up to 915 psi & hold for 5 minutes. Bleed off pressure, Check floats good. 120 bbls cement to surface. Cement in place @ 07:17hrs 1/30/23 Cement Stages Stage # 1 Description Surface String Cement Objective Top Depth (ftKB) 39.0 Bottom Depth (ftKB) 3,189.0 Full Return? Yes Vol Cement … 120.0 Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 5 Q Pump Final (bbl/… 3 Q Pump Avg (bbl/… 5 P Pump Final (psi) 353.0 P Plug Bump (psi) 914.0 Recip? Yes Stroke (ft) 10.00 Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Lead Cement Fluid Description Estimated Top (ftKB) 38.2 Est Btm (ftKB) 2,689.0 Amount (sacks) 1,040 Class Blend Volume Pumped (bbl) 361.5 Yield (ft³/sack) 1.92 Mix H20 Ratio (gal/sack) 6.69 Free Water (%) Density (lb/gal) 11.00 Plastic Viscosity (cP) 143.0 Thickening Time (hr) 6.19 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 2,689.0 Est Btm (ftKB) 3,189.0 Amount (sacks) 72 Class G Volume Pumped (bbl) 72.0 Yield (ft³/sack) 1.16 Mix H20 Ratio (gal/sack) 5.04 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) 80.0 Thickening Time (hr) 4.03 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Surface String Cement Page 1/1 MT7-97 Report Printed: 3/27/2023 Cement Cement Details Description Intermediate String 1 Cement Cementing Start Date 2/6/2023 21:30 Cementing End Date 2/7/2023 01:30 Wellbore Name MT7-97 Comment Line up cement unit. flush w/ 2 bbls FW. Test lines to 3700psi. Good test. Mix and pump 60bbls 12.5ppg mud push II at 4 bpm. SD and drop bottom plug. Mix and pump 69bbls 13.0 ppg G lead cement at 4.5bpm, Mix and pump 153bbls 15.8 ppg G Tail cement at 4.5 bpm. SD and drop top plug. Pum p 20 bbls FW w/ cement unit. Swap over to rig pumps and begin displace cement at 8bpm. Cement Stages Stage # 1 Description Intermediate String 1 Cement Objective Top Depth (ftKB) 5,309.0 Bottom Depth (ftKB) 8,232.6 Full Return? No Vol Cement …Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 5 Q Pump Avg (bbl/… 5 P Pump Final (psi) 998.0 P Plug Bump (psi) Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Fluid Description Estimated Top (ftKB) Est Btm (ftKB) Amount (sacks) Class Volume Pumped (bbl) Yield (ft³/sack) Mix H20 Ratio (gal/sack) Free Water (%) Density (lb/gal) Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 1 Cement Page 1/1 MT7-97 Report Printed: 3/27/2023 Cement Cement Details Description Intermediate String 2 Cement Cementing Start Date 2/11/2023 14:00 Cementing End Date 2/11/2023 16:00 Wellbore Name MT7-97 Comment Blow down TD and RU cement line. Pressure test line to 4500psi. Pump70bbls KCL w/ rig.Drop bottom dart. Swap to cementers.Mix and pump 70bbls 15.8ppg cement @ 4BPM. Sd and drop top dart.Pump 20bbl FW w/ cementers. Sawap over to rig pumps and displace cement w/ 173bls 11.5ppg OBM. 2043stks pumped.FCP 281 PSI. Pressure up to 1000 PSI and hold f/ 5 min. Bleed off and check floats. Good. Cement in place. @ 15:54hrs 2-11-23 TOL @ 8078'. Cement Stages Stage # 1 Description Intermediate String 2 Cement Objective Top Depth (ftKB) 9,017.0 Bottom Depth (ftKB) 9,779.0 Full Return? Yes Vol Cement …Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 2 Q Pump Avg (bbl/…P Pump Final (psi) P Plug Bump (psi) Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Fluid Description Estimated Top (ftKB) Est Btm (ftKB) Amount (sacks) Class Volume Pumped (bbl) Yield (ft³/sack) Mix H20 Ratio (gal/sack) Free Water (%) Density (lb/gal) Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 2 Cement Page 1/1 MT7-97 Report Printed: 3/27/2023 Cement Cement Details Description Production String 1 Cement Cementing Start Date 2/25/2023 16:30 Cementing End Date 2/25/2023 20:00 Wellbore Name MT7-97 Comment Pump 5bbbls FW w/ cement unit. Pressure tet lines to 4200psi. Mix and pump 30bbls of 13.5ppg MudPush. Mix and pump 239bbls of 15.3ppg cement. SD drop dart and nerf ball. Pump 20bbls FW w/ cement unit. Swap over to rig pumps. Displace w/ rig pumps. Pump @ 8bpm to catch cement (80bbls). Slow rate to 4bpm.Observed top dart shear @ 1340psi. Plug down @ 19:57hrs 2/25/23. FCP-765psi. Pressure up to 1280psi. Held 5 min and check floats. 1.7bbls back floats held. Good returns throughout job. Cement Stages Stage # 1 Description Production String 1 Cement Objective Top Depth (ftKB) 9,624.0 Bottom Depth (ftKB) 19,517.0 Full Return? No Vol Cement …Top Plug? No Btm Plug? Yes Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 2 Q Pump Avg (bbl/… 4 P Pump Final (psi) 765.0 P Plug Bump (psi) 1,280.0 Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Primary Cement Fluid Description Estimated Top (ftKB) 9,624.0 Est Btm (ftKB) 19,517.0 Amount (sacks) 1,015 Class G Volume Pumped (bbl) 239.0 Yield (ft³/sack) 1.32 Mix H20 Ratio (gal/sack) 4.06 Free Water (%) Density (lb/gal) 15.30 Plastic Viscosity (cP) Thickening Time (hr) 8.20 CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Production String 1 Cement ! " # " !$%&$ 50-103-20849-00 ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! )( )( ' . ( ) )(2 '! &03 # - '! &442- 5 1 52 1 6(7 8 2 9 # 2 99 # # # *-" ( *" ( / -( -( 0/1% 0 1% 2 "* ( ! ()(( ()(( *5!'*5:/,)( !(5( !),( '(()*( "/ ( ()(( (;'(<7),' '*';7'<,)/'' , 345 6 " - 3!5 ) - 345 ! " ) - %( '='!=(, '7) :(),/ * 5'(/)*/ (+ ( " ( - ! ')( 28 + ( 6)3!+ 5 3 5 0 1% 3 5 345 0/1% 3 5 ! 7 (,!)'( '/,)!()((()((,!)'( 6) 3 5 -) ! ) 3 , 5 ! 3 5 ,='=(, >?$ ?$ >$ $ @')''(,) ! '57*)!* ! ' & ! -'=!=(, A7'A( +>B++ 4 +>B+ 9+ # '57 /)!7 ,5'!)( ! & ! -'=!=(, A7:A( +>B++ 4 +>B+ 9+ # ,5 ) ! :577)(( ! , & ! -'=!=(, A7:A( +>B++ 4 +>B+ 9+ # :57!)*' !5 **)'( ! 7 & ! -'=!=(, A7:A( +>B++ 4 +>B+ 9+ # !5 !)(( '!5*' )(( ! * & ! -'=!=(, A7:A( 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) ,!)'( ()(( ()(( ,!)'( ()(( ()(( '(()*( *5!'*5:/,)( !(5( !),( ()(( ()(( 20B>0 '(,) ! ():: '(,)(' '(,) ! ()'' ()7: ,*):' *5!'*5:/)!7 !(5( !) : '),/ ()* >?$ ?$&'- '7')* ')(* '()// '7')7 ()* ')'(')/7 *5!'*5:/) : !(5(:(),! ()7* ()*/ >?$ ?$&'- ,7),, '), '(()!( ,7),( ()/7 )!:!7) ( *5!'*5:/),7 !(5(:)/ ()! ')7 >?$ ?$&'- ,*)!! (),* /:)7 ,*)!/ ():* ,) 7':/),/ *5!'*5:/)'' !(5(:,)(' '):' '):! >?$ ?$&'- 7':) / ):' ,((), 7':)/: ()! ')7! !)(: *5!'*5:/,),' !(5(:():( ) ()'* >?$ ?$&'- *(!)(7 *)'( ,(!)( *(:) 7 ,)!, ,)*7,/!)'7 *5!'*5:/ )(! !(5( *): )/ 7) : >?$ ?$&'- /():: /)/ ,( )/ /()(! !):/ '')(/7/)7! *5!'*5: ,) !(5(/:)*' ')/, ')/ >?$ ?$&'- /! )* /) ' ,'')7: /!*): '/):, '!)*(**/) *5!'*5::()7, !(5(/() ()7: ') >?$ ?$&'- !)* /)7* ,'()7, !()* ,)!! ) */*()! *5!'*5:: ):' !(5(*) (),( ,()!* >?$ ?$&'- ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) :: )( /)7* ,'()(: ::7)** ,():/ ,*):/ 77)!* *5!'*5:!7)!( !(5(77),' ()(7 ,!): >?$ ?$&'- !:),* /),/ ,'()(: ! !)'( , )/! 7,)!::,!)*( *5!'*5!(')!/ !(5(,/),: ()(! 7:) * >?$ ?$&'- '5( /)'/ *)// :*): '5( )7' 7),( *)7'!,):' *5!'*5!(/):( !(5(:)(: ) : **)*: >?$ ?$&'- '5' ()(( *)// */)! '5'/*):' 7)7/ /'),/'5(/)' *5!'*5!( )' !(5('!)'7 ,)( *:),' >?$ ?$&'- '5/7)' /)7* ,,) ! '5*!)7 ,:)7 ()'7'5''!): *5!'*5!(,), !(5('()* )/7 */) ! >?$ ?$&'- '5,*!)*( )*( ,() '5,*7)(! ,')'( !)*'5'7)7! *5!'*5:!/),* !(5((()!* ')'! *)* >?$ ?$&'- '57*)!* !)(: '):7 '577/)* ') ( ::):/'5,(/)! *5!'*5:: ), :!5!!')(: )', 7/),, >?$ ?$&'- '57 /)!7 !)7/ ()'! '57 ()7 ':) ! !'),!'5,,()/7 *5!'*5::7),: :!5!::)7/ ')!, 77) +>B++&- '5* ()!' '')', ')* '5*/) ( *)7 '(')*'57,)'( *5!'*5: ')'' :!5! :), ),( ,7)', +>B++&- '5//*),( ',)' (!)! '5/*7)! '') / ''')*'5*'*), *5!'*5:*7)7( :!5!/ )*( )7 () ! +>B++&- '5 /()'/ '7)! (:),! '5 7 )' ,')7, ')7 '5/( )* *5!'*5:,*)(* :!5!*/)(' ')7 *)'( +>B++&- '5:*7)*7 '*)*, ( )(* '5:,:), *)!, ',,) /'5/!:) *5!'*5:',): :!5!77)', '),/ ')7 +>B++&- '5!7/),7 ':)( (:)** '5!/)( /),! '7/)'*'5 :/)/( *5!'*5 !() :!5!,')(! ):' ,')'* +>B++&- 5(7()! ()( (!)7: 5('7)!! '(,) '/')(*'5: *),! *5!'*5 /7),/ :!5!'*)7* )'* *)* +>B++&- 5',7):' ')7: (:),7 5'(,),/ ',)* ' )*'5!/,) / *5!'*5 ,*)7 :!5:!:)7* ')** /)( +>B++&- 5!) 7 ,)( (/), 5'!')'/ '/7)/, '!,):'5(*')*/ *5!'*5 (,):! :!5::')(' ')!: '(')!/ +>B++&- 5,7), *),7 ( )/( 5 ),( '!!) '')775', ) ( *5!'*5//!) ! :!5:/)7 ),, ',()(, +>B++&- 57':)!! /)7* ( ) ' 5,/)*7 ,*):: ,()/*5)!7 *5!'*5/,,)/! :!5:7)( ')' '*!)/ +>B++&- 5*') /)(* (:)7 577/)/* )7: *()'/5,( )(* *5!'*5*! )/7 :!5:')/: ()*7 ':!)(/ +>B++&- 5/(*)7( *):/ (:),' 5*!)!7 ,(:)'* /!)75,!(),7 *5!'*5*/)* :!5:(')77 ()' ' )/! +>B++&- 5 (')( *)* (:) , 5/'/)'' ,77)* :!)'57 /)*' *5!'*5*/)// :!5 :()/* ()7( 7/):! +>B++&- 5 !*)*' *)' (!)'/ 5 (')*( , !)! ,(:) !5*/')!( *5!'*57!'):, :!5 /()'( ()7 *)'/ +>B++&- 5::!)! *)!7 (:)** 5 :/) 7'*)// ,:)7*5/7 )' *5!'*57*/) ( :!5 ,!)7/ ():/ ,(,)/! +>B++&- 5!:7) *):, (:)': 5: ')!/ 7*)(/ ,7:)'(5 ,),/ *5!'*57():/ :!5 ':):( ()' ,,)!' +>B++&- ,5( :): *)// ( )( 5!*/) 7::) ,/ )''5:' )' *5!'*5,:*)'! :!5/!:):( ()7! ,/)' +>B++&- ,5'!)( *)* (:)/7 ,5(()(* *( ),' , )(5:/)7* *5!'*5,//)77 :!5/::)'! ')7: , )7/ +>B++&- ,5 ) ! 7)** (:)*! ,5(!')/7 *7,): ,! )''5!*)(7 *5!'*5,,()*( :!5// ) () ' 7(/) ( +>B++&,- ,5*():! 7):: (:)7, ,5'')/ **),' 7(') 5! ,)( *5!'*5,)'7 :!5//)7, ')7/ 7',)*' +>B++&,- ,5,7*)* /)7( ( ):' ,5'! )!, *::)7 7')(,5(*:),, *5!'*5:/)*: :!5/7)'7 ')/, 77)** +>B++&,- ,57,!)/( /)' (:)( ,5:) /*)/ 77()*,,5'7)/ *5!'*5*(),( :!5/')/' () 7 ), +>B++&,- ,5*,7)(: /),/ (:)/: ,5,//)!: //)(: 7/()7(,5 ),: *5!'*5'7)(7 :!5/(() , (),* *(') : +>B++&,- ,5/:)*/ /)' (:),: ,57*')/! /!:):7 7:(),!,5,')(! *5!'*5' ):* :!5* !) , ()' *,')7 +>B++&,- ,5 )/* /) (!)!' ,5*,/)'' ,*)'7 *(()/,,5,!/)*' *5!'*5'7)', :!5**:)7! () */()'! +>B++&,- ,5:'/) 7 /)'/ '()'/ ,5/()*7 ')(! *')7',57:()!7 *5!'*5'(/) : :!5*,/) ()', *::)/* +>B++&,- ,5!'), /)7 '() ,5 (/),( :( )7/ *7):',5*//) ( *5!'*5( ')(' :!5*'7),, ()! /' ),7 +>B++&,- 75((/)( /) '')' ,5 !(), :7,)(, */7)',,5/*() *5!'*5(,/)(* :!57!)( ()' /7*) +>B++&,- 75'(')/7 /) '') 7 ,5: /)( : !)' *:/)'!,5 ,/)7 *5!'*5((()*! :!57/:)! ()! / ,)*( +>B++&,- 75'!*)7: *):: '()!/ ,5!/(),/ !'7),* /( )/*,5:() / *5!'75!/*)! :!577/)*7 ()** (')( +>B++&,- 75:!) * *):' '()*7 75(7*)( !7!)/ /:)//,5!(*)/( *5!'75!,')* :!577)*/ ()' :):* +>B++&,- 75,:,)! *)!, (!) / 75'!)!7 !:*)( /7!),(,5!!(),7 *5!'75:!/),' :!57()!* (),: */)!* +>B++&,- ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) 757 /)(7 *)!' (!)/ 75') ! '5(()7 //!)',75( ,)'! *5!'75:/'):, :!5,:)'* ()7 :7):' +>B++&,- 75* ()! /)(( (!), 75!:)'* '5(*/)7! /:!)7,75'*:)** *5!'75:/)'/ :!5,/():/ ()'( :',) ( +>B++&,- 75//*)( /)(! (!)', 75,:)/! '5(!)*/ (!)*:757,)(! *5!'75 !()// :!5,,!) ()'' :7)7/ +>B++&,- 75 /()(: /)(7 (!),! 757/:)(7 '5':)!: !)!:75,:)77 *5!'75 *7): :!5,':),' ()', : ')7: +>B++&,- 75:*,)/! *):: '()7' 75**)( '5'/7)*' *()7(757')/( *5!'75 '!):: :!5!/)!' ()*' :!!)/, +>B++&,- 75!7:)!7 *)!/ '()7 75/, ): '5(()7( ')*(757!:) *5!'75/:7)*! :!5 7):, ()(! ! )!* +>B++&,- *5(7)'' *):' '():/ 75 ')/! '5,*),! !)775*:)(! *5!'75/*()'! :!5*,)', ()7 !**)7! +>B++&,- *5',/)'! *) : '()*( 75:(/)7( '5 ()/( :',)',75///):( *5!'75/'*)*: :!5,') ()' !:,)' +>B++&,- *5,)'! *):! (:)** 75:!):( '5,( )(( :,,) 775 *,)( *5!'75* !) :!5(!)// ():! '5(')'* +>B++&,- *5,/)!: *):( ( ),: 75! :)'' '5,7,)7! :*,)'75:,:)*' *5!'75*7,):, :!5':!) ()** '5(7')*, +>B++&,- *57():( *) 7 ( )'* *5(/)/( '5, !) * : '):'75!,)(( *5!'75*(:)'( :!5'/!)*! ()' '5( ():! +>B++&,- *5*'7)/! *):, ( )! *5'7 )'7 '57'/)( :!()7!*5(( )*7 *5!'757 ), :!5'7!)!' ()' '5'((),( +>B++&,- *5/(!)7 *) / (/)!* *5,) '57*)/! !(!)7*5(!)/ *5!'757,/), :!5',()'* ()' '5'!)!: +>B++&,- *5 (7)'' *):* ( )/' *5,' )/: '57:!),! !:)' *5' :)(: *5!'757(()( :!5''()' (), '5'*!) ( +>B++&,- *5 !:)(/ *) 7 (:)' *57() '5**)*, !7 ),(*5/)/ *5!'75,/7)7: :!5(!()(! (): '5'::):' +>B++&,- *5:!'):, *): (:)'/ *57:/)/! '5*/')*' !//)*/*5,7 )(! *5!'75,!)(* :!5(/!):, ()'7 '5' ) , +>B++&,- *5!:/),* *):7 (:)7 *5* ') * '5*! ):7 !:/)(7*57,)'* *5!'75!,): :!5(7!),/ ()(* '57/)!, +>B++&,- /5(:')// *):! (:), *5/* )*' '5/,7)7 '5((*) '*5*' )!' *5!'75* )' :!5(:)/: ()(* '5 /),/ +>B++&,- /5' 7)*, *):, (:)( *5 7')(: '5/ ()'! '5(7):*5/(')7: *5!'75)(7 :!5((:)*: ()'( '5,(*)( +>B++&,- /5/!)' *):( (:) *5:/): '5 (/)* '5(77):*5/:/)/: *5!'75':/)/ ::5!::)', ()'( '5,,7): +>B++&,- /5,/)/( *): ( )* *5!'(), '5 7)7! '5(/,),7*5 () *5!'75'*():, ::5!/:)(: (),, '5,/,)/ +>B++&,- /57* )7, *)** ( )( *5!!*):' '5 !)(* '5(:)'*5:*/)' *5!'75''7):' ::5!7:)( ()7 '5,!):* +>B++&,- /5**'),( *)*! ( )'/ /5(:()7! '5:'*)' '5'(()//*5!7():! *5!'75( !) ::5!:) / ()(: '57)(! +>B++&,- /5/77): *)*( (/)* /5'/7)!' '5:*')'' '5'':):!/5(*),' *5!'75(7,):( ::5!(!)*7 ()! '57*'), +>B++&,- /5 ,!)(' *) * (/):' /57!) ! '5:: )7! '5', )':/5''()'! *5!'75(( )!7 ::5:!()* ()! '57:()!' +>B++&,- /5:,,)/, *)7/ (/)7 /5,,*)' '5!7)(* '5'**)*(/5'!*)* *5!',5! ')!' ::5: ()! (),* '5*'()/* +>B++&,- /5!:)' *)*! (/)' /57()7, '5!/()*: '5' ,)*,/5:():, *5!',5!,*)!( ::5:*'):! ()'! '5*7()7/ +>B++&,- 5()(, *) ! (/)(' /5*(*)( '5!! )', '5'!')7'/5,/*)7 *5!',5:!!):/ ::5:,,)(( () '5* (),, +>B++&,- 5''/)/ *)/ (7)(' /5*:!)! 5(,7)'/ '5(:)/!/57*(), *5!',5:/,), ::5:'7) ( ()!7 '5/(():, +>B++&,- 5'')(' /) '!!)*, /5/ *)'* 5( )/( '57)(/5*,*)** *5!',5:*), ::5 !:),' )'/ '5/,,)7 +>B++&,- 5,(7)!! :)'7 '!*)7: /5 *:) * 5'',)*7 '5,/)::/5/'!)'* *5!',5 :7) / ::5 :7), ):7 '5//:) * +>B++&,- 5,!:) !),( '!'):* /5:7')(( 5'* ),' '57 )7!/5 (')7( *5!',5 7'),( ::5 )*( ), '5 ( )/, +>B++&,- 57!):: ,()! ':!)77 /5!)/ 5(,)/ '5*/)'/5 :,)( *5!',5/!*)/' ::5 /)/( ')/* '5 7!)'/ +>B++&,- 5*::)(: ,'),* ':/)7( 5((7)7, 5*')*/ '5/):/5:/7):, *5!',5/7 )* ::5 *7)* ')!: '5 !,)7! +>B++&,- 5/:'): ,)/ ':7),7 5(:,)7: 5,(() ' '5/ )7/5!7,):: *5!',5*!:)* ::5 7:)/( '):( '5:,!)7 +>B++&,- 5 /),' ,,)/( ':() , 5'/,)(! 5,*)** '5/!)/! 5(,)7! *5!',5*7/) ::5 77):! ), '5:::)7 +>B++&,- 5: ')(, ,7)*, ' ) ' 57')*/ 57(*)*: '5/:)!* 5'(')!/ *5!',57!,) , ::5 77)'/ )(7 '5!,!)* +>B++&,- 5!/*)'* ,*)!: ' *),! 5,':)7 57*!):( '5/*)/ 5' :): *5!',57,!)7* ::5 7*)!7 )'( '5!!)' +>B++&,- :5(*!), ,:),, ' ,) , 5,!,)7 5*'/)7' '5/()* 5*,): *5!',5,:) ' ::5 7!) : ) ' 5(7 )!( +>B++&,- :5'*,) ,!) * ' ,)7' 57//)7( 5* *)': '5*,)/, 5,/):( *5!',5,,) ! ::5 *7) ')*, 5'(/)(! +>B++&,- ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) :5(7)*! ,!)// ' ,)7* 5*(*)! 5/( ) : '57!): 5,//), *5!',5!')(! ::5 * )/ ()': 5',:)7( +>B++&,- :57!)*' ,!)*: ' ,)/* 5*7()*, 5/,/)7 '57/)/* 57(()!, *5!',5/)** ::5 /()(* (),7 5'//)*: +>B++&7- :5,7,),7 7'),7 ' ')! 5/'')! 5/!/)/7 '5,:)!! 57 ), *5!',5(')! ::5 //)(, ) 5/)/, +>B++&7- :57,:)(( 7,)! '/!)'! 5/:')*/ 5 *!):/ '5:)77 5*7')!/ *5!',5',:)7! ::5 7):, ,),* 5!()' +>B++&7- :5*,)** 7/)! '/ )/! 5 7:)! 5:*)7 '5'*)(( 5/(:)/! *5!',5( )*7 ::5 :/)77 ) * 5,*/)! +>B++&7- :5//):/ 7:):: '/*),/ 5:'')!( 5:!,)'* '5'!:) * 5/ ),( *5!',5((7)7, ::5:(():' ,),( 57/)7 +>B++&7- :5 '),! *'),, '/,)7 5: )*, 5!/)!* '5' !)'( 5 ,)!, *5!'5!,7)'' ::5:':)*' ,)'' 57!:)! +>B++&7- :5:'*):, *,) 7 '/()7/ 5!!)!: ,5(,7)'/ '5'**) , 5 !(),: *5!'5:/)! ::5:,!):! ,)7/ 5* ,):7 +>B++&7- :5!(!)(/ */)7* '*:)!' 5!:,),, ,5'(*):7 '5'!)' 5:7,) , *5!'5 :!)!( ::5:/7)7* ,)' 5/*()', +>B++&7- !5((')7: *:):* '* )7 :5(,) : ,5' :)/ '5'(()(' 5:!,)': *5!'5 '/) ' ::5:!')*! ,)(' 5 ): +>B++&7- !5(!7):, /')7' '*/)(/ :5( !) ,5*)*/ '5(/ )! 5!,!)/ *5!'5/7')*7 ::5!')/' )!* 5:(:) +>B++&7- !5':!)77 /,)! '*7):' :5')/ ,5,!)(' '5(,)! 5!:,)( *5!'5*/7)'/ ::5!*7)7 )!* 5:!')*, +>B++&7- !5:7)' //)*' '*,)': :5'/),, ,57(/)/ !!*) :5() , *5!'57:*):! ::5!:!)! ,)'( 5! /), +>B++&7- !5, :): /!)( '*')!7 :5'!:)': ,57:7)(! !*7):*:5(*:)*: *5!'57(/)!: :!5(:)' )!' ,5(/)*, +>B++&7- !57 ,)/: ')* '*(),, :5,()'* ,5*/)7 !'') *:5(!()** *5!'5, )/ :!5(/!)'' ,)', ,5'7!) +>B++&7- !5*/ )// 7),/ '7!) ' :5* )/ ,5/7()( ://):*:5'':)( *5!'57:)/, :!5'''):7 ,)(, ,5, ) +>B++&7- !5//')!, /): '7!):7 :5:')*/ ,5 ':):/ :()!*:5'7')!/ *5!'5'/:)/( :!5'**)*, )(7 ,5,*):: +>B++&7- !5 **)'( )(/ '7:): :5,(,)(* ,5 !/):7 7) ':5'/,)7* *5!'5(:!), :!5'!!)/( '),* ,57',):/ +>B++&7- !5:7 ):: )! '7:)(( :5,,)'7 ,5: ,)!! )/:5':,)*7 *5!'5('()!7 :!577):: ') ,5*('),! +>B++&*- !5!7)*/ !)! '7/),! :5,7'),7 ,5!*)(: / /)!:5(') 7 *5!''5!,')7! :!5!,)(, )/! ,5*!()// +>B++&*- '(5(, )/! !)!( '7*):/ :5,*:)(( 75(!):7 /7) ':5':)7( *5!''5:*),' :!5,7,)(/ ()** ,5/:()'7 +>B++&*- '(5',) ! :()(( '77)'( :5, 7)/( 75'(/)* * ()!::5,*)(( *5!''5 7)' :!5,!7)/7 '):, ,5 /!)(7 +>B++&*- '(5 )(! :')!' '77)*7 :5,:!)7, 75':)'/ *'/)/ :57!):, *5!''5/! )(* :!577/):, )(: ,5:* )'( +>B++&*- '(5,'):! :,)*' '7/)*' :57(')7/ 75*!)/: 7/,)7*:5/'):/ *5!''5/':)'( :!57! ):: )// ,5!7/)/7 +>B++&*- '(57'/)/ :,)!, '7:) ( :57'') : 75,,:):: 7',)'!:5 )': *5!''5*, )*7 :!5*7*)!' ),* 75(,/)!7 +>B++&*- '(5*'()!* :/)'' '*()/ :57()(( 757(),( ,/*)*!:5:()7( *5!''57*7): :!5*!')7 ,)'( 75':)/ +>B++&*- '(5/(/)(* :!)(/ '*')7! :577)(' 75*(,)7/ ,'!)/7:5:7)7' *5!''5, ()7, :!5/,7):* ,) 75')7 +>B++&*- '(5 (')* !')'' '*,)'! :57,): 75*: ) *)7*:5:7) *5!''5:7)!, :!5/ /)/! ):( 75,'7)!, +>B++&*- '(5 !/)'* !()// '*,)' :57)7( 75/ )7 ,)/ :5:):( *5!''5'!!)(: :!5 ' )'( ()7 757(:),* +>B++&*- '(5:!')'7 !()'' '*,)7' :57') / 75 * ),7 '!()(':5:)'/ *5!''5'',)( :!5 * ),! ()/ 75*(')!( +>B++&*- '(5!:*)'' !()(* '*,)/* :57')/, 75:7')7/ '7:)':5:)(, *5!''5( ): :!5 !/)!, ()/ 75*!7)*' +>B++&*- ''5(:()'7 ::) ' '*):! :57)// 75!/), '(*),::5:,)(/ *5!'(5!7'):' :!5:, )! ')/ 75/::)(: +>B++&*- ''5' /)// : )/( '*) ! :57*) *5(')'* /'),*:5:/)' *5!'(5:*7) ! :!5: :)!, ')'* 75 :)!* +>B++&*- ''5/!)! : )*! '*) 7 :57!)/: *5(!*)(( ':) (:5!()(: *5!'(5 ():( :!5!'!)* ()(* 75: 7)*/ +>B++&*- ''5,//)* ::)'' '*):: :57,,),' *5':()!' *)7,:5!,) ' *5!'(5/:,) ( :!5!/()!: ()*/ 75!/!)*, +>B++&*- ''57/()': :!)'/ '*,),7 :57,*)*7 *5/7), / ) *:5!*)!7 *5!'(5*!!)'( !(5((()! ') *5(/')/, +>B++&*- ''5** )7( :!)'( '*') ! :57, )(' *5,*()/* '')*7:5! )7' *5!'(5*'')/ !(5(7,),* ')/( *5'* )'7 +>B++&*- ''5/**)( :!)*/ '*') :57,:)'* *57,/) ( '*:) :5!:)** *5!'(577), !(5(: )' ()7 *5*):7 +>B++&*- ''5 77)*, !()7* '*(): :57,:)'* *5*'*)'! (')/*:5!:)** *5!'(5,77)/: !(5' ):/ ')7' *5,7(),* +>B++&*- ''5:77) !()*7 '*')*7 :57, ): *5/()*! 7!)/!:5! )/: *5!'(5**)!! !(5' ,)7* ()/: *57, ): +>B++&*- ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) ''5!,*)!! !()* '*')/, :57,/)7( *5/:,)/ !,),7:5!/):( *5!'(5' 7)'7 !(5'7):7 ()'( *5* )/: +>B++&*- '5(!)*: !()/, '*')/' :57,*)7 *5 /*)*! ,, )::5!*): *5!'(5(!()/' !(5* )( ()( *5/'!),, +>B++&*- '5'!)', !()'7 '*7)(( :57,7) * *5:*7)', ,:,),':5!*)'* *5!'(5((():* !(5,(()(, )7* *5 ' )' +>B++&*- '5()( :!)', '*7)*! :57,*),, *5!,/)( 7) *:5!*) , *5!(!5!' ):* !(5,, )'! ')! *5:( )(, +>B++&*- '5,',):/ :!)'( '*7)'/ :57,/) /5(()/ 7/,),':5! )' *5!(!5:,)' !(5, *),: ()7/ *5:!!)/ +>B++&*- '57'')'( :!)', '*,)*! :57,:): /5'( )! *(/)':5!:)/: *5!(!5 7,) / !(57'*) * ()*! *5!!*)*! +>B++&*- '5*(,)7/ ::)*: '*7),, :577()' /5'!():: *7/)//:5,(()* *5!(!5/*!) ' !(57*,)! ')(( /5(:/) ' +>B++&*- '5*! )/, ::)(* '*,)/' :577):! /5 *)7/ *: )! :5,(,)! *5!(!5* 7)( !(57!)!' ()!* /5' !)*! +>B++&*- '5/!)7 ::)( '*,)*' :577/)'7 /5,/()', /,()( :5,(/)*7 *5!(!57::) !(5*,)/* ()'' /5 ) : +>B++&*- '5 : )// ::) '*,)7 :577!) /577*),: / ):':5,(!)/ *5!(!57('): !(5* ,)(( (),! /5,//) , +>B++&*- '5::)/ :!):! '*/)(( :57*() 7 /5*,():, ',),*:5,'')'7 *5!(!5,'*): !(5/'')'* ,),: /57/() +>B++&*- '5! /)/( !() / '*,) : :57*()' /5/'/)* *,),::5,'()/' *5!(!5:) ! !(5/7:):( )*, /5**,)*7 +>B++&*- ',5( '):( !():* '*7)', :577:): /5 (') !*)' :5,(!) *5!(!5'7)'* !(5/::)( (),: /5/7 )7 +>B++&*- ',5'/:)( !()!' '*7)7/ :577 ),! /5 ::)*' :,/)!:5,( ) ! *5!(!5(*7)! !(5 )*, (),* /5 7)** +>B++&*- ',5/7)/( !():* '*,)7 :577*)!' /5: *)'7 : !)7/:5,(/),' *5!(:5!//)*' !(5 / )/7 ') /5:, ) * +>B++&*- ',5,*!)7* !()!' '*,)7( :5777)7* /5!*!):: !)(7:5,(7):* *5!(:5::()/, !(5:( ):/ ()': /5!,')'/ +>B++&*- ',57*7) : !() / '*') :577,)(/ 5(77)7: !/*)! :5,(,)7/ *5!(:5 !7):* !(5:7!)7' ') 5(7):' +>B++&*- ',5*7!)/! !() / '*')/7 :577'):( 5':)( '5('()!!:5,()( *5!(:5 '()'( !(5:!)'( ()(: 5'' ) +>B++&*- ',5/77)/, :!)'' '*()!/ :577')!' 5'')! '5(*/)*::5,(),' *5!(:5/*)/( !(5!,*),/ '):: 5'()/, +>B++&*- ',5 ,:)*! ::)7 '*')*! :577,)!7 5!,)/ '5'(') ,:5,(7),7 *5!(:5*7)(( !(5! :)( ()!! 5,()*' +>B++&*- ',5:,()' : )!! '*()!' :577/):' 5, ,)!/ '5'7*) :5,( )' *5!(:57/()*, !'5(()(( ():: 5,!)( +>B++&*- ',5!7):, : )', '*()7 :57*():7 57*/)! '5'!)':5,'')7 *5!(:5, /)!7 !'5(/7)'7 ')'* 57:7): +>B++&*- '75('!), : )', '*) :57**)* 5*,!)(, '5, )/(:5,'*)! *5!(:5!)!: !'5'( )( )'* 5* /)* +>B++&*- '75'',)! ::)'' '*,)/ :57*!)7 5/)*' '5:()*/:5,'!): *5!(:5(:),7 !'5'7 ):7 ')7: 5//:):: +>B++&*- '75(/) :!)(' '*,)(! :57/'):' 5 (*)7/ '5,)*':5,)' *5!(:5'7) !'5': )7/ ()!! 5 /(),: +>B++&*- '75,(')(! :!)', '*)!: :57/,),* 5 :!)!/ '5,/*)*(:5,,) * *5!(:5(,:)/' !'5:)(! ()' 5:*,)/: +>B++&*- '75,!*)(! :!)'/ '*,)// :57/7) * 5: ,)!7 '57( ) (:5,*)'* *5!( 5!*,)*( !'5/ )!7 () 5!7/)7 +>B++&*- '757:!)(, ::)7: '*)*! :57//)/: 5!* ) ' '57*()'*:5, )(: *5!( 5:/:)*: !'5,(:)(* '),* :5(,:)/! +>B++&*- '75*:,)7! :!)'! '*7)( :57/:)/( :5(7)'( '57!)*7:5,!)(( *5!( 5 :,)(* !'5,7:)(: ') 7 :5',') ( +>B++&*- '75/ :)*7 :!)'! '*7)(/ :57/!)!* :5' )* '5*,7)'':5,,(),* *5!( 5/!/)7 !'5,: )/ ()(' :5*)*' +>B++&*- '75 ) / :!)(7 '*,)! :57 ')7( :5')/ '5* *),::5,,'):( *5!( 5/'()/ !'57/)' ()'! :5,':)7! +>B++&*- '75://) :!)', '*7)(' :57 )!( :5!/)/! '5/'/)*::5,,,),( *5!( 5**)'7 !'57/*)(' ()'( :57'')( +>B++&*- '75!/')!' :!)'/ '*,)/ :57 7), :5,:)'( '5/*:)*::5,,7) *5!( 57,:)/( !'5*(7)/ ()7' :5*(*)(: +>B++&*- '*5(*7)!: :!)'( '*)!: :57 *) 7 :57/*)7 '5 (()7(:5,,/)'7 *5!( 5,*7),7 !'5*77)'' ()/! :5*!/) , +>B++&*- '*5'7!)/! !(), '*,)*/ :57 /)! :5*7!): '5 7)!!:5,,/)/! *5!( 5/:)/' !'5*:7),7 '),7 :5/:!)!! +>B++&*- '*577)(: :!)/ '*,)(: :57 /)7' :5/,7)'/ '5 :*),::5,,/):' *5!( 5':,)', !'5/7),/ (): :5 :)!* +>B++&*- '*5,,:):/ :!)(7 '*):, :57 )* :5 ':)* '5::)7 :5,, )! *5!( 5(! )*/ !'5//*)'( ()/ :5: /)': +>B++&*- '*57,)/! :!)'( '*) ( :57 !)(7 :5:(')!! '5: ')7(:5,,!)77 *5!( 5(')!! !'5 (*) ( ()'* :5!/:)7 +>B++&*- '*5* ) :!) '*)*7 :57:()7, :5::*)! '5!'7): :5,7():, *5!(/5! ):! !'5 7/): ()' !5(/'),' +>B++&*- '*5/')*7 :!):, '**),/ :57:')' :5! ()/* '5!*/)!:5,7')/' *5!(/5:7)(* !'5 :*): ,)(/ !5'*7),/ +>B++&*- ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) '*5 '/) ' !')(! '*,)', :57:()7* !5(*/),* '5!! )/7:5,7():* *5!(/5 **), !'5:7): )/! !57:),7 +>B++&*- '*5:'(): !')(( '*,)7' :57 :) , !5'7()77 5(,!)!::5,,!)', *5!(/5/ ()(' !'5:/7):' (),' !5,7')(7 +>B++&*- '*5!(/)(' !') '*,)'/ :57 /):! !5*)7( 5(:) 7:5,, )! *5!(/5*:,):! !'5!(*)( (),* !57,7) +>B++&*- '/5((')'! !')(! '*')!' :57 7)! !5,(!):7 5'/)/,:5,,*), *5!(/57!:): !'5!7/) , '), !5*:)' +>B++&*- '/5(!7)/' :!)'7 '*7)7' :57 7) : !5,!,)': 5'/:):(:5,,*)': *5!(/57',):( !'5!:/)* ,),! !5/()'/ +>B++&*- '/5'!,)(: :!)', '*')*: :57 /) !57:()!( 5',)*':5,,/)/ *5!(/5,7):: !5(:): ): !5 ' )( +>B++&*- '/5:,)(' ::)7: '*)/ :57 :)'7 !5*/(),/ 5**)*::5,,:)*7 *5!(/577)! !5(/:)/ '),/ !5:(*) +>B++&*- '/5, /)(/ :!) ' '*,) , :57 !)/' !5/7,),: 5! )*/:5,7()(' *5!(/5'/()'7 !5'(:),, ') : !5:!/):' +>B++&*- '/57/!),! !(), '*,)7 :57 !)// !5 /):! 5,,!),:5,7()(/ *5!(/5( *)*' !5'7 )// () !5!::) +>B++&*- '/5*/7),/ !(),/ '*,)7/ :57 !)' !5:'') 5,:')::5,,!)* *5!(*5!:!)7: !5': ):: () '(5(:),' +>B++&*- '/5//()7 !(),, '*7),! :57 :)/( !5:!:)(* 577)(*:5,,!)(( *5!(*5!()( !5 )/! ()! '(5' )(! +>B++&*- '/5 *)*! !(), '*,):( :57 :)'* !5!:()!/ 57/7),':5,,:)** *5!(*5:':)(: !5/*)/7 ()/* '(5/:)( +>B++&*- '/5:7 ): :!)*( '*):: :57 :), '(5(/*)*: 5*(/):(:5,,:) *5!(*5 ,), !5,(*) / ')7 '(5,/'),7 +>B++&*- '/5!7)*( :!)( '*):/ :57 !)*/ '(5'*(), 5**():5,,!)!/ *5!(*5/7/)7' !5,7/):' ()7* '(57*7)!: +>B++&*- ' 5(,/)*! :!) '*,)(* :57:()!/ '(5,7)'' 5*!)!!:5,7'),/ *5!(*5*/')7 !5,: )7 ()/ '(5*7 )*, +>B++&*- ' 5',')(! :!)'( '*):* :57:),* '(5,':)/ 5/,*)!/:5,7) * *5!(*57 /)'/ !57 ):/ ()* '(5/7()7: +>B++&*- ' 5/)(! :!)(7 '*)// :57:,):! '(57() ' 5/ !)7*:5,77)! *5!(*5,!()*7 !57/:)!: ()' '(5 ,,): +>B++&*- ' 5,()(, ::)(: '*,)(' :57:/)* '(57:/)/ 5 ),:5,7/)/* *5!(*5,(*):7 !5*(!)* ')(! '(5:/) +>B++&*- ' 57'7)'7 : ) '*)'/ :57:!) ( '(5*/!) * 5 /*)/:5,*()'( *5!(*5')'! !5**()7! ()!: '(5!':)/, +>B++&*- ' 5*(:),: ::)7 '*)!/ :57!,)( '(5/*,),, 5:(!)(:5,*,)7 *5!(*5',/)77 !5*!')** ')(' ''5('')'/ +>B++&*- ' 5/()** ::) ( '*):' :57!*)*, '(5 , )' 5:*')!,:5,**)!, *5!(*5(*')7! !5/,)'' ()*' ''5'(,) * +>B++&*- ' 5/!/)*( :!)/ '*) 7 :57!/)!' '(5:()/* 5:!7)!':5,* ),' *5!(75!//):' !5/ ) * ()!: ''5'!/)'' +>B++&*- ' 5 !() ! :!)/ '*)/ :57! )*7 '(5!(7)77 5!,:)'7:5,* )!7 *5!(75::'):* !5 ',)/* ()( ''5::) ! +>B++&*- ' 5::/)*/ !')' '*)/* :57!/):7 '(5!:!)*' 5!:)',:5,* )7 *5!(75 !*)/( !5 **)* ')// ''5,:)!' +>B++&*- ' 5! !),7 !(), '7!)!7 :57!*)/: ''5( (): ,5(/)/::5,*/)(: *5!(75 ',)(7 !5 ! )*, ,)'' ''57 ,)/* +>B++&*- ':5( ) ' !')' '*') , :57!7)*: ''5'*),! ,5( )'::5,*7)!: *5!(75/,()! !5:7() 7 )'7 ''5*/7):' +>B++&*- ':5'/:)7( !,)(: '*)7* :57!')( ''5,/):! ,5''/)!,:5,*')7 *5!(75*77)*! !5::,)'7 )': ''5/*:)/( +>B++&*- ':5/')(' !)( '*), :57:/)!* ''5,':):7 ,5'*!):::5,7 ),* *5!(757/')7! !5!,) ! ')' ''5 7!)77 +>B++&*- ':5,*/) / !)'7 '*)*! :57:,)7 ''57(,)/7 ,5(7)(:5,7,): *5!(75, *)7! !5!/*) 7 ()7( ''5:7,)7( +>B++&*- ':57*():/ !)(: '*'),7 :57:()(' ''57:/)/7 ,57:)7(:5,7()7' *5!(75!'),( !,5(( )/' '),, ''5!,*)/( +>B++&*- ':5*77) !)'' '*)77 :57 /)*! ''5*/:)!: ,5!),::5,,/)!! *5!(75( ) : !,5(7!)! ')': '5( )'' +>B++&*- ':5/,:):, !,)(/ '*,)(7 :57 ),, ''5/*)!* ,5,,*)/*:5,,) , *5!(75')/7 !,5(!()' ')'! '5''!)! +>B++&*- ':5 ,)/! !()!: '*,) / :57/!)( ''5 ,/): ,5, )/7:5,!)7 *5!(75(, )/* !,5'!):/ ),7 '5'), +>B++&*- ':5: )'* :!)(* '*,)(! :57/!)(( ''5:')! ,57'!)!(:5,!)7( *5!(,5!*)(7 !,5'/!) / )'/ '5,(*)7, +>B++&*- ':5!),' : )'' '*)!7 :57 )'! ''5!(/)(7 ,57/,)(*:5,,)*! *5!(,5://)', !,5'()*7 )(7 '5,!!)(' +>B++&*- '!5('*)/! :*)( '*,): :57 :)7* ''5!:!)', ,5*(*)'!:5,,:):* *5!(,5 :')!( !,5*(),* )(: '57!() ( +>B++&*- '!5'(!)*! :*), '*)7 :57:/)' '5( )7( ,5*7 ):!:5,7/)/' *5!(,5/! )7! !,5!() , ()! '5*:) , +>B++&*- '!5(,)*! :*) '*) :57!,)!/ '5'**)** ,5*!')(*:5,*7),/ *5!(,5/',)': !,5,,')*/ (),7 '5/ 7) : +>B++&*- '!5!:)!: :*)'( '*,) :5*()(' '57()7 ,5/,,):,:5,/)7' *5!(,5* )'/ !,5, ')! ')'( '5 /:), +>B++&*- '!5,!')*! :*) '*,)(! :5*(!): '5,)!* ,5/ *)'':5, () *5!(,577,)*' !,57'()!7 () 7 '5:*!): +>B++&*- ' ( ) ( *%" ( !+ ( ( ( , ( ! ! "( "" # $%&'(()*(+,!)'(-.',!)/( & *- -( ! , (0' 1 (# $%&'(()*(+,!)'(-.',!)/( & *- ( ! 3 5 8 345 # 345 0/1% 3 5 0 1% 3 5 !+ 3 5 !+ 3 5 - 3 5 / - 3 5 + 3 5 * 34195 ! ) '!57:7)!( :*)'! '*) : :5*' )/ '57(*) * ,5 ' )7:5, :)( *5!(,5,*!)*: !,57*()!, (),, '5!*() * +>B++&*- '!5*' )(( :*)'! '*) : :5*(),' '57,7)( ,5 ,)(*:5,:() ' *5!(,5,,() 7 !,57/7) ()(( '5!:)( +>B++&*- JLC 4/14/2023 RBDMS JSB 041823 C:\Users\kmjunke\AppData\Local\Microsoft\Windows\INetCache\Content.Outlook\99RGP1KB\2023-03-10_22085_GMTU_MT7-97_ArcherVividAcousticLDL_Transmittal.docx DELIVERABLE DISCRIPTION Ticket #Field Well #API # Log Description Log Date 22085 GMTU MT7-97 50-103-20849-00 Archer Vivid Acoustic LDL 10-Mar-23 DELIVERED TO Company & Address DIGITAL FILE # of Copies LOG PRINTS # of Prints CD’s # of Copies 1 AOGCC Attn: Natural Resources Technician 333 W. 7th Ave., Suite 100 Anchorage, Ak. 99501-3539 Delivered By: CPAI Sharefile ______________________________ ______________________________________ Date received Signature PLEASE RETURN COPY VIA EMAIL TO: DIANE.WILLIAMS@READCASEDHOLE.COM READ CASED HOLE, INC., 4141 B STREET, SUITE 308, ANCHORAGE, AK 99503 PHONE: (907)245-8951 E-MAIL :READ-Anchorage@readcasedhole.com WEBSITE :WWW.READCASEDHOLE.COM 1. Type of Request: Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: ___________________ 2. Operator Name: 4. Current Well Class: 5. Permit to Drill Number: Exploratory Development 3. Address: Stratigraphic Service 6. API Number: 7. If perforating:8. Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Will planned perforations require a spacing exception? Yes No 9. Property Designation (Lease Number): 10. Field: Current Pools: 11. Total Depth MD (ft): Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: MPSP (psi): Plugs (MD): Junk (MD): 19517 N/A Casing Collapse Structural Conductor Surface 2260 Intermediate 3810, 5090 Production 7030, 8530 Liner 7500 Packers and SSSV Type: Packers and SSSV MD (ft) and TVD (ft): 12. Attachments: Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations: OIL WINJ WDSPL Suspended 16. Verbal Approval: Date: GAS WAG GSTOR SPLUG AOGCC Representative: GINJ Op Shutdown Abandoned Contact Name: Contact Email: Contact Phone: Authorized Title: Conditions of approval: Notify AOGCC so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other: Post Initial Injection MIT Req'd? Yes No Spacing Exception Required? Yes No Subsequent Form Required: APPROVED BY Approved by: COMMISSIONER THE AOGCC Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng Perforation Depth MD (ft): 8232 N/A 1701 4-1/2" N/A 195159891 4.5" 8520 7" 20" x 34" 13-3/8" 80 9-5/8"8232 3189 8160, 11220 MD 6330, 8150 5020 120 3056 7527 120 3189 83089779 Length Size Proposed Pools: TVD Burst Greater Moose's Tooth Rendezvous 8520 19517 8520 3078 N/A PRESENT WELL CONDITION SUMMARY STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 AA081800, AA081781 222-150 P.O. Box 100360 Anchorage, AK 99510-0360 50-103-20849-00-00 ConocoPhillips Alaska Inc. MT7-97 11590 Tubing Grade: Tubing MD (ft): LTP: 9,624' / 8,272' TVD Prod Packer: 9,499' MD / 8,238' TVD Perforation Depth TVD (ft): Tubing Size: L-80 9630 3/12/2023 Baker ZXHD Liner Top Packer Halliburton TNT Production Packer 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Name and Digital Signature with Date: AOGCC USE ONLY Madeline Woodard madeline.e.woodard@cop.com 907-265-6086 Completions Engineer m n P 2 6 5 6 t _ Form 10-403 Revised 10/2022 Approved application valid for 12 months from date of approval.Submit PDF to aogcc.permitting@alaska.gov By Samantha Carlisle at 3:27 pm, Mar 06, 2023 323-133 Digitally signed by Madeline Woodard DN: CN=Madeline Woodard, E=madeline.e.woodard @conocophillips.com Reason: I am the author of this document Location: Date: 2023.03.06 14:56:59-09'00' Foxit PDF Editor Version: 12.0.1 Madeline Woodard X Fracture Stimulate 3/12/2023 10-404 CDW 03/09/2023 DSR-3/7/23VTL 3/10/2023 SFD 3/8/2023JLC 3/13/2023 RBDMS JSB 031423 SECTION 1 - AFFIDAVIT 10 AAC 25.283 (A)(1) Exhibit 1 is an affidavit stating that the owners, landowners, surface owners and operators within one-half mile radius of the current or proposed wellbore trajectory have been provided notice of operations in compliance with 20 AAC 25.283(a)(1). March 6, 2023 VIA CERTIFIED MAIL To: Operator and Owners (shown on Exhibit 2) Re: Notice of Operations pursuant to 20 AAC 25.283 (a)(1) for MT7-97 Well AA-081800 and AA-081781 Greater Mooses Tooth Unit, Alaska CPAI Contract No. 204278 ConocoPhillips Alaska, Inc. (“CPAI”) as Operator and on behalf of the Greater Mooses Tooth Unit working interest owners, hereby notifies you that it intends to submit an Application for Sundry Approvals for stimulation by hydraulic fracturing pursuant to the provisions of 20 AAC 25.280 (“Application”) for the MT7-97 Well (the “Well”). The Application will be filed with the Alaska Oil and Gas Conservation Commission (“AOGCC”) on or about March 6, 2023. This Notice is being provided pursuant to subsection of 20 AAC 25.283. The Well is currently planned to be drilled as a directional horizontal well on leases AA-081800 and AA- 081781, as depicted on Exhibit 1, and has locations as follows: Location FNL FEL Township Range Section Meridian Surface 4,237’ 3,276’ T10N R2E 32 Umiat Top Open Interval 2,800’ 4,038’ T9N R2E 5 Umiat Bottomhole 832’ 4,869’ T9N R2E 16 Umiat Exhibit 1 shows the location of the Well and the lands that are within a one-half mile radius of the current proposed trajectory of the Well (“Notification Area”), which includes the reservoir section. Exhibit 2 is a list of the names and addresses of all owners, landowners, surface owners, and operators of record of all properties within the Notification Area. Upon your request, CPAI will provide a complete copy of the Application. If you require any additional information, please contact the undersigned. Sincerely, Attachments: Exhibits 1 & 2 Dennise Arzola Senior Land Negotiator ConocoPhillips Alaska, Inc. 700 G Street Anchorage, AK 99501 Office: 907-265-6297 Fax: 907-263-4966 dennise.arzola@cop.com Exhibit 1 Exhibit 2 List of the names and addresses of all owners, landowners, surface owners, and operators of record of all properties within the Notification Area. Operator & Owner: ConocoPhillips Alaska, Inc. 700 G Street, Suite ATO-1480 (Zip 99501) P.O. Box 100360 Anchorage, AK 99510-0360 Attn: Ian Ramshaw, Western North Slope Asset Development Manager Owner (Non-Operator): None Other Operators of Record: None Landowners: U.S. Department of the Interior Bureau of Land Management 222 West 7th Avenue, #13 Anchorage, Alaska 99513 Attn: Wayne M. Svejnoha, Branch Chief Energy & Minerals Surface Owner: U.S. Department of the Interior Bureau of Land Management 222 West 7th Avenue, #13 Anchorage, Alaska 99513 Attn: Wayne M. Svejnoha, Branch Chief Energy & Minerals SECTION 2 – PLAT 20 AAC 25.283 (A)(2) Plat 1: Wells within .5 miles Table 1: Wells within .5 miles Well Name API Well Type Status Field Name Fluid Type Well in Frac Port 1/2 mi Buffer Open Interval in Frac Port 1/2 mi Buffer MT7-96 50103208340000 PROD ACTIVE GMT2 OIL YES YES MT7-98 50103208430000 INJ ACTIVE GMT2 YES YES MT7-01 50103208320000 PROD ACTIVE GMT2 OIL YES YES MT7-01PB1 50103208327000 - P&A GMT2 N/A YES MT7-03 50103208300000 INJ ACTIVE GMT2 YES MT7-05 50103208330000 PROD ACTIVE GMT2 OIL YES MT7-07 50103208410000 INJ ACTIVE GMT2 YES MT7-08 50103208460000 INJ ACTIVE GMT2 NO MT7-08PB1 50103208467000 - P&A GMT2 N/A NO MT7-09 50103208370000 PROD ACTIVE GMT2 OIL YES MT7-99 50103208450000 INJ ACTIVE GMT2 YES YES MT7-02 50103208400000 PROD ACTIVE GMT2 OIL YES YES MT7-04 50103208290000 INJ ACTIVE GMT2 NO MT7-06 50103208310000 - P&A GMT2 N/A NO MT7-06PB1 50103208317000 - P&A GMT2 N/A NO MT7-06A 50103208310100 PROD ACTIVE GMT2 OIL NO SECTION 3 – FRESHWATER AQUIFERS 20 AAC 25.283(A)(3) There are no freshwater aquifers within a one-half mile radius of the current or proposed wellbore trajectory. See Conclusion number 5 of the Conservation Order CO 793 Amended, Greater Moose’s Tooth-Rendezvous Oil Pool (ROP), which states “There are no freshwater aquifers in the proposed Affected Area of the ROP.” SECTION 4 – PLAN FOR BASELINE WATER SAMPLING FOR WATER WELLS 20 AAC 25.283(A)(4) There are no water wells located within one-half mile of the current or proposed wellbore trajectory and fracturing interval. A water well sampling plan is not applicable. SECTION 5 – DETAILED CEMENTING AND CASING INFORMATION 20 AAC 25.283(A)(5) All casing is cemented in accordance with 20 AAC 25.52(b) and tested in accordance with 20 AAC 25.030 (g) when completed. See Wellbore schematic for casing and cement details. SECTION 6 – ASSESSMENT OF EACH CASING AND CEMENTING OPERATION TO BE PERFORMED TO CONSTRUCT OR REPAIR THE WELL 20 AAC 25.283(A)(6) Casing & Cement Assessments: 13-3/8” casing cement pump report on 01/30/2023 shows that the job was pumped as designed, indicating competent cementing operations. The cement job was pumped with 361.5 bbls of 11.0 ppg DeepCRETE cement and 72 bbls of 15.8 ppg Class G blend tail cement and displaced with 11.0 ppg mud. Full returns to surface were seen throughout the job. The plug bumped with 914 psi, and a pressure of 915 psi was held for 5 minutes. Pressure was bled off to check the floats and they held. 120 bbls of 11.0 ppg lead cement returned to surface. The 9-5/8” casing cement report on 02/06/2023 shows that the job was pumped as designed, indicating competent cementing operations with 69 bbls of 13 ppg Class G lead cement and 153 bbls of 15.8 ppg Class G tail cement. No losses were observed and plugs bumped. Pressure was bled off to check floats and they held. A sonic log was run and confirmed TOC at 4,260’ MD. The 7” liner cement report on 02/11/2023 shows that the initial job was pumped as designed, indicating competent cementing operations, with 70 bbls of 15.8 ppg Class G cement. Plugs bumped with 1000 psi and floats were confirmed to be holding. A sonic log was run and confirmed top of cement at 8,335’ MD. The 4-1/2” production liner cement report on 02/25/2023 shows that the initial job was pumped as designed, indicating competent cement operations, with 239 bbls of 15.3ppg cement. Plugs bumped with 1280 psi and floats were confirmed to be holding. Good returns were seen throughout job and 15 bbls of cement were circulated back to surface when cleaning up the wellbore after setting the liner top packer. Summary All casing is cemented in accordance with 20 AAC 25.030 and each hydrocarbon zone penetrated by the well is isolated. Based on engineering evaluation of the wells referenced in this application, ConocoPhillips has determined that this well can be successfully fractured within its design limits. ppg sonic log was run andpp confirmed top of cement at 8,335’ MD. ppg Good returns gp were seen throughout job pg p sonic log was run and confirmed TOC at 4,260’ MD. p 120 bbls of 11.0 ppg lead cement returned to surface. SECTION 7 – PRESSURE TEST INFORMATION AND PLANS TO PRESSURE-TEST CASINGS AND TUBINGS INSTALLED IN THE WELL 20 AAC 25.283(a)(7) On 2/2/23 the 13-3/8” casing was pressure tested to 3,500 psi for 30 mins. On 2/7/23 the 9-5/8” casing was pressure tested to 3,500 psi for 30 mins. On 2/12/23 the 7” liner was pressure tested to 4,200 psi for 30 mins. On 2/28/23 the 9-5/8” casing and 7” liner were pressure tested to 4,200 psi for 30 mins during the IA test on rig. The tubing was tested on the same day to 4,200 psi for 30 mins. During the post-rig well work, the tubing and IA will be pressure tested to 4,250/4,200 psi for 30 mins. Maximum Predicted Treating Pressure (MPTP) 7,550 Annulus pressure during frac 3,800 Annulus PRV setpoint during frac 3,900 7" Annulus pressure test 4,200 4 1/2" Tubing pressure Test 4,250 E PRV 8,550 Highest pump trip 8,050 AOGCC Required Pressures [all in psi] 7,550 SECTION 8 – PRESSURE RATINGS AND SCHEMATICS FOR THE WELLBORE, WELLHEAD, BOPE AND TREATING HEAD 20 AAC 25.283(a)(8) Table 2: Wellbore pressure ratings Size Weight Grade API Burst API Collapse 13-3/8” 68 L-80 5,020 psi 2,260 psi 9-5/8” 43.5 L-80 6,330 psi 3,810 psi 9-5/8” 47 T-95 8,150 psi 5,090 psi 7” 29 L-80 8,160 psi 7,030 psi 7” 29 TN-110SS 11,220 psi 8,530 psi 4.5” 12.6 P-110S 11,590 psi 9,210 psi 4.5” 12.6 L-80 8,430 psi 7,500 psi Stimulation Surface Rig-Up Alpine 10K Frac Tree SECTION 9 – DATA FOR FRACTURING ZONE AND CONFINING ZONES 20 AAC 25.283(A)(9) CPAI has formed the opinion, based on seismic, well, and other subsurface information currently available that: The Alpine C interval is approximately 100’ TVD thick at the heel of the lateral. The Alpine C sandstone is very fine to fine grained and quartz rich. Top Alpine C is estimated to be at 9,812’ MD / -8,176’ TVDSS. The estimated fracture gradient for the Alpine C sandstone is 11.3 ppg. The overlying confining zone consists of greater than 700’ TVD of Miluveach, Kalubik and HRZ mudstones. The estimated fracture gradient for the Miluveach is 15 ppg and for the Kalubik and the HRZ is 16 ppg. Top HRZ was encountered at 8,187’ MD/ -7,353’ TVDSS. The underlying confining zone consists of approximately 1700’ TVD of Kingak shales. The estimated fracture gradient for the Kingak interval ranges from 15-18 ppg. Fracture gradient increases down section. The Kingak shale interval was not encountered in this lateral. SECTION 10 – LOCATION, ORIENTATION AND A REPORT ON MECHANICAL CONDITION OF EACH WELL THAT MAY TRANSECT CONFINING ZONE 20 AAC 25.283(a)(10) The plat shows the location and orientation of each well that transects the confining zone. ConocoPhillips has formed the opinion, based on following assessments for each well and seismic, well, and other subsurface information currently available that none of these wells will interfere with containment of the hydraulic fracturing fluid within the one-half mile radius of the proposed wellbore trajectory. Casing & Cement assessments for all wells that transect the confining zone: MT7-96: The 7” intermediate 2 liner was cemented on 2/7/22. The primary cement job was pumped with 67 bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job. A sonic log was run and confirmed top of cement to be at 8,770’ MD. MT7-98: The 7” intermediate 2 liner was cemented on 8/9/22. The primary cement job was pumped with 65bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job, with no losses to formation. A sonic log was run and confirmed top of cement to be at 9,162’ MD. MT7-99: The 7” intermediate 2 liner was cemented on 9/9/22. The primary cement job was pumped with 64bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job, with no losses to formation. A sonic log was run and confirmed top of cement to be at 8,740’ MD. MT7-01/MT7-01PB1: The MT7-01PB1 wellbore was abandoned on 11/2/21 with 82.1 bbl sof 16.5 ppg cement. The abandonment plug was tagged with 11klbs prior to sidetracking the wellbore. The MT7-01 7” intermediate 2 liner was cemented on 11/13/21. The primary cement job was pumped with a 15.8 ppg Class G slurry and 69 bbls were lost during the cement displacement. The plugs bumped and the floats held. The cement was logged and TOC determined to be at 9,995’ MD. MT7-02: The 7” intermediate 2 liner was cemented on 5/19/22. The primary cement job was pumped with 75bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job. A sonic log was run and confirmed top of cement to be at 9,270’ MD. MT7-03: The 7-5/8” casing was cemented on 6/28/21. The primary cement job was pumped with 15.8 ppg Class G slurry, the plug bumped and floats held. There were some partial losses during the execution of the job but the cement was logged and the TOC was determined to be 11,050’ MD. MT7-04: The 7-5/8” casing was cemented on 5/17/21. The cement job was pumped with 15.8ppg Class G slurry. During the execution of the job there were some partial losses however the cement was logged and the TOC was determined to be 10,605’ MD. MT7-05: The 7” intermediate 2 liner was cemented on 12/23/21. The primary cement job was pumped with a 15.8 ppg Class G slurry where 27 bbls out of the total 52 bbls were lost. A CBL and sonic log were run and confirmed top of cement to be at 11,900’ MD or 352’ MD of cement. A FIT to 11.5 ppg was performed and the intermediate 2 shoe was considered competent. MT7-06/ MT7-06PB1: The original MT7-06 wellbore was abandoned with 3x balanced plugs. The first was pumped on 9/30/2022 with 33 bbls of 15.8 ppg Class G cement. No losses were observed and the cement top was tagged @ 9,202’ MD with 15klbs witnessed by AOGCC Sean Sullivan. The plug was pressure tested to 1,865 psi for 45 min witnessed by AOGCC Sean Sullivan. The second plug consisted of two separate 37 bbl 15.8 ppg Class G plugs. No losses were observed and the cement top was tagged @ 6,366’ MD with 15klbs witnessed by AOGCC Lou Laubenstein. The plug was also pressure tested to 1500 psi for 30 min witnessed by AOGCC Lou Laubenstein. The third balanced plug/kick off plug was pumped on 10/11/22 with 87 bbls of 16.8 ppg Class G cement. No losses were observed and the cement top was tagged @ 3,074’ MD with 10klbs and no witness. MT7-06PB1 was drilled and a liner run to 25,254’ MD before the liner was separated. The top of the liner (fish) is located at 12,985’ MD with the MT7-06 sidetrack point at 12,540’ MD. MT7-06A: The 7” intermediate 2 liner was cemented on 10/27/22. The primary cement job was pumped with 81bbls of 15.8ppg Class G cement. The plugs bumped and floats held during the job. A sonic log was run and confirmed top of cement to be at 10,557’ MD, above the required TOC depth. MT7-07: The 7” intermediate 2 liner was cemented on 7/7/22. The primary cement job was pumped with 71bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job, but 162 bbls lost during the job. A sonic log was run and confirmed top of cement to be at 11,574’ MD, above required TOC depth. MT7-08/MT7-08PB1: The 7” intermediate 2 liner was cemented on 12/21/22. The primary cement job was pumped with 79bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job. A sonic log was run and confirmed top of cement to be at 11,560’ MD, above required TOC depth. The MT7-08PB1 was a cross cut that was performed prior to drilling an open hole side track to TD the MT7-08 lateral. It is not completed. MT7-09: The 7” intermediate 2 liner was cemented on 3/16/22. The primary cement job was pumped with 88bbls of 15.8 ppg Class G cement. The plugs bumped and floats held during the job. A sonic log was run and confirmed top of cement to be at 12,474’ MD. SECTION 11 – LOCATION OF, ORIENTATION OF AND GEOLOGICAL DATA FOR FAULTS AND FRACTURES THAT MAY TRANSECT THE CONFINING ZONES 20 AAC 25.283(a)(11) CPAI has formed the opinion, based on seismic, well, and other subsurface information currently available that four fault or fracture systems transect the Alpine C formation or enter the confining zone within one half mile radius of the wellbore trajectory for MT7-97. All reported faults are sub-seismic. The MT7-97 wellbore crossed one fault at 10,724’ MD that had 11’ of throw. This fault was not encountered in the offset wells. Three other faults or features do not intersect the MT7-97 but sit within a half mile. One fault occurs in the MT7-02 at 17,690’ MD, one feature or fault occurs in the MT7-96 at 12,710’MD, and one fault in MT7- 99 occurs at 15,868’ MD. Any faults that are within the half mile radius of the wellbore do not extend up through the confining interval, and fracture gradients within the top seal intervals would not be exceeded during fracture stimulation and would therefore confine injected fluids to the pool. CPAI has formed the opinion, based on seismic, well and other subsurface information currently available that the apparent faults will not interfere with containment. Based on our knowledge of the principal stress direction in the Alpine C formation, along with the well path, the fractures will be longitudinal, running parallel to the wellbore. Because of this the fractures will only intersect faults that intersect the wellbore. We do not expect any of our hydraulic fractures to intersect faults seen in this wellbore. If there are indications that a fracture has intersected a fault during fracturing operations, ConocoPhillips will go to flush and terminate the stage immediately. Well Name Fault Depth MD (ft) Fault Depth TVDSS (ft) Fault Vertical Displacement (ft) Fluid Losses (bbls/hr) MT7-97 10724 -8,284 11 total MT7-02 17,690 -8,320 7 0 MT7-96 12,710 -8,236 <5’ 0 MT7-99 15,868 -8,315 3 0 p, ,, four fault or fracture systems transect the Alpine C formation or enter y the confining zone gpp p fractures will be longitudinal, running parallel to the wellbore. Plat 2: MT7-97 Fault Analysis SECTION 12 – PROPOSED HYDRAULIC FRACTURING PROGRAM 20 AAC 25.283(A)(12) MT7-97 was completed in 2023 as a horizontal producer in the Alpine C formation. The well was completed with 4.5” tubing. The liner is a 4.5” liner with dart actuated sliding sleeves and swellpackers with 2x Alpha pressure activated sleeves at the toe. We will open the Alpha sleeves, establish injection and pump a slurry with 100M to remove any residual cement from the ID of the sleeves/liner followed by acid. We will then begin treatment for the first stage and drop the first dart for the second stage and treat that stage. We will drop a dart after each remaining stage, which will provide isolation from the previous stage and allow us to move from the toe of the well towards the heel. Proposed Procedure: Halliburton Pumping Services: (Alpine C Frac) 1. Conduct Safety Meeting and Identify Hazards. Inspect Wellhead and Pad Condition to identify any pre-existing conditions. 2. Ensure all Pre-frac Well work has been completed and confirm the tubing and annulus are filled with a freeze protect fluid to 1,200’ TVD. 3. Ensure the 10-403 Sundry has been reviewed and approved by the AOGCC. 4. MIRU 25 clean insulated Frac tanks, with a berm surrounding the tanks that can hold a single tank volume plus 10%. Load tanks with 100º F seawater (approx. ~24,500 bbls are required for the full treatment with breakdown, maximum pad, and 450 bbls useable volume per tank). 5. MIRU HES Frac Equipment. 6. PT Surface lines to 9,500 psi using a pressure test fluid. 7. Test IA Pop off system to ensure lines are clear and all components are functioning properly. 8. Bring up pumps and increase annulus pressure from 2,500 psi to 3,800 psi as the tubing pressures up. 9. Pump the Frac job by following attached HES schedule @ 37bpm with a maximum expected treating pressure of 7,550 psi. 10. RDMO HES Equipment. Freeze Protect the tubing and wellhead if not able to complete following the flush. 11. Well is ready for Post Frac well prep for flowback (Slickline and possibly CTU). Stage Job Size (lb) Top MD (ft) Top TVD (ft) Propped Half-Length (ft) Fracture Height (ft) Avg Fracture Width (in) 1 165,906 17,924 8,271 160 225 0.2897 2 165,906 17,240 8,284 180 200 0.309 3 165,906 16,514 8,284 220 195 0.311 4 165,906 15,787 8,284 200 195 0.311 5 165,906 15,101 8,276 240 200 0.310 6 165,906 14,332 8,279 340 185 0.314 7 165,906 13,568 8,332 280 110 0.291 8 165,906 12,802 8,274 200 175 0.291 9 165,906 12,080 8,325 300 110 0.295 10 165,906 11,352 8,323 360 110 0.295 11 165,906 10,068 8,229 260 135 0.298 Disclaimer Notice: MT7-97 This model was generated using commercially available modeling software and is based on engineering estimates of reservoir properties. Conoco Phillips is providing these model results as an informed prediction of actual results. Because of the inherent limitations in assumptions required to generate this model, and for other reasons, actual results may differ from the model results CUSTOMERConoco Phillips FALSEAPIBFD (lb/gal)8.54LAT 70.173041LEASEMT7-97SALES ORDERBHST (°F)196LONG-151.692992FORMATIONAlpine DATE Max Pressure (psi)9000*Exceeds 80% of burst pressure*Prop Slurry Design Clean Design Clean Design Slurry Design Prop Stage Interval CL-28M Losurf-300D MO-67 LVT-200 WG-36 OptiFlo-III BE-6Treatment Stage Fluid Stage Proppant Conc Rate Volume Volume Volume Total Time TimeInterval Number Description Description Description(ppg) (bpm) (gal) (bbl) (bbl) (lbs) (hh:mm:ss) (hh:mm:ss)(gpt) (gpt) (gpt) (gpt) (ppt) (ppt) (ppt)1-1 Shut-In Shut-In1:34:11 1-2 Freeze Protect Prime Up Pressure Test 10 1,500 36 36 0:03:34 1:34:11 1000.001-3 Shut-In Shut-In1:30:36 1-4 35# Linear Alpha Sleeve 15 1,250 30 30 0:01:59 1:30:36 1.00 35.00 2.00 0.151-5 15# Linear Conditioning Pad 100M 0.25 15 8,400 200 202 2,100 0:13:29 1:28:37 1-6 35# Linear Spacer 15 1,000 24 24 0:01:35 1:15:08 1.00 35.00 2.00 0.151-7 15% HCL Acid 15 420 10 10 0:00:40 1:13:33 1-8 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.151-9 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.151-10 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.151-11 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.151-12 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.151-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.151-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.151-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.151-16 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.151-17 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.151-18 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.151-19 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.151-20 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.151-21 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.152-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:37:18 1.00 35.00 2.00 0.152-2 15% HCL Acid 10 420 10 10 0:01:00 1:34:18 2-3 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:33:18 2.80 1.00 1.00 35.00 2.00 0.152-4 35# Hybor G Minifrac 30 6,300 150 150 0:05:00 1:26:38 2.80 1.00 1.00 35.00 2.00 0.152-5 35# Linear Flush 30 11,020 262 262 0:08:45 1:21:38 1.00 35.00 2.00 0.152-6 Shut-In Shut-In1:12:53 2-7 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.152-8 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.152-9 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.152-10 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.152-11 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.152-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.152-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.152-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.152-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.152-16 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.152-17 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.152-18 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.152-19 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.152-20 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.153-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:29:04 1.00 35.00 2.00 0.153-2 15% HCL Acid 10 420 10 10 0:01:00 1:26:04 3-3 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:25:04 1.00 35.00 2.00 0.153-4 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:18:24 2.80 1.00 1.00 35.00 2.00 0.153-5 35# Hybor G Pad 30 7,875 188 188 0:06:15 1:11:44 2.80 1.00 1.00 35.00 2.00 0.153-6 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 1:05:29 2.80 1.00 1.00 35.00 2.00 0.153-7 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:59:10 2.80 1.00 1.00 35.00 2.00 0.153-8 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:52:46 2.80 1.00 1.00 35.00 2.00 0.153-9 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:49:52 2.80 1.00 1.00 35.00 2.00 0.153-10 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:45:06 2.80 1.00 1.00 35.00 2.00 0.153-11 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:38:47 2.80 1.00 1.00 35.00 2.00 0.153-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:30:20 2.80 1.00 1.00 35.00 2.00 0.153-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:23:27 2.80 1.00 1.00 35.00 2.00 0.153-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:19:04 2.80 1.00 1.00 35.00 2.00 0.153-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:15:36 2.80 1.00 1.00 35.00 2.00 0.153-16 35# Linear Flush 30 10,556 251 251 0:08:23 0:13:11 1.00 35.00 2.00 0.153-17 Freeze Protect Freeze Protect 10 2,016 48 48 0:04:48 0:04:48 1000.003-18 Shut-In Shut-InLiquid Additives Dry Additives50-103-20849Interval 1ALP Sand@ 17924 - 17927.88 ft 195.9 °FInterval 2ALP Sand@ 17240 - 17243.88 ft 195.7 °FInterval 3ALP Sand@ 16514 - 16517.88 ft 195.7 °FConoco Phillips - MT7-97Planned Design1 CUSTOMERConoco Phillips FALSEAPIBFD (lb/gal)8.54LAT 70.173041LEASEMT7-97SALES ORDERBHST (°F)196LONG-151.692992FORMATIONAlpine DATE Max Pressure (psi)9000*Exceeds 80% of burst pressure*Prop Slurry Design Clean Design Clean Design Slurry Design Prop Stage Interval CL-28M Losurf-300D MO-67 LVT-200 WG-36 OptiFlo-III BE-6Treatment Stage Fluid Stage Proppant Conc Rate Volume Volume Volume Total Time TimeInterval Number Description Description Description(ppg) (bpm) (gal) (bbl) (bbl) (lbs) (hh:mm:ss) (hh:mm:ss)(gpt) (gpt) (gpt) (gpt) (ppt) (ppt) (ppt)Liquid Additives Dry Additives50-103-208494-1 Shut-In Shut-In1:22:26 4-2 Freeze Protect Prime Up Pressure Test 10 1,500 36 36 0:03:34 1:22:26 1000.004-3 Shut-In Shut-In1:18:52 4-4 35# Linear Spacer and Dart Drop 15 1,250 30 30 0:01:59 1:18:52 1.00 35.00 2.00 0.154-5 35# Linear Spacer 10 1,260 30 30 0:03:00 1:16:53 1.00 35.00 2.00 0.154-6 15% HCL Acid 10 420 10 10 0:01:00 1:13:53 4-7 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.154-8 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.154-9 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.154-10 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.154-11 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.154-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.154-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.154-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.154-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.154-16 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.154-17 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.154-18 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.154-19 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.154-20 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.155-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:16:53 1.00 35.00 2.00 0.155-2 15% HCL Acid 10 420 10 10 0:01:00 1:13:53 5-3 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.155-4 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.155-5 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.155-6 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.155-7 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.155-8 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.155-9 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.155-10 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.155-11 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.155-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.155-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.155-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.155-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.155-16 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.156-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:27:58 1.00 35.00 2.00 0.156-2 15% HCL Acid 10 420 10 10 0:01:00 1:24:58 6-3 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:23:58 1.00 35.00 2.00 0.156-4 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:17:18 2.80 1.00 1.00 35.00 2.00 0.156-5 35# Hybor G Pad 30 7,875 188 188 0:06:15 1:10:38 2.80 1.00 1.00 35.00 2.00 0.156-6 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 1:04:23 2.80 1.00 1.00 35.00 2.00 0.156-7 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:58:03 2.80 1.00 1.00 35.00 2.00 0.156-8 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:51:40 2.80 1.00 1.00 35.00 2.00 0.156-9 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:48:46 2.80 1.00 1.00 35.00 2.00 0.156-10 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:44:00 2.80 1.00 1.00 35.00 2.00 0.156-11 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:37:41 2.80 1.00 1.00 35.00 2.00 0.156-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:29:14 2.80 1.00 1.00 35.00 2.00 0.156-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:22:21 2.80 1.00 1.00 35.00 2.00 0.156-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:17:58 2.80 1.00 1.00 35.00 2.00 0.156-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:14:29 2.80 1.00 1.00 35.00 2.00 0.156-16 35# Linear Flush 30 9,161 218 218 0:07:16 0:12:04 1.00 35.00 2.00 0.156-17 Freeze Protect Freeze Protect 10 2,016 48 48 0:04:48 0:04:48 1000.006-18 Shut-In Shut-InInterval 4ALP Sand@ 15787 - 15790.88 ft 195.7 °FInterval 5ALP Sand@ 15101 - 15104.88 ft 195.6 °FInterval 6ALP Sand@ 14332 - 14335.88 ft 195.4 °FConoco Phillips - MT7-97Planned Design2 CUSTOMERConoco Phillips FALSEAPIBFD (lb/gal)8.54LAT 70.173041LEASEMT7-97SALES ORDERBHST (°F)196LONG-151.692992FORMATIONAlpine DATE Max Pressure (psi)9000*Exceeds 80% of burst pressure*Prop Slurry Design Clean Design Clean Design Slurry Design Prop Stage Interval CL-28M Losurf-300D MO-67 LVT-200 WG-36 OptiFlo-III BE-6Treatment Stage Fluid Stage Proppant Conc Rate Volume Volume Volume Total Time TimeInterval Number Description Description Description(ppg) (bpm) (gal) (bbl) (bbl) (lbs) (hh:mm:ss) (hh:mm:ss)(gpt) (gpt) (gpt) (gpt) (ppt) (ppt) (ppt)Liquid Additives Dry Additives50-103-208497-1 Shut-In Shut-In1:22:26 7-2 Freeze Protect Prime Up Pressure Test 10 1,500 36 36 0:03:34 1:22:26 1000.007-3 Shut-In Shut-In1:18:52 7-4 35# Linear Spacer and Dart Drop 15 1,250 30 30 0:01:59 1:18:52 1.00 35.00 2.00 0.157-5 35# Linear Spacer 10 1,260 30 30 0:03:00 1:16:53 1.00 35.00 2.00 0.157-6 15% HCL Acid 10 420 10 10 0:01:00 1:13:53 7-7 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.157-8 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.157-9 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.157-10 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.157-11 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.157-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.157-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.157-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.157-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.157-16 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.157-17 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.157-18 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.157-19 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.157-20 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.158-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:16:53 1.00 35.00 2.00 0.158-2 15% HCL Acid 10 420 10 10 0:01:00 1:13:53 8-3 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.158-4 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.158-5 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.158-6 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.158-7 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.158-8 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.158-9 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.158-10 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.158-11 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.158-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.158-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.158-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.158-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.158-16 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.159-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:26:49 1.00 35.00 2.00 0.159-2 15% HCL Acid 10 420 10 10 0:01:00 1:23:49 9-3 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:22:49 1.00 35.00 2.00 0.159-4 35# Hybor G Establish Stable Fluid 30 8,400 200 200 0:06:40 1:16:09 2.80 1.00 1.00 35.00 2.00 0.159-5 35# Hybor G Pad 30 7,875 188 188 0:06:15 1:09:29 2.80 1.00 1.00 35.00 2.00 0.159-6 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 1:03:14 2.80 1.00 1.00 35.00 2.00 0.159-7 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:56:55 2.80 1.00 1.00 35.00 2.00 0.159-8 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:50:31 2.80 1.00 1.00 35.00 2.00 0.159-9 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:47:37 2.80 1.00 1.00 35.00 2.00 0.159-10 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:42:51 2.80 1.00 1.00 35.00 2.00 0.159-11 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:36:32 2.80 1.00 1.00 35.00 2.00 0.159-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:28:06 2.80 1.00 1.00 35.00 2.00 0.159-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:21:12 2.80 1.00 1.00 35.00 2.00 0.159-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:16:49 2.80 1.00 1.00 35.00 2.00 0.159-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:13:21 2.80 1.00 1.00 35.00 2.00 0.159-16 35# Linear Flush 30 7,722 184 184 0:06:08 0:10:56 1.00 35.00 2.00 0.159-17 Freeze Protect Freeze Protect 10 2,016 48 48 0:04:48 0:04:48 1000.009-18 Shut-In Shut-InInterval 9ALP Sand@ 12080 - 12083.88 ft 195 °FInterval 7ALP Sand@ 13568 - 13571.88 ft 195.1 °FInterval 8ALP Sand@ 12802 - 12805.88 ft 195.2 °FConoco Phillips - MT7-97Planned Design3 CUSTOMERConoco Phillips FALSEAPIBFD (lb/gal)8.54LAT 70.173041LEASEMT7-97SALES ORDERBHST (°F)196LONG-151.692992FORMATIONAlpine DATE Max Pressure (psi)9000*Exceeds 80% of burst pressure*Prop Slurry Design Clean Design Clean Design Slurry Design Prop Stage Interval CL-28M Losurf-300D MO-67 LVT-200 WG-36 OptiFlo-III BE-6Treatment Stage Fluid Stage Proppant Conc Rate Volume Volume Volume Total Time TimeInterval Number Description Description Description(ppg) (bpm) (gal) (bbl) (bbl) (lbs) (hh:mm:ss) (hh:mm:ss)(gpt) (gpt) (gpt) (gpt) (ppt) (ppt) (ppt)Liquid Additives Dry Additives50-103-2084910-1 Shut-In Shut-In1:22:26 10-2 Freeze Protect Prime Up Pressure Test 10 1,500 36 36 0:03:34 1:22:26 1000.0010-3 Shut-In Shut-In1:18:52 10-4 35# Linear Spacer and Dart Drop 15 1,250 30 30 0:01:59 1:18:52 1.00 35.00 2.00 0.1510-5 35# Linear Spacer 10 1,260 30 30 0:03:00 1:16:53 1.00 35.00 2.00 0.1510-6 15% HCL Acid 10 420 10 10 0:01:00 1:13:53 10-7 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:12:53 1.00 35.00 2.00 0.1510-8 35# Hybor G Establish Stable Fluid 30 8,400200 200 0:06:40 1:06:13 2.80 1.00 1.00 35.00 2.00 0.1510-9 35# Hybor G Pad 30 7,875 188 188 0:06:15 0:59:33 2.80 1.00 1.00 35.00 2.00 0.1510-10 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 0:53:18 2.80 1.00 1.00 35.00 2.00 0.1510-11 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:46:59 2.80 1.00 1.00 35.00 2.00 0.1510-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:40:35 2.80 1.00 1.00 35.00 2.00 0.1510-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:37:41 2.80 1.00 1.00 35.00 2.00 0.1510-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:32:55 2.80 1.00 1.00 35.00 2.00 0.1510-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:26:36 2.80 1.00 1.00 35.00 2.00 0.1510-16 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:18:09 2.80 1.00 1.00 35.00 2.00 0.1510-17 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:11:16 2.80 1.00 1.00 35.00 2.00 0.1510-18 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:06:53 2.80 1.00 1.00 35.00 2.00 0.1510-19 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:03:25 2.80 1.00 1.00 35.00 2.00 0.1510-20 35# Hybor G Spacer and Dart Drop 30 1,250 30 30 0:01:00 0:01:00 2.80 1.00 1.00 35.00 2.00 0.1511-1 35# Linear Spacer 10 1,260 30 30 0:03:00 1:25:48 1.00 35.00 2.00 0.1511-2 15% HCL Acid 10 420 10 10 0:01:00 1:22:48 11-3 35# Linear Pre-Pad 30 8,400 200 200 0:06:40 1:21:48 1.00 35.00 2.00 0.1511-4 35# Hybor G Establish Stable Fluid 30 8,400200 200 0:06:40 1:15:08 2.80 1.00 1.00 35.00 2.00 0.1511-5 35# Hybor G Pad 30 7,875 188 188 0:06:15 1:08:28 2.80 1.00 1.00 35.00 2.00 0.1511-6 35# Hybor G Proppant Laden Fluid 100M 0.25 30 7,875 188 190 1,969 0:06:19 1:02:13 2.80 1.00 1.00 35.00 2.00 0.1511-7 35# Hybor G Proppant Laden Fluid 100M 0.50 30 7,875 188 192 3,938 0:06:24 0:55:54 2.80 1.00 1.00 35.00 2.00 0.1511-8 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 1.00 30 3,500 83 87 3,500 0:02:54 0:49:30 2.80 1.00 1.00 35.00 2.00 0.1511-9 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 2.00 30 5,500 131 143 11,000 0:04:46 0:46:36 2.80 1.00 1.00 35.00 2.00 0.1511-10 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 3.00 30 7,000 167 189 21,000 0:06:19 0:41:50 2.80 1.00 1.00 35.00 2.00 0.1511-11 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.00 30 9,000 214 253 36,000 0:08:27 0:35:31 2.80 1.00 1.00 35.00 2.00 0.1511-12 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 4.50 30 7,200 171 206 32,400 0:06:53 0:27:04 2.80 1.00 1.00 35.00 2.00 0.1511-13 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.00 30 4,496 107 131 22,480 0:04:23 0:20:11 2.80 1.00 1.00 35.00 2.00 0.1511-14 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 5.50 30 3,500 83 104 19,250 0:03:28 0:15:48 2.80 1.00 1.00 35.00 2.00 0.1511-15 35# Hybor G Proppant Laden Fluid Wanli 20/40 Ceramic 6.00 30 2,395 57 73 14,370 0:02:25 0:12:20 2.80 1.00 1.00 35.00 2.00 0.1511-16 35# Linear Flush 30 6,435 153 153 0:05:06 0:09:54 1.00 35.00 2.00 0.1511-17 Freeze Protect Freeze Protect 10 2,016 48 48 0:04:48 0:04:48 1000.0011-18 Shut-In Shut-In1,027,204 24,457 26,428 1,827,069Design Total (gal)Design Total (lbs)CL-28M Losurf-300D MO-67 LVT-200 WG-36 OptiFlo-III BE-6844,2261,760,000(gal) (gal) (gal) (gal) (lbs) (lbs) (lbs)155,89467,069Initial Design Material Volume 2,363.8 1,000.1 844.2 14,064.0 35,004.2 2,000.2 150.0-3072.9826414,064-104,620-CL-28M Losurf-300D MO-67 LVT-200 WG-36 OptiFlo-III BE-68400(gpm) (gpm) (gpm) (gpm) ppm ppm ppm-Max Additive Rate 3.5 1.3 1.3 1,260.0 44.1 2.5 0.2-Min Additive RateFluid Type35# Hybor G35# LinearSeawaterFreeze Protect15% HCL---Proppant TypeWanli 20/40 Ceramic100M--15# LinearInterval 10ALP Sand@ 11352 - 11355.88 ft 194.9 °FInterval 11ALP Sand@ 10068 - 10071.88 ft 193.8 °F15:42:12 Conoco Phillips - MT7-97Planned Design4 Hydraulic Fracturing Fluid Product Component Information Disclosure 2023-03-01 Alaska HARRISON BAY 50-103-20849 CONOCOPHILLIPS MT7 97 -151.6929 70.1730 NAD83 none Oil 8520 1,017,014 Hydraulic Fracturing Fluid Composition: Trade Name Supplier Purpose Ingredients Chemical Abstract Service Number (CAS #) Maximum Ingredient Concentration in Additive (% by mass)** Maximum Ingredient Concentration in HF Fluid (% by mass)** Ingredient Mass lbs Comments Company First Name Last Name Email Phone SEAWATER (SG 8.52) Halliburton Base Fluid Water 7732-18-5 100.00%80.92750%8664960 Density = 8.52 Halliburton AS-7 ANTI- SLUDGING AGENT Halliburton Anti-sludging Agent Listed Below Listed Below 0 BE-6(TM) Bactericide Halliburton Microbiocide Listed Below Listed Below 0 CL-22 UC Halliburton Crosslinker Listed Below Listed Below 0 CL-28M CROSSLINKER Halliburton Crosslinker Listed Below Listed Below 0 FE-1A ACIDIZING COMPOSITION Halliburton Additive Listed Below Listed Below 0 FE-2A Halliburton Additive Listed Below Listed Below 0 HAI-404M Halliburton Corrosion Inhibitor Listed Below Listed Below 0 HYDROCHLORIC ACID, 10-30% Halliburton Solvent Listed Below Listed Below 0 LoSurf-300D Halliburton Non-ionic Surfactant Listed Below Listed Below 0 LVT-200 Baker Hughes Additive Listed Below Listed Below 0 NA MO-67 Halliburton pH Control Listed Below Listed Below 0 OPTIFLO-III DELAYED RELEASE BREAKER Halliburton Breaker Listed Below Listed Below 0 SP BREAKER Halliburton Breaker Listed Below Listed Below 0 WG-36 GELLING AGENT Halliburton Gelling Agent Listed Below Listed Below 0 Ceramic Proppant - Wanli Wanli Proppant Listed Below Listed Below 0 NA Sand-Common White-100 Mesh, SSA-2 Halliburton Proppant Listed Below Listed Below 0 Ingredients Listed Above Listed Above 1-(Benzyl)quinolinium chloride 15619-48-4 10.00%0.00036%39 1,2,4 Trimethylbenzene 95-63-6 1.00%0.00079%85 2-Bromo-2-nitro-1,3-propanediol 52-51-7 100.00%0.00142%152 2-Methyl-4-isothiazolin-3-one 2682-20-4 0.01%0.00002%3 5-Chloro-2-methyl-3(2H)- Isothaiazolone 26172-55-4 0.01%0.00002%3 Acetic acid 64-19-7 60.00%0.00465%499 Acetic anhydride 108-24-7 100.00%0.00774%829 Acrylate polymer Proprietary 1.00%0.00000%0 Denise Tuck, Halliburton, 3000 N. Sam Houston Pkwy E., Houston, TX 77032, 281-871- 6226 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Aldehyde Proprietary 30.00%0.00107%115 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Ammonium persulfate 7727-54-0 100.00%0.01900%2034 Ammonium phosphate 7722-76-1 1.00%0.00004%4 Benzenesulfonic acid, dodecyl-, compd. with morpholine 12068-08-5 60.00%0.00448%481 Benzylheteropolycycle salt Proprietary 10.00%0.00036%39 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Borate salts Proprietary 60.00%0.13970%14958 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Calcium magnesium carbonate 16389-88-1 1.00%0.00233%250 Citric acid 77-92-9 60.00%0.00535%574 Corundum 1302-74-5 65.00%10.68454%1144000 Crystalline silica, quartz 14808-60-7 100.00%0.63233%67705 Cycloaliphatic alkyoxylate Proprietary 30.00%0.00107%115 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Distillates (petroleum), hydrotreated light 64742-47-8 100.00%0.90896%97323 Ethanol 64-17-5 60.00%0.04727%5062 Ethoxylated alcohol Proprietary 60.00%0.00448%481 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Ethoxylated alcohols Proprietary 10.00%0.00036%39 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Ethoxylated alkyl amines Proprietary 5.00%0.00018%20 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Fatty acids, tall oil Proprietary 10.00%0.00036%39 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Gluteraldehyde 111-30-8 1.00%0.00233%250 Guar gum 9000-30-0 100.00%0.23905%25595 Heavy aromatic petroleum naphtha 64742-94-5 30.00%0.02364%2531 Hydrochloric acid 7647-01-0 60.00%0.25035%26806 Inorganic mineral 1317-65-3 5.00%0.01164%1247 Inorganic mineral Proprietary 1.00%0.00233%250 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Isopropanol 67-63-0 30.00%0.00107%115 Magensium chloride 7786-30-3 0.01%0.00002%3 Magnesium nitrate 10377-60-3 0.01%0.00002%3 Methanesulfonic acid, 1-hydroxy-, sodium salt 870-72-4 0.10%0.00023%25 Methanol 67-56-1 30.00%0.00599%641 Morpholine 110-91-8 5.00%0.00037%41 Mullite 1302-93-8 45.00%7.39699%792000 Naphthalene 91-20-3 5.00%0.00394%422 Oxyalkylated nonyl phenolic resin Proprietary 30.00%0.02364%2531 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Oxyalkylated phenolic resin Proprietary 10.00%0.00788%844 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Oxylated phenolic resin Proprietary 30.00%0.00570%611 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Poly(oxy-1,2-ethanediyl), alpha-(4- nonylphenyl)-omega-hydroxy-, branched 127087-87-0 5.00%0.00394%422 Polyethoxylated fatty amine salt 61791-26-2 10.00%0.00036%39 Polymer Proprietary 1.00%0.00233%250 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Potassium acetate 127-08-2 1.00%0.00007%9 Potassium chloride 7447-40-7 5.00%0.01164%1247 Potassium formate 590-29-4 30.00%0.00000%0 Sodium bisulfate 7681-38-1 0.10%0.00023%25 Sodium carboxymethyl cellulose 9004-32-4 1.00%0.00000%0 Sodium chloride 7647-14-5 5.00%4.04721%433338 Sodium glycolate 2836-32-0 1.00%0.00000%0 Sodium hydroxide 1310-73-2 30.00%0.02495%2672 Sodium iodide 7681-82-5 1.00%0.00004%4 Sodium persulfate 7775-27-1 100.00%0.00019%20 Sodium sulfate 7757-82-6 0.10%0.00000%1 Water 7732-18-5 100.00%0.64658%69231 * Total Water Volume sources may include fresh water, produced water, and/or recycled water _ ** Information is based on the maximum potential for concentration and thus the total may be over 100% Note: For Field Development Products (products that begin with FDP), MSDS level only information has been provided.Version web 1.3 All component information listed was obtained from the supplier’s Material Safety Data Sheets (MSDS). As such, the Operator is not responsible for inaccurate and/or incomplete information. Any questions regarding the content of the MSDS should be directed to the supplier who provided it. The Occupational Safety and Health Administration’s (OSHA) regulations govern the criteria for the disclosure of this information. Please note that Federal Law protects "proprietary", "trade secret", and "confidential business information" and the criteria for how this information is reported on an MSDS is subject to 29 CFR 1910.1200(i) and Appendix D. Production Type: True Vertical Depth (TVD): Total Water Volume (gal)*: MSDS and Non-MSDS Ingredients are listed below the green line Well Name and Number: Longitude: Latitude: Long/Lat Projection: Indian/Federal: Fracture Date State: County: API Number: Operator Name: SECTION 13 – POST-FRACTURE WELLBORE CLEANUP AND FLUID RECOVERY PLAN 20 AAC 25.283(A)(13) After the fracture stimulation, ConocoPhillips (“CPAI”) plans to flowback the well for cleanup purposes for an estimated 7 to 14 days. Little Red Services (“LRS”) will be the flowback company utilized for the flowback. The flowback liquids will be routed through a portable test separator to temporary tanks. The gas will be sent through the drillsite to the Alpine Central Facility (“ACF”) for processing. Once the well’s flowback liquids meet ACF criteria all liquids will be routed to ACF. CPAI plans to limit the flowback time to what is necessary to achieve conforming production liquids. The initial flowback period is intended to produce back the fracture liquids to tanks as quickly as possible, until the well is producing less than 10% water cut and less than 0.5% solids, at which time the produced liquids meet ACF acceptance criteria. Estimated total flowback volumes are 25,000 to 65,000 barrels of liquid produced. The flowback liquids not suitable for ACF processing will be hauled via truck from MT7 to disposal. A manifest form will be completed for each load trucked offsite. CPAI will work to separate and recover liquids that meet the facility specifications from the flowback tanks. Acceptable recovered liquids will be pumped from the tanks into the MT7 production header upstream of the MT7 pad custody meters. The fluids will be sent to the ACF and commingled with Colville River Unit (“CRU”) production, processed to sales quality, delivered to a common carrier line, and ultimately sold. T + 1 337.856-7201 1058 Baker Hughes Drive Broussard, LA 70518, USA Mar 02, 2023 AOGCC Attention: Natural Resources Technician 333 W. 7th Ave., Suite 100 Anchorage, Alaska 99501-3539 Subject:Final Log Distribution for ConocoPhillips Alaska, Inc. MT7-97 Greater Mooses Tooth API #: 50-103-20849-00 Permit No: 222-150 Rig: Doyon 25 The final deliverables were uploaded via https://copsftp.sharefile.com/ for the above well. Items delivered: MWD/LWD Digital Las Data, Graphic Images CGM/PDF and Survey Files. MT7-97 is located in a federal oil and gas unit. Only with respect to the MT7-97 Well Data, CPAI hereby waives its right to indefinite confidentiality, under 5 U.S.C. 552(b)(4) and (9). Nothing in this communication should be construed as a waiver of indefinite confidentiality on any other wells. Please note that for wells not on State land, a state agency should seek consent from the landowner prior to the release of well data by the state agency. See, e.g., AS 43.55.025(f)(2)(C)(i). Here, the landowner is the Bureau of Land Management (BLM) and/or Arctic Slope Regional Corporation (ASRC). Thank you. Signature of receiver & date received: Please return transmittal letter to: Garrett Brown Garrett.Brown@conocophillips.com Luis Arismendi Luis.arismendi@bakerhughes.com 1 Regg, James B (OGC) From:Rig 25 <rig25@doyondrilling.com> Sent:Sunday, February 12, 2023 2:43 PM To:DOA AOGCC Prudhoe Bay; Regg, James B (OGC); Brooks, Phoebe L (OGC); BLM_AK_AKSO_EnergySection_Notifications@blm.gov Cc:Drilling Supervisor, Doyon 25; WSC Rig Advisor; Greg.S.Hobbs@conocophillips.com; Ben Wedin; Bill Walter; Samuel Dye Subject:Doyon 25 BOP test 2/12/23 Attachments:BOP Test 2 JTS Order 2-12-23.pdf; 2-12-23 Chart 2.pdf; 2-12-23 Chart 1.pdf; Doyon 25 Test Report 2-12-22.xlsx Everett Potter Rig 25 Toolpusher rig25@doyondrilling.com 907-670-4971 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Greater Mooses Tooth Unit MT7-97PTD 2221500 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:25 DATE:2/12/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2201500 Sundry #323-002 Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:Other:X Rams:250 / 3500 Annular:250 / 2500 Valves:250 / 3500 MASP:3078 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 FP Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 4 P Test Fluid Water Inside BOP 2 FP FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 13-5/8"x5000psi P Pit Level Indicators P P #1 Rams 1 2-7/8 x 5-1/2 VBR P Flow Indicator P P #2 Rams 1 Blind/Shear P Meth Gas Detector P P #3 Rams 1 2-7/8 x 5-1/2 VBR P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3 1/8" x 5000 psi P Time/Pressure Test Result HCR Valves 2 3 1/8" x 5000 psi P System Pressure (psi)3000 P Kill Line Valves 2 3 1/8" x 5000 psi P Pressure After Closure (psi)1650 P Check Valve 0 NA 200 psi Attained (sec)15 P BOP Misc 0 NA Full Pressure Attained (sec)91 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:P Quantity Test Result Nitgn. Bottles # & psi (Avg.):6/ 1983 P No. Valves 15 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 17 P #1 Rams 13 P Coiled Tubing Only:#2 Rams 14 P Inside Reel valves 0 NA #3 Rams 14 P #4 Rams NA Test Results #5 Rams NA #6 Rams NA Number of Failures:2 Test Time:8.0 HCR Choke 2 P Repair or replacement of equipment will be made within days. HCR Kill 2 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 2/9/23 12:19 Waived By Test Start Date/Time:2/12/2023 5:30 (date)(time)Witness Test Finish Date/Time:2/12/2023 13:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Austin McLeod Doyon Test annular 250/3500 w/ 5" and 4" test joint, Ram #1 and #3 w/ 5" and 4" test joint to 250/3500 psi f/ 5/10 min. Test ram #2 to 250/3500 psi for 5/10 min. Test 2 ea 5" and 4" FOSV and 1 ea 5" and 4" dart valve. Function primary and remote BOPE control stations. Dart valve failed test, change, test good. Upper Kelly valve failed test, changed, test good. Test LEL and H2S gas alarms. BLM Sawyer Quinn waved witness. E,Potter/ Z.Coleman CPAI R.Reinhardt/L.Shirley GMTU MT7-97 Test Pressure (psi): rig25@doyondrilling.com d25cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0212_BOP_Doyon25_GMTU_MT7-97 =======2221500 jbr J. Regg; 6/12/2023 BOP Test - Doyon 25 GMTU MT7-97 PTD 2221500 2/12/2023 J. REgg; 6/12/2023 BOP Test - Doyon 25 GMTU MT7-97 PTD 2221500 2/12/2023 J. REgg; 6/12/2023 MT7-97 02/12/2023 Tested to 250PSI/5MIN, 35OOPSI/10MIN 4” Test Jt 1.Annular Preventer, Valves: 1, 13, 14, 15, 4” Kill Line Valve, 5” FOSV #1 2.Upper Pipe Rams (2.87” x 5.5” ), Valves: 2, 10, 12, Manual KILL 5” FOSV # 2 3.Valves: 6, 9 ,11, HCR Kill & 4” Dart 4.Valves 5, 7, 8 & , 4” FOSV #1 5.Valves 3 & 4” FOSV # 2 6.Lower Pipe Rams (2.87” x 5.5” VBR’S) 7.Blind Rams, Valves: 4 8.Manually Operated & Super Choke ( 8 A= SUPER Choke – 8B = MANUAL Choke) 5” Test Jt 9.Annular Preventer, Manual choke, 5” Dart. Chart 2 10.Upper pipe rams, HCR choke. 11. Lower pipe rams 12. Upper IBOP 13. Lower IBOP BOP Test - Doyon 25 GMTU MT7-97 PTD 2221500 2/12/2023 J. Regg; 6/12/2023 MT7-97 02/12/2023 Tested to 250PSI/5MIN, 35OOPSI/10MIN 10. Upper Pipe Rams (2.87” x 5.5” VBR’S) & HCR Choke 11. Lower Pipe Rams (2.87” x 5.5” VBR’S) 12. UIBOP 13. LIBOP 1 Regg, James B (OGC) From:Rig 25 <rig25@doyondrilling.com> Sent:Tuesday, February 7, 2023 6:09 PM To:DOA AOGCC Prudhoe Bay; Regg, James B (OGC); Brooks, Phoebe L (OGC); BLM_AK_AKSO_EnergySection_Notifications@blm.gov Cc:Drilling Supervisor, Doyon 25; WSC Rig Advisor; Greg.S.Hobbs@conocophillips.com; Ben Wedin; Bill Walter; Samuel Dye Subject:Doyon 25 2-7-23 Ram Change Test Attachments:Doyon 25 Test Report 2-7-23.xlsx; Test Chart 2-7-23.pdf; Test Sequence 2-7-23.pdf Doyon Rig 25 Test Reports for 4 ½” x 7” Ram Change with 5” & 7” Test joints. Zak Coleman Rig 25 Tourpusher rig25@doyondrilling.com 907‐670‐4971 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Greater Mooses Tooth Unit MT7-97PTD 2221500 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:25 DATE:2/7/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2201500 Sundry #323-002 Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:Other:X Rams:250 / 3500 Annular:250 / 2500 Valves:MASP:3078 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping NA Well Sign NA Upper Kelly NA Permit On Location NA Hazard Sec.NA Lower Kelly NA Standing Order Posted NA Misc.NA Ball Type NA Test Fluid Water Inside BOP NA FSV Misc NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper NA Trip Tank NA Annular Preventer 1 13-5/8 P Pit Level Indicators NA #1 Rams 1 4 1/2 X 7 P Flow Indicator NA #2 Rams NA Meth Gas Detector NA #3 Rams NA H2S Gas Detector NA #4 Rams NA MS Misc NA #5 Rams NA #6 Rams NA ACCUMULATOR SYSTEM: Choke Ln. Valves NA Time/Pressure Test Result HCR Valves NA System Pressure (psi)NA Kill Line Valves NA Pressure After Closure (psi)NA Check Valve NA 200 psi Attained (sec)NA BOP Misc NA Full Pressure Attained (sec)NA Blind Switch Covers:All stations NA CHOKE MANIFOLD:Bottle Precharge:NA Quantity Test Result Nitgn. Bottles # & psi (Avg.):NA No. Valves NA ACC Misc 0 NA Manual Chokes NA Hydraulic Chokes NA Control System Response Time:Time (sec)Test Result CH Misc NA Annular Preventer 17 P #1 Rams 15 P Coiled Tubing Only:#2 Rams 0 NA Inside Reel valves NA #3 Rams 0 NA #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:1.5 HCR Choke 0 NA Repair or replacement of equipment will be made within days. HCR Kill 0 NA Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 2/5/23 09:24 Waived By Test Start Date/Time:2/7/2023 7:00 (date)(time)Witness Test Finish Date/Time:2/7/2023 8:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Sully Sullivan Doyon Changed Ram #1 to 4 1/2X 7". Test Annular 250/2500 f/ 5/10 min w/ 7" test joint. Test Ram #1 w/ 5" and 7" test joints 250/3500 psi f/ 5/10 min. BLM Rep. Quinn Sawyer waived witness E. Potter / Z.Coleman CPAI R.Reinhardt/L.Shirley GMTU MT7-97 Test Pressure (psi): rig25@doyondrilling.com d25cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0207_BOP_Doyon25_ram-change_GMTU_MT7-97 =======2221500 J. Regg; 6/12/2023 1 Regg, James B (OGC) From:Rig 25 <rig25@doyondrilling.com> Sent:Monday, February 6, 2023 9:38 AM To:DOA AOGCC Prudhoe Bay; Regg, James B (OGC); Brooks, Phoebe L (OGC); BLM_AK_AKSO_EnergySection_Notifications@blm.gov Cc:Drilling Supervisor, Doyon 25; WSC Rig Advisor; Greg.S.Hobbs@conocophillips.com; Ben Wedin; Bill Walter; Samuel Dye Subject:D25 Ram change test Attachments:BOP Test Sequence 2-6-23.pdf; Test Chart #1 2-6-23.pdf; Doyon 25 Test Report 2-6-23.xlsx Everett Potter Rig 25 Toolpusher rig25@doyondrilling.com 907-670-4971 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. GMTU MT7-97PTD 2221500 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:25 DATE:2/6/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2201500 Sundry #323-002 Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:Other:X Rams:250 / 3500 Annular:250 / 2500 Valves:MASP:3078 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping NA Well Sign NA Upper Kelly NA Permit On Location NA Hazard Sec.NA Lower Kelly NA Standing Order Posted NA Misc.NA Ball Type NA Test Fluid Water Inside BOP NA FSV Misc NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper NA Trip Tank NA Annular Preventer 1 13-5/8 P Pit Level Indicators NA #1 Rams 1 9 5/8 P Flow Indicator NA #2 Rams NA Meth Gas Detector NA #3 Rams NA H2S Gas Detector NA #4 Rams NA MS Misc NA #5 Rams NA #6 Rams NA ACCUMULATOR SYSTEM: Choke Ln. Valves NA Time/Pressure Test Result HCR Valves NA System Pressure (psi)NA Kill Line Valves NA Pressure After Closure (psi)NA Check Valve NA 200 psi Attained (sec)NA BOP Misc NA Full Pressure Attained (sec)NA Blind Switch Covers:All stations NA CHOKE MANIFOLD:Bottle Precharge:NA Quantity Test Result Nitgn. Bottles # & psi (Avg.):NA No. Valves NA ACC Misc 0 NA Manual Chokes NA Hydraulic Chokes NA Control System Response Time:Time (sec)Test Result CH Misc NA Annular Preventer 17 P #1 Rams 15 P Coiled Tubing Only:#2 Rams 0 NA Inside Reel valves NA #3 Rams 0 NA #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:1.0 HCR Choke 0 NA Repair or replacement of equipment will be made within days. HCR Kill 0 NA Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 2/4/23 6:31PM Waived By Test Start Date/Time:2/6/2023 1:00 (date)(time)Witness Test Finish Date/Time:2/6/2023 2:00 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Guy Cook Doyon Changed Ram #1 to 9-5/8". Test Annular 250/2500 f/ 5/10 min w/ 9-5/8" test joint. Test Ram #1 w/ 9 5/8 test joint 250/3500 psi f/ 5/10 min. BLM Rep. Quinn Sawyer witnessed test. E. Potter / Z.Coleman CPAI R.Reinhardt/L.Shirley GMTU MT7-97 Test Pressure (psi): rig25@doyondrilling.com d25cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0206_BOP_Doyon25_ram-change_GMTU_MT7-97 J. Regg; 6/2/2023 Ram change NT ======== 2221500 jbr STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:25 DATE:2/1/23 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2221500 Sundry #323-002 Operation:Drilling:X Workover:Explor.: Test:Initial:X Weekly:Bi-Weekly:Other: Rams:250/5000 Annular:250/3500 Valves:250/5000 MASP:3078 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 P Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 2 P Test Fluid Water Inside BOP 1 P FSV Misc 1 P BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 13-5/8"x5000psi FP Pit Level Indicators P P #1 Rams 1 2-7/8"x5-1/2" VBR P Flow Indicator P P #2 Rams 1 Blind FP Meth Gas Detector P P #3 Rams 1 2-7/8"x5-1/2" VBR P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3-1/8"x5000psi P Time/Pressure Test Result HCR Valves 2 3-1/8"x5000psi FP System Pressure (psi)3000 P Kill Line Valves 2 3-1/8"x5000psi P Pressure After Closure (psi)1650 P Check Valve 0 NA 200 psi Attained (sec)16 P BOP Misc 0 NA Full Pressure Attained (sec)96 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:P Quantity Test Result Nitgn. Bottles # & psi (Avg.):6 / 1950 P No. Valves 15 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 26 P #1 Rams 14 P Coiled Tubing Only:#2 Rams 14 P Inside Reel valves 0 NA #3 Rams 14 P #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:3 Test Time:40.5 HCR Choke 3 P Repair or replacement of equipment will be made within days. HCR Kill 3 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 1/27/23 06:19 Waived By Test Start Date/Time:1/31/2023 3:00 (date)(time)Witness Test Finish Date/Time:2/1/2023 19:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Kam StJohn Doyon Test Annular to 250/3500psi and Ram #1 & #3 to 250/5000psi w/5" test joint. Test 2 ea 5" FOSV and 1 ea 5" & Dart Valve. All tests for 5/10 mins. Function primary & remote BOPE control stations. Test LEL & H2S alarms. BLM Rep. Quinn Sawyer waived witness. Choke HCR valve failed. Changed out with new HCR valve and retested good. Annular leaking from cap. Replaced top seal and element on annular and retested good. Blind/shears failed. Install Blind Rams and tested good. R. Fritts / Z.Coleman CPAI J. Benedict / P. Angelle GMTU MT7-97 Test Pressure (psi): rig25@doyondrilling.com d25cm@conocophillips.com Form 10-424 (Revised 08/2022)2023-0201_BOP_Doyon25_GMTU MT7-97 J. Regg; 6/1/2023 BOPE Test - Doyon 25 GMTU MT7-97 PTD 2221500 2/1/2023 J. Regg; 6/1/2023 MT7-08 2/1/2023 250 Low for 5 min – 5000 High for 10 min 5” Test Jt 1.Annular Preventer ( 250 low / 3500 high) 2.Upper 2 7/8” x 5 ½ VRB’s, Valves: # 1, 13, 14, 15, 4” Kill Valve, 5” Dart 3.Valves: # 2, 10, 12, Manual Kill, 5” FOSV # 1 4.Valves: # 6, 9 ,11, HCR Kill, 5” FOSV # 2 5.Valves: # 5, 7, 8 & UIBOP 6.Valves: # 3, 6, & LIBOP 7.Lower Pipe Rams 2 7/8” x 5 ½” VRB’s 8.Blind Rams, # 4, BOPE Test - Doyon 25 GMTU MT7-97 PTD 2221500 2/1/2023 J. Regg; 6/1/2023 MT7-97 2/1/2023 250 Low for 5 min – 5000 High for 10 min CHART #2 9.Manual Choke Valve 10.HCR Choke Valve 11.Manually Operated & Super Choke ( 11A = SUPER CHOKE – 11B = MAN OP ) 1. Type of Request:Abandon Plug Perforations Fracture Stimulate Repair Well Operations shutdown Suspend Perforate Other Stimulate Pull Tubing Change Approved Program Plug for Redrill Perforate New Pool Re-enter Susp Well Alter Casing Other: ___________________ 2.Operator Name:4. Current Well Class: 5. Permit to Drill Number: Exploratory Development 3. Address:Stratigraphic Service 6.API Number: 7. If perforating:8. Well Name and Number: What Regulation or Conservation Order governs well spacing in this pool? Will planned perforations require a spacing exception?Yes No 9. Property Designation (Lease Number):10. Field/Pool(s): 11. Total Depth MD (ft):Total Depth TVD (ft): Effective Depth MD: Effective Depth TVD: MPSP (psi): Plugs (MD): Junk (MD): Casing Collapse Structural Conductor Surface Intermediate Production Liner Packers and SSSV Type:Packers and SSSV MD (ft) and TVD (ft): 12. Attachments:Proposal Summary Wellbore schematic 13. Well Class after proposed work: Detailed Operations Program BOP Sketch Exploratory Stratigraphic Development Service 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations:OIL WINJ WDSPL Suspended 16. Verbal Approval:Yes Date: GAS WAG GSTOR SPLUG Commission Representative: GINJ Op Shutdown Abandoned Contact Name: Contact Email: Contact Phone: Date: Conditions of approval: Notify Commission so that a representative may witness Sundry Number: Plug Integrity BOP Test Mechanical Integrity Test Location Clearance Other: Post Initial Injection MIT Req'd? Yes No Spacing Exception Required? Yes No Subsequent Form Required: APPROVED BY Approved by: COMMISSIONER THE COMMISSION Date: Comm. Comm. Sr Pet Eng Sr Pet Geo Sr Res Eng Authorized Title: 17. I hereby certify that the foregoing is true and the procedure approved herein will not be deviated from without prior written approval. Authorized Signature: 1/25/2023 Staff Drilling Engineer Perforation Depth MD (ft): 2080.5 120120 TVD BurstMDLengthSize PRESENT WELL CONDITION SUMMARY STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION APPLICATION FOR SUNDRY APPROVALS 20 AAC 25.280 AA081800, AA081781 222-150 P.O. Box 100360 Anchorage, Alaska 99510-0360 50-103-20849-00-00 ConocoPhillips COMMISSION USE ONLY Authorized Name: Tubing Grade:Tubing MD (ft): Joseph Longo MT7-97 Greater Mooses Tooth / Rendezvous Joseph Longo 907-947-4323 joseph.j.longo@conocophillips.com Perforation Depth TVD (ft):Tubing Size: m n P 66 t _ Form 10-403 Revised 3/2020 Approved application is valid for 12 months from the date of approval. By Anne Prysunka at 8:30 am, Jan 06, 2023 323-002 3078 psi not Int 1 1994 psi Int 1 Initial BOP test to 5000 psig Subsequent BOP test to 3500 psig ALL CONDITIONS OF APPROVAL ON ORIGINAL PTD APPLY EXCEPT AS OUTLINED HERE. AnnularBOPtestto2500psig ApprovalisgrantedtouseaBOPEstackequippedwithanannularpreventer,blindrams,variablerams(2-7/8"x5-1/2")andfixed9-5/8"solidbody rDmswhiledrillingandrunningcasingintheIntermediate1section. ApprovalisgrantedfortheIntermediateI9-5/8"casingcentralizationstrategy. X Approval is granted to cement the production lateral section. DLB 01/06/2022 VTL 01/19/23 File with well 10-407 X X DSR-1/6/23GCW 01/19/23 JLC 1/19/2023 1/19/23Brett W. Huber. Sr.Digitally signed by Brett W. Huber. Sr. Date: 2023.01.19 14:24:23 -09'00' RBDMS JSB 012523 ConocoPhillips Alaska, Inc. Post Office Box 100360 Anchorage, Alaska 99510-0360 Telephone 907-276-1215 January 6, 2023 Alaska Oil and Gas Conservation Commission 333 West 7th Avenue, Suite 100 Anchorage, Alaska 99501 Re: Sundry to Change Approved Program for MT7-97 Dear Sir or Madam: ConocoPhillips Alaska, Inc. hereby applies for a Sundry to Change Approved Program for MT7-97, an onshore production well from the MT7 drilling pad currently being drilled with the Doyon 25 drilling rig. MT7-97 is planned to be a horizontal producer within the Rendevouz reservoir. Below are the following proposed changes to the current approved Permit to Drill. 1. Request approval to use a BOPE stack equipped with an annular preventer, blind rams, variable rams (2-7/8” x 5-1/2”) and fixed 9-5/8” solid body rams while drilling and running casing in the Intermediate 1 section. 2. Request approval to the Intermediate 1 9-5/8” casing centralization strategy. Due to issues landing within the HRZ shale it is planned to run a slick shoe track to aid in landing successfully on the casing hanger. 12” Hydroform centralizers will be run through the top of cement and inside the 13-3/8” surface casing. 3. Request approval to cement the production lateral section. This is a trial to get a better understanding of its effect on reservoir conformance. Please find attached the information required by 20 ACC 25.280 for your review. Pertinent information attached to this application includes the following: 1. Form 10-403 APPLICATION FOR SUNDRY APPROVAL as per 20 ACC 25.280 2. Intermediate 1 MPSP Review 3. Intermediate 1 centralization overview 4. 4-1/2” Production Cement program 5. Proposed schematic If you have any questions or require further information, please contact Joseph Longo at 907-947-4323 (joseph.j.longo@conocophillips.com) or Chris Brillon at 907-265-6120. Sincerely, cc: MT7-97 Well File / Jenna Taylor ATO 1732 David Lee ATO 1552 Chris Brillon ATO 1548 Joseph Longo Staff Drilling Engineer Saved: 1/4/2023 Page 1 Table of Contents MT7-97 Intermediate 1 MPSP Review............................................................................... 2 Proposal ................................................................................................................................................................................... 2 20 AAC 25.035.e.1.A: ............................................................................................................................................................... 2 Pore Pressure Assessment ...................................................................................................................................................... 3 Maximum Potential Surface Pressure ...................................................................................................................................... 4 MT7-97 Intermediate Centralization ................................................................................. 5 Overview .................................................................................................................................................................................. 5 MT7-97 Production Cement Details .................................................................................. 6 Overview .................................................................................................................................................................................. 6 Cement calculations ................................................................................................................................................................. 6 15.3 GASBLOK CTD Liner Pilot ................................................................................................................................................ 7 MT7-97 Proposed Well Schematic ................................................................................... 8 Saved: 1/4/2023 Page 2 MT7-97 Intermediate 1 MPSP Review Proposal Requesting approval to use a BOPE stack equipped with an annular preventer, fixed 9-5/8” solid body rams, blind/shear rams and, variable rams (2-7/8” x 5-1/2”) while drilling and running casing in the Intermediate 1 section of MT7-97. The Maximum Potential Surface Pressure (MPSP) is expected to be 1,994 psi while drilling the 12-1/4” Intermediate 1 hole section with 5” drill pipe, satisfying 20 AAC 25.035.e.1.A. Please find the review below for more detail. 20 AAC 25.035.e.1.A: For an operation with a maximum potential surface pressure of 3,000 psi or less, BOPE must have at least three preventers, including: i. One equipped with pipe rams that fit the size of drill pipe, tubing or casing begin used, except that pipe rams need not be sixed to bottom-hole assemblies and drill collars. ii. One with blind rams iii. One annular type Proposed Configuration: x Annular Preventer (iii) x 9-5/8” Solid Body Rams x Blind/Shear Rams (ii) x 2-7/8” x 5-1/2” VBR’s (i) Saved: 1/4/2023 Page 3 Pore Pressure Assessment A Normal Compaction Trend (NCT) is defined using the Bowers Method on a calibration well with little/no erosion and global constants as a starting point. Both source rock and non-source rock NCTs are then defined. For a given unit/zone, deviations slower than NCP indicate overpressure and allow calculation of its magnitude. The NCT for individual wells is defined by modifying Bowers parameters to account for specific erosion amounts. The maximum estimated reservoir pressure in the Intermediate 1 section is 9.4 ppg Interval TVD Top TVD Base Max PPG Note Surface to Permafrost_Base 0 977 8.3 Hydrostatic Permafrost_Base to C40 977 1079 9.1 Hydrostatic C40 to C30 1079 1405 9.2 Rendezvous-2 DT Estimate C30 to C20 1405 1642 8.45 Hydrostatic C20 to C10 1642 1986 8.475 Hydrostatic C10 to K3 1986 2999 9.3 Rendezvous-2 DT Estimate K3 to Albian_97 2999 3607 8.55 Hydrostatic Albian_97 to Albian_96 3607 3788 8.56 Hydrostatic Albian_96 to Albian_95 3788 3972 8.56 Hydrostatic Albian_95 to Albian_94 (Tusk Sand if present) 3972 4240 8.56 Hydrostatic Albian_94 to Albian_93 4240 4895 8.57 Hydrostatic Albian_93 to Albian_92 4895 6061 8.6 Hydrostatic Albian_92 to Albian_91 6061 6121 8.6 Hydrostatic Albian_91 to HRZ (Susitna Sand if present) 6121 7396 9.4 Offset Well DT/ Res Estimates HRZ to LCU 7396 7591 11.6 Offset Well DT/ Res Estimates LCU to Alpine_D 7591 8237 11.75 Offset Well DT/ Res Estimates Alpine_D to Alpine_C 8237 8263 11.4 MT7-04 Res Est. Alpine_C to UJU 8263 8359 8.8 Offset MDT’s Saved: 1/4/2023 Page 4 Maximum Potential Surface Pressure Surface Casing Point: 3193' MD/ 3049' TVD Intermediate 1 Casing Point: 8202' MD/ 7498' TVD Max Anticipated Pore Pressure: 9.4 ppg | Albian 91 > HRZ Surface Casing Shoe FG: 14.5 ppg EMW | K3 Maximum Potential Surface Pressure (MPSP) is determined as the lesser of 1.) surface pressure at breakdown of the formation casing seat with a gas gradient to the surface, or 2.) formation pore pressure at the next casing point less a gas gradient to the surface as follows: Method 1 Method 2 ܯܲܵܲ = [(ܨܩ × 0.052 )െܩܽݏ ܩݎܽ݀݅݁݊ݐ] × ܸܶܦ ܯܲܵܲ = ܨܲܲ െ (ܩܽݏ ܩݎܽ݀݅݁݊ݐ) × ܸܶܦ Where: FG – Fracture gradient at the casing seat in lb/gal 0.052 – Conversion from lb/gal to psi/ft Gas Gradient – 0.1 psi/ft TVD – True Vertical Depth of casing seat in ft RKB Where: FPP – Formation Pore Pressure at the next casing point MPSP CALCULATIONS: Method 1: ࡹࡼࡿࡼ = [(ܨܩ × 0.052 )െܩܽݏ ܩݎܽ݀݅݁݊ݐ] × ܸܶܦ MPSP = [(14.5 ݃ ܧܯܹ × 0.052 )െ 0.1] × 3049Ԣ MPSP = 1994 psi Method 2: ࡹࡼࡿࡼ = ܨܲܲ െ (ܩܽݏ ܩݎܽ݀݅݁݊ݐ) × ܸܶܦ MPSP = (9.4 ݃ × 0.052 × 7498Ԣ )െ (0.1 × 7498 ᇱ) MPSP = 2915 psi Saved: 1/4/2023 Page 5 MT7-97 Intermediate Centralization Overview In the past while landing our 9-5/8” intermediate 1 casing string we have issues running through the HRZ. Our interpretation is that, due to swelling, often our shoe track creates excessive drag upon entering the top of the HRZ. To mitigate this risk, we are proposing to run an un-centralized shoe track. We will run centralizers above the shoe track through the Top of Cement (TOC) as well as inside the 13-3/8” surface casing. Intermediate 1 - 9-5/8” Centralization Type Spacing Count Stop Ring 9-5/8” x 12" HydroForm 1 per 3 joints inside Surface Casing 27 0 9-5/8” x 12" HydroForm 1 per Joint from TOC to Shoe Track 69 0 Saved: 1/4/2023 Page 6 MT7-97 Production Cement Details Overview To reduce potential future conformance issues within the Alpine reservoir the 4-1/2” production liner will be cemented. A 15.3 ppg GASBLOK CTD slurry will be utilized due to its low rheology. The entire lateral will be cementing using 30% cement excess + 500’. Cement calculations Weight Yieldft3bblsft3bblsft3bblsft3bbls ppgft3/ SackLateral Length + 500' 9230' - 20495' 11265 0.019 30% 1204 214.46 361 64.34 0 0 1565 278.80 1195 15.3 ppg GASBLOK CTD 1.31Shoe Track 20415' - 20495' 80 0.015 0% 7 1.22 0 0.00 0 0 7 1.22 5 15.3 ppg GASBLOK CTD 1.311211 215.68 361 64.34 0 01572 280.02 1200 15.3 ppg GASBLOK CTD 1.31Total Tail Volume = 278.80 + 1.22 bbls = 280.02 bbls => 1,200 sx of 15.3 ppg GASBLOK CTD @ 1.31 ft³/skAdditional bblsTotal VolumeSacks BlendTailFootagePlacementbbl/ft% ExcessVolumeXS VolumeProduction Liner Saved: 1/4/2023 Page 7 15.3 GASBLOK CTD Liner Pilot Job Type : Primary MD : 14,390.00 ft TVD : 8,672.00 ft BHST : 178.00 °F BHCT : 177.00 °F BHP : 4,500.00 psi Starting Temp : 68.00 °F Time To Temp : 00:45 hr:mn Heating Rate : 2.42 °F/min Starting Pressure : 0.00 psi Time To Pressure : 00:45 hr:mn Composition Slurry Density : 15.30 lb/gal Yield : 1.31 ft³/sk of blend Mix Fluid : 6.108 gal/sk of blend Solid Vol. Fraction : 37.79 % Slurry Type : Single System Mix Water : 4.290 gal/sk of blend Rheology Surface (Configuration: R1B1 F1.0) Temperature 80 °F (rpm) Up (deg) Down (deg) Average (deg) 300 33 33 33 200 24 24 24 100 12 12 12 60 9 9 9 30 6 6 6 6 3 3 3 3 2 2 2 10 sec Gel 3 deg - 3.19 lbf/100ft² 10 min Gel 18 deg - 19.16 lbf/100ft² Rheo. computed PV: 31.1 cP, Ty: 2.35 lbf/100ft² Downhole (Configuration: R1B1 F1.0) Temperature 177 °F (rpm) Up (deg) Down (deg) Average (deg) 300 43 43 43 200 32 31 31.5 100 18 18 18 60 12 12 12 30 8 8 8 6 3 3 3 3 2 2 2 10 sec Gel 3 deg - 3.19 lbf/100ft² 10 min Gel 15 deg - 15.97 lbf/100ft² Rheo. computed PV: 41.1 cP, Ty: 3.08 lbf/100ft² Thickening Time S/N: 964 Set Conditions – Set Hard Consistency Time Temp Go/No-Go: On: 01:45 hr:mn Off: 00:20 hr:mn 30 Bc 06:23 hr:mn 177 °F 50 Bc 06:34 hr:mn 177 °F 70 Bc 06:38 hr:mn 177 °F 100 Bc 06:42 hr:mn 177 °F Batch Mix Time 01:00 hr:mn at 90 °F Thickening time includes batch mix time Free Fluid Trace / 250mL in 2 hrs At 80 °F and 45 deg inclination Sedimentation: None Fluid Loss S/N: 1408 API/Calculated Fluid Loss 40.00 mL 20.00 mL in 30 mins at 177 °F Non Stirred Fluid Loss apparatus was utilized Mud Balance S/N: 90308 Slurry Density Verified by Pressurized Fluid Balance: 15.30 lb/gal Saved: 1/4/2023Page 8MT7-97 Proposed Well SchematicMT7-97Southern ProducerDRAFT –WP03RKB = 139.5' AMSLJJL –12/30/2022Top Sub Albian 935895' MD / 5483' TVDTop HRZ8153' MD / 7460' TVDTop Alpine D9681' MD / 8289' TVDTop Alpine C9867' MD / 8329' TVD20" 94 ppf H-40 Insulated Conductor80' MD/ TVD - Cemented to surfaceIntermediate I Casing9-5/8" 43.5# L80 H563 | 9-5/8" 47# T95 H563 (5000')8202' MD / 7498' TVD4-½" 12.6# P110S HYD5631 Arsenal Flotation Sub / ~15 Swell Packer / ~15 Advanced Upstream Frac Sleeves / 1 Alpha Landing Collar2 Alpha Toe Sleeves / 1 Citadeal MOAS Float ShoeHRDE ZXP Liner Top PKR9556' MD / 8257' TVD7" x 4-½” Production Packer9435' MD / 8219' TVD4-1/2" 12.6# P110S HYD56320490' MD / 8486' TVD6-1/8” Production Hole20495' MD / 8486' TVDSurface Casing13-3/8" 68# L80 H5633193' MD / 3005' TVD Cemented to SurfaceLead: 11.0 ppg DeepCRETE | Tail: 15.8 ppg Class GIntermediate II Liner7" 29# L80 H5639731' MD / 8300' TVDTOC – 500' Above Sub-Albian 93Lead: 13.0 ppg Class G |Tail: 15.8 ppg Class G5395' MD / 5033' TVDTOC – 500' Above AlpineTail: 15.8 ppg Class G9181' MD / 8119' TVD4-½” 12.6# L80 H563 TubingUPPER COMPLETION:1. 4-½” X Landing Nipple (3.813" ID)2. 4-½” x 1" KBG 4-5 (3x – 1 SOV, 2 DV)3. HES Opsis Downhole Gauge4. HES TNT Packer5. 4-½” DB Landing Nipple (3.75" ID) From:Loepp, Victoria T (OGC) To:Hobbs, Greg S Cc:Rixse, Melvin G (OGC); McLellan, Bryan J (OGC); Regg, James B (OGC) Bcc:Chmielowski, Jessie L C (OGC); Wilson, Greg C (OGC) Subject:CPAI BOPE stack modification for drilling GMT MT7 INT 1 sections for 4 string completions Date:Thursday, December 29, 2022 9:37:00 AM Greg, CPAI has requested approval to use a BOPE stack equipped with an annular preventer, blind rams, variable rams (2-7/8”x5-1/2”) and fixed 9-5/8” solid body rams while drilling and running casing in the Intermediate 1 section of future 4 string GMT MT7 wells. CPAI has indicated the MPSP of this Intermediate 1 section is <3000 psig and requires a three preventer stack. The fourth preventer would be equipped with 9-5/8” solid body rams. This configuration would eliminate a procedural step to change VBRs to 9-5/8” solid body rams to run 9.625” intermediate casing after drilling to the casing point. CPAI has provided a review of GMT MT7 wells including MPSP determination, complications that arise due to HRZ destabilization, BOPE configurations and a risk analysis. This request will be considered for GMT MT7 wells only on a well by well basis during the PTD approval process. The request must include the proposal, the justification and the risk analysis to be considered. If approved, the approval conditions will be included in the “Conditions of Approval” section of the 10-401 Permit to Drill application. Victoria Victoria Loepp Senior Petroleum Engineer State of Alaska Oil & Gas Conservation Commission 333 W. 7th Ave Anchorage, AK 99501 Work: (907)793-1247 Victoria.Loepp@alaska.gov CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Victoria Loepp at (907)793-1247 or Victoria.Loepp@alaska.gov Alaska Oil and Gas Conservation Commission 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov Chris Brillon Wells Engineering Manager ConocoPhillips Alaska, Inc P.O. Box 100360 Anchorage, Alaska 99510-0360 Re: Greater Moose’s Tooth Field, Rendezvous Oil Pool, MT7-97 ConocoPhillips Alaska, Inc Permit to Drill Number: 222-150 Surface Location: 1044’ FSL, 2000’ FWL, SESW S32 T10N R2E, UM Bottomhole Location: 3576’ FSL, 846’ FWL, SESE S16 T9N R2E, UM Dear Mr. Brillon: Enclosed is the approved application for the permit to drill the above referenced well. Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071, composite curves for well logs run must be submitted to the AOGCC within 90 days after completion, suspension, or abandonment of this well, or within 90 ways of acquisition of the data, whichever occurs first. This permit to drill does not exempt you from obtaining additional permits or an approval required by law from other governmental agencies and does not authorize conducting drilling operations until all other required permits and approvals have been issued. In addition, the AOGCC reserves the right to withdraw the permit in the event it was erroneously issued. Operations must be conducted in accordance with AS 31.05 and Title 20, Chapter 25 of the Alaska Administrative Code unless the AOGCC specifically authorizes a variance. Failure to comply with an applicable provision of AS 31.05, Title 20, Chapter 25 of the Alaska Administrative Code, or an AOGCC order, or the terms and conditions of this permit may result in the revocation or suspension of the permit. Sincerely, Jessie L. Chmielowski Commissioner DATED this ___ day of December 2022. 16 Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2022.12.16 14:08:42 -09'00' D7\SHRI:RUN E3URSRVHG:HOO&ODVV ([SORUDWRU\*DV 6HUYLFH:$* 6HUYLFH'LVS F6SHFLI\LIZHOOLVSURSRVHGIRU 'ULOO /DWHUDO 6WUDWLJUDSKLF7HVW 'HYHORSPHQW2LO 6HUYLFH:LQM 6LQJOH=RQH &RDOEHG*DV *DV+\GUDWHV 5HGULOO 5HHQWU\ ([SORUDWRU\2LO 'HYHORSPHQW*DV 6HUYLFH6XSSO\ 0XOWLSOH=RQH *HRWKHUPDO 6KDOH*DV 2SHUDWRU1DPH %RQG %ODQNHW 6LQJOH:HOO :HOO1DPHDQG1XPEHU %RQG1R $GGUHVV 3URSRVHG'HSWK )LHOG3RRO V 0' 79' D/RFDWLRQRI:HOO *RYHUQPHQWDO6HFWLRQ 3URSHUW\'HVLJQDWLRQ 6XUIDFH 7RSRI3URGXFWLYH+RUL]RQ '15$SSURYDO1XPEHU $SSUR[LPDWH6SXG'DWH 7RWDO'HSWK $FUHVLQ3URSHUW\ 'LVWDQFHWR1HDUHVW3URSHUW\ WR$$ E/RFDWLRQRI:HOO 6WDWH%DVH3ODQH&RRUGLQDWHV1$' .%(OHYDWLRQDERYH06/ IW 'LVWDQFHWR1HDUHVW:HOO2SHQ 6XUIDFH [ \ =RQH WR6DPH3RRO WR07 'HYLDWHGZHOOV .LFNRIIGHSWK IHHW 0D[LPXP3RWHQWLDO3UHVVXUHVLQSVLJ VHH$$& 0D[LPXP+ROH$QJOH GHJUHHV 'RZQKROH 6XUIDFH +ROH &DVLQJ :HLJKW *UDGH &RXSOLQJ /HQJWK 0' 79' 0' 79' +:HOGHG / +\G /7 +\G [ /3 +\G 3 +\G 35(6(17:(//&21',7,216800$5< 7REHFRPSOHWHGIRU5HGULOODQG5H(QWU\2SHUDWLRQV -XQN PHDVXUHG 79' +\GUDXOLF)UDFWXUHSODQQHG"<HV 1R $WWDFKPHQWV 3URSHUW\3ODW %236NHWFK 'ULOOLQJ3URJUDP 7LPHY'HSWK3ORW 6KDOORZ+D]DUG$QDO\VLV 'LYHUWHU6NHWFK 6HDEHG5HSRUW 'ULOOLQJ)OXLG3URJUDP $$&UHTXLUHPHQWV &RQWDFW1DPH -RH/RQJR &KULV%ULOORQ &RQWDFW(PDLO MRVHSKMORQJR#FRQRFRSKLOOLSVFRP :HOOV(QJLQHHULQJ0DQDJHU &RQWDFW3KRQH 'DWH 3HUPLWWR'ULOO $3,1XPEHU 3HUPLW$SSURYDO 1XPEHU 'DWH &RQGLWLRQVRIDSSURYDO ,IER[LVFKHFNHGZHOOPD\QRWEHXVHGWRH[SORUHIRUWHVWRUSURGXFHFRDOEHGPHWKDQHJDVK\GUDWHVRUJDVFRQWDLQHGLQVKDOHV 6DPSOHVUHT G <HV1R 0XGORJUHT G <HV1R +6PHDVXUHV <HV1R 'LUHFWLRQDOVY\UHT G <HV1R 6SDFLQJH[FHSWLRQUHT G <HV1R ,QFOLQDWLRQRQO\VY\UHT G <HV1R 3RVWLQLWLDOLQMHFWLRQ0,7UHT G <HV1R $33529('%< $SSURYHGE\ &200,66,21(5 7+(&200,66,21 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEH GHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO 3HUIRUDWLRQ'HSWK79' IW */%)(OHYDWLRQDERYH06/ IW 3HUIRUDWLRQ'HSWK0' IW V[SSJ&ODVV* 8QFHPHQWHGOLQHUZIUDFVOHHYHV VZHOOSDFNHUV (IIHFW'HSWK0' IW (IIHFW'HSWK79' IW $XWKRUL]HG7LWOH $XWKRUL]HG6LJQDWXUH $XWKRUL]HG1DPH /HQJWK&DVLQJ 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 3(50,772'5,// $$& &DVLQJ3URJUDP 7RS6HWWLQJ'HSWK%RWWRP6SHFLILFDWLRQV &RQRFR3KLOOLSV )6/ ):/6(6:6715(80 $$$$ )6/ ):/6(6:67 15(80 )6/ ):/6(6(67 15(80 32%R[$QFKRUDJH$ODVND &HPHQW9ROXPH 0'6L]H 3OXJV PHDVXUHG LQFOXGLQJVWDJHGDWD &HPHQWWRVXUIDFHZLWK\GVVOXUU\ V[SSJ&ODVV*V[SSJ& 7RWDO'HSWK0' IW 7RWDO'HSWK79' IW V[SSJ'&V[SSJ&ODV 07 *UHDWHU0RRVHV7RRWK 5HQGH]YRXV &HPHQW4XDQWLW\FIRUVDFNV &RPPLVVLRQ8VH2QO\ 6HHFRYHUOHWWHUIRURWKHU UHTXLUHPHQWV G < <HHV \SHRI: O E 6 &ODVV RV1 G <HHHV111R V1 11R 'ULO V V V 7 'ULO R KDDDOHVV ZHOOLV * 6 6 66 6 G <HHV11RV1R 6 * \( 6 G <HHV11R V )RUP5HYLVHG7KLVSHUPLWLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDOSHU$$& J By Anne Prysunka at 9:52 am, Nov 22, 2022 SFD 12/15/2022 50-103-20849-00-00 VTL 12/16/2022 222-150 Initial BOP test to 5000 psig; Subsequent BOP test to 3500 psig; Annular preventer to 2500 psig Diverter variance granted per 20 AAC 25.035(h)(2) Waiver for CPAI Rotary Rig BOPE Test Frequency applies according to order OTH-21-018 attached Intermediate II cement evaluation may use SonicScope under the attached Conditions of Approval Surface casing LOT and annular LOT to the AOGCC as soon as available. DSR-11/22/22 X GCW 12/1226 Jessie L. Chmielowski Digitally signed by Jessie L. Chmielowski Date: 2022.12.16 14:08:54 -09'00' GMTU MT7-97 Conditions of Approval: Approval is granted to run the LWD-Sonic on upcoming well with the following provisions: 1. CPAI will provide a written log evaluation/interpretation to the AOGCC along with the log as soon as they become available. The evaluation is to include/highlight the intervals of competent cement that CPAI is using to meet the objective requirements for annular isolation, reservoir isolation, or confining zone isolation etc. Providing the log without an evaluation/interpretation is not acceptable. 2. LWD sonic logs must show free pipe and Top of Cement, just as the e-line log does. CPAI must start the log at a depth to ensure the free pipe above the TOC is captured as well as the TOC. Starting the log below the actual TOC based on calculations predicting a different TOC will not be acceptable. 3. CPAI will provide a cement job summary report and evaluation along with the cement log and evaluation to the AOGCC when they become available 4. CPAI will provide the results of the FIT when available. 5. Depending on the cement job results indicated by the cement job report, the logs and the FIT, remedial measures or additional logging may be required. 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov -DQXDU\ &(57,),('0$,/± 5(78515(&(,375(48(67(' 0U/XNH/DZUHQFH :HOOV0DQDJHU &RQRFR3KLOOLSV$ODVND *6WUHHW $QFKRUDJH$. 5H 'RFNHW1XPEHU 27+ $SSOLFDWLRQIRU:DLYHURQ&3$,5RWDU\ 5LJ%23(7HVW)UHTXHQF\ 'HDU0U/DZUHQFH %\OHWWHUGDWHG0D\&RQRFR3KLOOLSV$ODVND,QF &3$, UHTXHVWHGDZDLYHUIURPWKH $ODVND 2LO DQG *DV &RQVHUYDWLRQ &RPPLVVLRQ¶V $2*&& UHJXODWRU\ UHTXLUHG EORZRXW SUHYHQWLRQHTXLSPHQW %23( WHVWIUHTXHQF\IRUDOO&3$,URWDU\GULOOLQJULJVSHWLWLRQLQJWRWHVW WKHEORZRXWSUHYHQWLRQHTXLSPHQW %23( RQDGD\WHVWVFKHGXOH$2*&&JUDQWVDSSURYDO IRUOLPLWHGGXUDWLRQDQGVFRSH &3$,PHWZLWK$2*&&RQ$SULOVXPPDUL]HGLWVREMHFWLYHLQUHTXHVWLQJDSSURYDORID GD\%23(WHVWVFKHGXOH LPSURYH&3$,¶VDELOLW\WRFRPSHWHIRUFRUSRUDWH FDSLWDOLQYHVWPHQWV H[SODLQHGDOLJQPHQWZLWKLQGXVWU\VWDQGDUG%23(WHVWFULWHULD DQG&RQRFR3KLOOLSVJOREDOZHOO FRQWUROSROLF\DQGSURYLGHGDQRYHUYLHZRIQHZGULOOLQJWDUJHWVSODQQHGXVLQJD³KLJKVSHF H[WHQGHGUHDFKGULOOLQJULJ´&3$,DOVRSURYLGHGGHWDLOVDERXWWKHVFRSHDQG%23(SHUIRUPDQFH DFKLHYHPHQWV XQGHU LWV %HWZHHQ :HOO 0DLQWHQDQFH 3URJUDP %:0 IRU URWDU\ GULOOLQJ DQG ZRUNRYHUULJV $VZLWKSUHYLRXVUHTXHVWVWRH[WHQGWKH%23(WHVWLQWHUYDO&3$,UHIHUHQFHVQXPHURXVUHJXODWRU\ MXULVGLFWLRQVDVZHOODVVXJJHVWHGLQGXVWU\SUDFWLFHIURPWKH$PHULFDQ3HWUROHXP,QVWLWXWHUHODWLQJ WR WHVW IUHTXHQF\ HDFK SURYLGLQJIRU %23( WHVWLQJ DW LQWHUYDOV EH\RQG GD\V &3$, DOVR UHIHUHQFHVLWVLQWHUQDOZHOOFRQWUROPDQXDOZKLFKDOORZVIRUWHVWLQJDWLQWHUYDOVEH\RQGGD\V ϭW/^ƚĂŶĚĂƌĚϱϯ͕͞tĞůůŽŶƚƌŽů ƋƵŝƉŵĞŶƚ^LJƐƚĞŵƐĨŽƌƌŝůůŝŶŐtĞůůƐ͕͟ϱƚŚ ĚŝƚŝŽŶ;ĞĐĞŵďĞƌϮϬϭϴͿ ϮK'ĂƉƉƌŽǀĂůŽĨƚŚĞtDƉƌŽŐƌĂŵŚĂƐĞŶĂďůĞĚW/ǁŽƌŬŽǀĞƌƌŝŐƐƚŽĞdžƚĞŶĚƚŚĞŝŶƚĞƌǀĂůďĞƚǁĞĞŶKW ƚĞƐƚƐ ĨƌŽŵĞǀĞƌLJϳĚĂLJƐƚŽŶŽƚĞdžĐĞĞĚŝŶŐϭϰĚĂLJƐ͘W/ĚĂƚĂƐŚŽǁƐƚŚĞtDŚĂƐƌĞĚƵĐĞĚƚŚĞŶƵŵďĞƌŽĨĐŽŵƉŽŶĞŶƚ ĨĂŝůƵƌĞƐĚƵƌŝŶŐKW ƚĞƐƚŝŶŐďLJƌĞƉůĂĐŝŶŐĐŽŵƉŽŶĞŶƚƐƚŚĂƚŝŶĚŝĐ ĂƚĞƐƵƐƉĞĐƚŝŶƚĞŐƌŝƚLJďĞĨŽƌĞƚŚŽƐĞĐŽŵƉŽŶĞŶƚƐĨĂŝů ĚƵƌŝŶŐƚĞƐƚŝŶŐ͘ 'RFNHW1XPEHU 27+ &3$,±GD\%23(7HVW,QWHUYDO -DQXDU\ ,PSURYHPHQW LQ %23( SHUIRUPDQFH WHVWLQJ UHVXOWV DWWULEXWHG WR &3$,¶V %:0 SURJUDP LV UHFRJQL]HG&3$,LVFRPPHQGHGIRULPSOHPHQWLQJWKHSURJUDPDQGZLWK$2*&&DSSURYDO&3$, ZRUNRYHUULJV KDYHEHHQDXWKRUL]HGWRWHVW %23( DWLQWHUYDOVXSWR GD\V$2*&&UHFRJQL]HV WKHFRPSOH[GULOOLQJSURJUDPVWKDWKDYHEHHQLQLWLDWHGE\&3$,WRWDUJHWFKDOOHQJLQJUHVRXUFHV ZKLOHPDLQWDLQLQJDVPDOOHQYLURQPHQWDOIRRWSULQWDQGWKHFRPPLWPHQWWRXVHUREXVWGULOOLQJULJV DQGFUHZVWRSHUIRUPWKRVHSURMHFWVLQDVDIHDQGHIILFLHQWPDQQHU,QUHVSRQVHWRWKHVHFKDOOHQJHV DQG WKH FRPPLWPHQWV E\ &3$, LQFOXGLQJ LPSOHPHQWDWLRQ RI WKH %:0 SURJUDP $2*&& FRQGLWLRQDOO\DSSURYHG'R\RQ5LJWRWHVW%23(RQDQHYHQWEDVLVLQVWHDGRIDWVSHFLILFWLPH LQWHUYDOVZKLOHGULOOLQJVSHFLILFLQWHUYDOV LQDQXOWUDH[WHQGHGUHDFKZHOO &3$,¶VUHTXHVWIRUD YDULDQFHIURPUHJXODWRU\UHTXLUHPHQWV RI$$& H $ LV DSSURYHGIRUGULOOLQJULJV'R\RQDQG'R\RQDVDSLORWSURMHFWZLWKWKHIROORZLQJFRQGLWLRQV 7KHSLORWWHVWGXUDWLRQLVIRU21( \HDU IURPWKHDSSURYDOGDWHRIWKLVOHWWHUVXEMHFWWR SRWHQWLDOH[WHQVLRQDQG H[SDQVLRQWRLQFOXGHRWKHU&3$,RSHUDWHGULJVZLWK DWOHDVW PRQWKVRIFRQWLQXRXVULJZRUNDQG$2*&&UHYLHZRIDULJ¶V%23(V\VWHPUHOLDELOLW\ &3$,PXVWFRQWLQXHWRLPSOHPHQWWKH%:0SURJUDPDVDSSURYHGE\$2*&& 'HYHORSPHQWGULOOLQJZHOOVRQO\DUHLQFOXGHGLQWKLVDSSURYDO 7KHLQLWLDOWHVWDIWHUULJJLQJXS%23(WRGULOODZHOOPXVWEHWRWKHUDWHGZRUNLQJSUHVVXUH DVSURYLGHGLQ$3,6WDQGDUG &3$,LVHQFRXUDJHGWRWDNHDGYDQWDJHRIRSSRUWXQLWLHVWRWHVW5LJVPXVWWHVWEHIRUH UHHQWHULQJWKHZHOOLIDWULSWRVXUIDFHRFFXUVZLWKLQGD\VRIWKHGXHGDWHXQOHVVRWKHUZLVH DSSURYHGE\$2*&& &3$,PXVWDGKHUHWRRULJLQDOHTXLSPHQWPDQXIDFWXUHUUHFRPPHQGDWLRQVDQGUHSODFHPHQW SDUWVIRU%23( 5HTXHVWV IRU H[WHQVLRQV EH\RQG GD\V PXVW LQFOXGH MXVWLILFDWLRQ ZLWK VXSSRUWLQJ LQIRUPDWLRQGHPRQVWUDWLQJWKHDGGLWLRQDOWLPHLVQHFHVVDU\IRUZHOOFRQWUROSXUSRVHVRUWR PLWLJDWHDVWXFNGULOOVWULQJ KRXUDGYDQFHQRWLFHIRUD%23(WHVWVKDOOEHSURYLGHGWR$2*&&IRURSSRUWXQLW\WR ZLWQHVV ,I\RXKDYH TXHVWLRQVUHJDUGLQJWKLV SOHDVH FRQWDFW-LP5HJJ DW 6LQFHUHO\ -HUHP\0 3ULFH &KDLU&RPPLVVLRQHU FF *UHJ+REEV &3$, 0LNH.QHDOH &3$, 9LFWRULD/RHSS $2*&& $2*&&,QVSHFWRUV HPDLO Jeremy Price Digitally signed by Jeremy Price Date: 2022.01.25 13:00:50 -09'00' &RQRFR3KLOOLSV$ODVND,QF 3RVW2IILFH%R[ $QFKRUDJH$ODVND 7HOHSKRQH 1RYHPEHU $ODVND2LODQG*DV&RQVHUYDWLRQ&RPPLVVLRQ :HVWWK$YHQXH6XLWH $QFKRUDJH$ODVND 5H $SSOLFDWLRQIRU3HUPLWWR'ULOO07 'HDU6LURU0DGDP &RQRFR3KLOOLSV$ODVND,QFKHUHE\DSSOLHVIRUD3HUPLWWR'ULOODQRQVKRUH$OSLQH&6DQGSURGXFHUZHOOIURPWKH07 GULOOLQJSDG7KHLQWHQGHGVSXGGDWHIRUWKLVZHOOLV,WLVLQWHQGHGWKDW'R\RQEHXVHGWRGULOOWKHZHOO 07 ZLOOXWLOL]HD´VXUIDFHKROHDQGZLOO7'DERYHWKH.VDQGDQGWKHQFDVLQJZLOOEHVHWDQGFHPHQWHGWR VXUIDFH7KHLQWHUPHGLDWHVHFWLRQZLOOEHGULOOHGWRWKHWRSRI+5=IRUPDWLRQ$ FDVLQJVWULQJZLOOEHUXQDQG FHPHQWHGLQSODFHZLWKD¶0'RU¶79'FROXPQRIFHPHQWDERYHWKHKLJKHVWK\GURFDUERQEHDULQJ]RQHSHU$2*&& UHJXODWLRQ,IDQDGGLWLRQDOK\GURFDUERQ]RQHLVSUHVHQWDQGVWDJHFHPHQWMREZLOOEHSHUIRUPHGWRFRYHU¶79'DERYHDQG EHORZWKHLQWHUYDO7KH[ LQWHUPHGLDWHVHFWLRQZLOOEHGULOOHGDQGODQGHGLQWKH$OSLQH'$´OLQHUVWULQJZLOO EHVHWDQGFHPHQWHGIURP7'WRVHFFXUHWKHVKRHDQGFRYHU¶0'RU¶79'DERYHDQ\K\GURFDUERQEHDULQJ]RQH 7KHSURGXFWLRQLQWHUYDOZLOOEHFRPSULVHGRID[KRUL]RQWDOKROHWKDWZLOOEHJHRVWHHUHGLQWKH$OSLQH&VDQG 7KHZHOOZLOOEHFRPSOHWHGDVDSURGXFHUZLWK´OLQHUZLWKIUDFVOHHYHVDQGVZHOOSDFNHUV7KHXSSHUFRPSOHWLRQZLOO LQFOXGHDSURGXFWLRQSDFNHUZLWK*/0¶VDQGWLHGEDFNWRVXUIDFH ,WLVUHTXHVWHGWKDWDYDULDQFHRIWKHGLYHUWHUUHTXLUHPHQWXQGHU$$& K LVJUDQWHG$W07WKHUHKDV QRWEHHQDVLJQLILFDQWLQGLFDWLRQRIVKDOORZJDVRUJDVK\GUDWHVWKURXJKWKHVXUIDFHKROHLQWHUYDO 3OHDVHILQGDWWDFKHGWKHLQIRUPDWLRQUHTXLUHGE\$&& D DQG F IRU\RXUUHYLHZ3HUWLQHQWLQIRUPDWLRQ DWWDFKHGWRWKLVDSSOLFDWLRQLQFOXGHVWKHIROORZLQJ )RUP$33/,&$7,21)253HUPLWWR'ULOOSHU$&& D $SURSRVHGGULOOLQJSURJUDP $SURSRVHGFRPSOHWLRQGLDJUDP $GULOOLQJIOXLGVSURJUDPVXPPDU\ 3UHVVXUHLQIRUPDWLRQDVUHTXLUHGE\$&& G 'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFHLQIRUPDWLRQDVUHTXLUHGE\$&& E $UHDRIUHYLHZ ,QIRUPDWLRQSHUWLQHQWWRWKHDSSOLFDWLRQWKDWLVSUHVHQWO\RQILOHDWWKH$2*&& 'LDJUDPVRIWKH%23HTXLSPHQWGLYHUWHUHTXLSPHQWDQGFKRNHPDQLIROGOD\RXWDVUHTXLUHGE\$&& D DQG E $GHVFULSWLRQRIWKHGULOOLQJIOXLGVKDQGOLQJV\VWHP 'LDJUDPRIULVHUVHWXS ,I\RXKDYHDQ\TXHVWLRQVRUUHTXLUHIXUWKHULQIRUPDWLRQSOHDVHFRQWDFW-RH/RQJRDW -RVHSK-/RQJR#FRQRFRSKLOOLSVFRP RU*UHJ+REEVDW JUHJVKREEV#FRQRFRSKLOOLSVFRP 6LQFHUHO\FF 07 :HOO)LOH-HQQD7D\ORU $72 'DYH/HH$72 -RH/RQJR &KULV%ULOORQ $72 6WDII'ULOOLQJ(QJLQHHU $QG\0DFN .XXNSLN&RUS YDULDQFHRIWKHGLYHUWHUUHTXLUHPHQW Recommend approval upon the condition that surface hole is drilled with 10.5 to 11.5 ppg mud per the attached email from J. Longo dated 12/15/2022. SFD $OSLQH&VDQG 07 6DYHG 1RY MT7-97 Page 1 of 14 Printed: 10-Nov-22 07 :HOO3ODQ Application for Permit to Drill 7DEOHRI&RQWHQWV :HOO1DPH(Requirements of 20 AAC 25.005 (f)) /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) 3URSRVHG'ULOOLQJ3URJUDP 'LYHUWHUDQG%23,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) 0$63&DOFXODWLRQV 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV(Requirements of 20 AAC 25.005 ©(5)) &DVLQJDQG&HPHQWLQJ3URJUDP 'ULOOLQJ)OXLG3URJUDP Requirements of 20 AAC 25.005(c)(8)) $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) 'ULOOLQJ+D]DUGV6XPPDU\ 3URSRVHG&RPSOHWLRQ6FKHPDWLF 07 6DYHG 1RY MT7-97 Page 2 of 14 Printed: 10-Nov-22 :HOO1DPH(Requirements of 20 AAC 25.005 (f)) 7KHZHOOIRUZKLFKWKLVDSSOLFDWLRQLVVXEPLWWHGZLOOEHGHVLJQDWHGDV07 /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) /RFDWLRQDW6XUIDFH )6/ ):/6(6:6715(80 NAD27 Northings: 5915863 Eastings: 290079 RKB Elevation ¶$06/ Pad Elevation ¶$06/ 7RSRI3URGXFWLYH+RUL]RQ +HHO )6/ ):/6(6:67 15(80 NAD27 Northings:5912003 Eastings: 289252 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ 7RWDO'HSWK 7RH )6/ ):/6(6(67 15(80 NAD27 Northings: 5902445 Eastings: 293877 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ 3OHDVHVHHDWWDFKHGZHOOVWLFNGLDJUDPIRUWKHFXUUHQWSODQQHGGHYHORSPHQWRIWKHSDG 07 6DYHG 1RY MT7-97 Page 3 of 14 Printed: 10-Nov-22 Pad Layout Well Stick Diagram 07 6DYHG 1RY MT7-97 Page 4 of 14 Printed: 10-Nov-22 07 6DYHG 1RY MT7-97 Page 5 of 14 Printed: 10-Nov-22 3URSRVHG'ULOOLQJ3URJUDP 0,58'R\RQRQWRZHOORYHUSUHLQVWDOOHG´LQVXODWHGFRQGXFWRU,QVWDOOGLYHUWHUDQGIXQFWLRQWHVW 5LJXSDQGWHVWULVHUGHZDWHUFHOODUDVQHHGHG 'ULOO´KROHWRWKHVXUIDFHFDVLQJSRLQWDVSHUWKHGLUHFWLRQDOSODQ /:'3URJUDP *55(6 5XQDQGFHPHQWQHZ´VXUIDFHFDVLQJWRVXUIDFH5HVXOWVRIWKHFHPHQWRSHUDWLRQZLOOEHVXEPLWWHGDV VRRQDVSRVVLEOH ,QVWDOO%23(ZLWKWKHIROORZLQJHTXLSPHQWFRQILJXUDWLRQ ´DQQXODUSUHYHQWHU´[´9%5 EOLQGUDPDQG´[´9%5 7HVW%23(WRSVLORZSVLKLJK KUUHJXODWRU\QRWLFH 3LFNXSDQGUXQLQKROHZLWK´GULOOLQJ%+$WRGULOOLQWHUPHGLDWH /:'3URJUDP *55(6 &KDUWFDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFNDQG¶RIQHZKROH 3HUIRUP/27WRPD[LPXP(0:RISSJ0LQLPXP/27UHTXLUHGWRGULOODKHDGLVSSJ(0: 6HQGUHVXOWVWR$2*&&DVVRRQDVDYDLODEOH 'LVSODFHZHOOWRSSJ9HUVDFOHDQ2%0 'ULOO´KROHWRWKHFDVLQJSRLQW &LUFXODWHZHOOERUHFOHDQDQG322+ 6HQG2+ORJVWR$2*&&WRUHYLHZVKDOORZK\GURFDUERQEHDULQJVDQGVDVVRRQDVDYDLODEOH &KDQJHXSSHU9%5VWR ´VROLGERG\UDPV7HVWVDPHWRSVLORZSVLKLJK 5XQ ´LQWHUPHGLDWHFDVLQJWR7' 3XPSVLQJOHVWDJHFHPHQWMREWRLVRODWHWKHFDVLQJVKRHRU¶0'DERYHXSSHUPRVWK\GURFDUERQEHDULQJ ]RQH$QGVWDJHFHPHQWMREZLOOEHSHUIRUPHGWRLVRODWHUHVHUYRLUTXDOLW\VDQGLIH[LVWVDWVKDOORZHUGHSWK 6XEPLWUHVXOWVRIWKHFHPHQWRSHUDWLRQWR$2*&&DVVRRQDVSRVVLEOH 7KHUHLVSRWHQWLDOIRUWKHSUHVHQFHRIWKH7XVNVDQGZKLFKPD\EHK\GURFDUERQEHDULQJDQGUHTXLUHD VHFRQGVWDJHFHPHQWMREWRSODFHFHPHQW¶79'DERYHDQGEHORZWKHLQWHUYDO7KHUHTXLUHG HTXLSPHQWDQGFHPHQWSODQVDUHSUHSDUHGLIWKLVEHFRPHVQHFHVVDU\ &KDQJHXSSHU ´VROLGERG\UDPVWR´[´9%5V7HVW%23(WRSVL KUUHJXODWRU\ QRWLFH 3LFNXSDQGUXQLQKROHZLWK´[ ´GULOOLQJ%+$WRGULOOLQWHUPHGLDWH6LPRSV±SHUIRUP ´ DQQXOXV/27IOXVKDQGIUHH]HSURWHFWZLWKWKHEDOOPLOO &KDUWFDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFNDQG¶RIQHZKROH 3HUIRUP),7WRPD[SSJ(0:0LQLPXPUHTXLUHGWRGULOODKHDGLVSSJ(0: 'ULOO[ ´KROHWRVHFWLRQ7'ZLWK2%0 $VDQLGHQWLILHGFRQWLQJHQF\SODQ ,I&DVLQJ'ULOOLQJLVUHTXLUHGGXHWR*HRORJLF,QVWDELOLW\LQLQWHUPHGLDWH VHFWLRQUHIHUWREHORZVWHSV 3LFNXSDQGUXQLQKROHZLWKWKH´VWHHUDEOHGULOOLQJOLQHU3LFNXSDQGVWDELQ´SLORW%+$DVVHPEO\ /:'SURJUDP *55(6 5,+WRERWWRPZLWK´6'/RQ´GULOOSLSH 'ULOO´6'/KROHWRSURGXFWLRQFDVLQJSRLQWLQWRWKH$OSLQH&VDQGXVLQJ0DQDJHG3UHVVXUH'ULOOLQJ WRPDLQWDLQFRQVWDQWERWWRPKROHSUHVVXUHRQFRQQHFWLRQV /:'SURJUDP *55(6 'LVSODFHZHOOWRSSJ9HUVDFOHDQ2%0 2%0 SRWHQWLDOIRUWKHSUHVHQFHRIWKH7XVNVDQGZKLFKPD\EHK\GURFDUERQEHDULQJ 12-1/4” hole section will be drilled with water-base mud per email from J. Longo, Hilcorp, dated 11/28/2022. SFD 12/15/2022 07 6DYHG 1RY MT7-97 Page 6 of 14 Printed: 10-Nov-22 /DQG´OLQHUDW7''LVFRQQHFW6'/DQG322+WRVXUIDFHZLWKLQQHUVWULQJDQGSLORW%+$ 5XQLQKROHZLWKLQQHUVWULQJFHPHQWLQJ%+$6WDELQWROLQHU&LUFXODWHDQGFRQGLWLRQPXGLQ SUHSDUDWLRQIRUFHPHQWLQJ &HPHQW´OLQHUWRWRSRIOLQHU6HWOLQHUWRSSDFNHU&LUFXODWHH[FHVVFHPHQWIURPWRSRIOLQHU322+ OD\LQJGRZQ´GULOOSLSH &RQWLQXHWR6WHSEHORZ &LUFXODWHZHOOERUHFOHDQZDLWXSWRWULSSLQJ0:DQG322+ 3LFNXSDQGUXQLQKROHZLWKWKH´OLQHURQ´'3WRVHFWLRQ7' &LUFXODWHDQGFRQGLWLRQPXGLQSUHSDUDWLRQVIRUFHPHQWLQJ &HPHQW´OLQHUWRUHTXLUHG72&6HWOLQHUWRSSDFNHU&LUFXODWHH[FHVVFHPHQWIURPWRSRIOLQHU322+OD\LQJ GRZQ´GULOOSLSH6XEPLWUHVXOWVWR$2*&&DVVRRQDVSRVVLEOH &KDQJHRXWXSSHUUDPVWR´[´9%5 3LFNXS´'37HVW%23(WRSVLORZSVLKLJK KUUHJXODWRU\QRWLFH 3LFNXSDQG5,+ZLWK´GULOOLQJDVVHPEO\ /:'3URJUDP *5$]LPXWKDO5(6 &KDUWFDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHVDQGUHFRUGUHVXOWV 'ULOORXWDQGSHUIRUP),7WRSSJ(0:0LQLPXPDFFHSWDEOHOHDNRIIIRUGULOOLQJDKHDGLVSSJ (0: 'ULOO´KRUL]RQWDOKROHWR7' /:'3URJUDP *5$]LPXWKDO5(61HX'HQ &LUFXODWHWKHKROHFOHDQDQG322+ 5XQ´OLQHURQ´[´'3VHWOLQHUKDQJHUDQGWRSSDFNHU7HVWWRSVLFKDUWHG5HOHDVHIURPKDQJHU DQGGLVSODFHZHOOWR.:EULQH322+DQGOD\LQJGRZQ'3 5XQ´WXELQJZLWKSURGXFWLRQSDFNHU'+**/0VDQGODQGLQJQLSSOHV/RFDWHDQGVSDFHRXWWXELQJ 7HUPLQDWH7(&ZLUHDQGODQGWXELQJKDQJHU 7HVWWXELQJKDQJHUVHDOVIURPDERYHWRSVLIRUPLQV 'URSEDOODQGURG3UHVVXUHXSWRVHW717SURGXFWLRQSDFNHU 3UHVVXUHWHVWWXELQJWRSVLIRUPLQV7HVW,$WRSVLIRUPLQV6KHDU629 ,QVWDOO%39WHVWVDPHDQGWXELQJKDQJHUVHDOVIURPEHORZWRSVL 1LSSOHGRZQ%23WHUPLQDWH7(&ZLUH ,QVWDOOWXELQJKHDGDGDSWRU3UHVVXUHWHVWDGDSWRUWRSVL ,QVWDOONWUHHDQGWHVW 3XOO%39IUHH]HSURWHFW,$DQGWXELQJ 6HFXUHZHOO5LJGRZQDQGPRYHRXW 'LYHUWHUDQG%23,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) 3OHDVHUHIHUHQFH%23DQGGLYHUWHUVFKHPDWLFVRQILOHIRU'R\RQ 0$63&DOFXODWLRQV 7KHIROORZLQJSUHVHQWVGDWDXVHGIRUFDOFXODWLRQRIDQWLFLSDWHGVXUIDFHSUHVVXUH $63 GXULQJGULOOLQJRIWKLVZHOO &DVLQJ 6L]H LQ &VJ6HWWLQJ'HSWK 0'79' IW )UDFWXUH *UDGLHQW SSJ 3RUHSUHVVXUH SVL $63'ULOOLQJ SVL 07 6DYHG 1RY MT7-97 Page 7 of 14 Printed: 10-Nov-22 QD 352&('85()25&$/&8/$7,1*$17,&3$7('685)$&(35(6685( $63 $63LVGHWHUPLQHGDVWKHOHVVHURI VXUIDFHSUHVVXUHDWEUHDNGRZQRIWKHIRUPDWLRQFDVLQJVHDWZLWKDJDVJUDGLHQW WRWKHVXUIDFHRU IRUPDWLRQSRUHSUHVVXUHDWWKHQH[WFDVLQJSRLQWOHVVDJDVJUDGLHQWWRWKHVXUIDFHDVIROORZV $63 > )*[ @' :KHUH $63 $QWLFLSDWHG6XUIDFHSUHVVXUHLQSVL )* )UDFWXUHJUDGLHQWDWWKHFDVLQJVHDWLQOEJDO &RQYHUVLRQIURPOEJDOWRSVLIW *DVJUDGLHQWLQSVLIW ' WUXH9HUWLFDOGHSWKRIFDVLQJVHDWLQIW5.% 25 $63 )33± [' :KHUH )33 )RUPDWLRQ3RUH3UHVVXUHDWWKHQH[WFDVLQJSRLQW )33 [79' $63&$/&8/$7,216 'ULOOLQJEHORZ´FRQGXFWRU $63 > )*[ ±@' > [ ±@[ SVL 25 $63 )33± [' ± [ ¶ SVL 0LQLPXP0:QHHGHG SSJ 'ULOOLQJEHORZ´VXUIDFHFDVLQJ $63 > )*[ ±@' > [ ±@[ ¶ SVL 25 $63 )33± [' ± [ SVL 0LQLPXP0:QHHGHG SSJ 'ULOOLQJEHORZILUVW ´LQWHUPHGLDWHFDVLQJ $63 > )*[ ±@' > [ ±@[ SVL 25 $63 )33± [' ± [¶ SVL 0LQLPXP0:QHHGHG SSJ 'ULOOLQJEHORZ´SURGXFWLRQOLQHU 07 6DYHG 1RY MT7-97 Page 8 of 14 Printed: 10-Nov-22 $63 > )*[ ±@' > [ ±@[ SVL 25 $63 )33± [' ± [ SVL 0LQLPXP0:QHHGHG SSJ (B) data on potential gas zones; 7KHZHOOERUHLVQRWH[SHFWHGWRSHQHWUDWHDQ\JDV]RQHV (C) data concerning potential causes of hole problems such as abnormally geo-pressured strata, lost circulation zones, and zones that have a propensity for differential sticking; 3OHDVHVHH'ULOOLQJ+D]DUGV6XPPDU\ 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV(Requirements of 20 AAC 25.005 ©(5)) 'ULOORXWFDVLQJVKRHDQGSHUIRUP/27WHVWRU),7LQDFFRUGDQFHZLWKWKH$OSLQH/27),7SURFHGXUHWKDW &RQRFR3KLOOLSV$ODVNDKDVRQILOHZLWKWKH&RPPLVVLRQ &DVLQJDQG&HPHQWLQJ3URJUDP &DVLQJDQG&HPHQWLQJ3URJUDP Csg/Tbg OD (in) Hole Size (in) Weight (lb/ft) Grade Conn. Cement Program +:HOGHG&HPHQWHGWRVXUIDFHZLWK \GVVOXUU\ /+\G&HPHQWWR6XUIDFH /7 +\G¶79'RU¶0'ZKLFKHYHULVJUHDWHUDERYH KLJKHVWVLJQLILFDQWK\GURFDUERQEHDULQJ]RQH [ / 3+\G¶79'RU¶0'ZKLFKHYHULVJUHDWHUDERYH KLJKHVWVLJQLILFDQWK\GURFDUERQEHDULQJ]RQH /+\G8QFHPHQHWHGRSHQKROHOLQHUZLWKIUDFSRUWVDQGVZHOO SDFNHUV ´6XUIDFH&DVLQJUXQWR ¶0' ¶79'&HPHQW3ODQ &HPHQWIURP ¶0'WR ¶RIWDLO ZLWK'HHSFUHWH$GG V#SSJDQGIURP WRVXUIDFHZLWK SSJ'HHS&UHWH$VVXPHH[FHVVDQQXODUYROXPHLQSHUPDIURVWDQGH[FHVVEHORZWKHSHUPDIURVW ¶ 0' ]HURH[FHVVLQ´FRQGXFWRU /HDGVOXUU\IURP ¶0'WRVXUIDFHZLWK$UFWLF/LWH&UHWH#SSJ 7RWDO9ROXPH IW !V[RISSJ'HHSFUHWH$GG V#IWVN 7DLOVOXUU\IURP 0'WR ¶0'ZLWKSSJ'HHSFUHWH$GG V 7RWDO9ROXPH IW !V[RISSJ&ODVV*$GGV#IWVN 07 6DYHG 1RY MT7-97 Page 9 of 14 Printed: 10-Nov-22 ´,QWHUPHGLDWH&DVLQJUXQWR¶0' ¶79'&HPHQW3ODQ 3ULPDU\FHPHQWMREFRQVLVWVRIIWSSJWDLOVOXUU\DQGWRSRISSJOHDGVOXUU\LVGHVLJQHGWREHDW ¶0' ZKLFKLV¶0'RU¶79'DERYHWKHSURJQRVLVVKDOORZHVWK\GURFDUERQEHDULQJ]RQH$OELDQ6XE ,IDVKDOORZHU K\GURFDUERQ]RQHRISURGXFLEOHYROXPHVLVHQFRXQWHUHGZKLOHGULOOLQJDQGVWDJHFHPHQWMREZLOOEHSHUIRUPHGWRLVRODWH WKLV]RQH$VVXPHH[FHVVDQQXODUYROXPH /HDGVOXUU\IURP ¶0'WR ¶ZLWKSSJ&ODVV*$GG¶V 7RWDO9ROXPH IW !V[RI SSJ&ODVV*$GG V#IW VN 7DLOVOXUU\IURP¶0'WR¶0'ZLWKSSJ&ODVV*$GG V 7RWDO9ROXPH IW !V[RISSJ&ODVV*$GGV#IWVN ´,QWHUPHGLDWH&DVLQJUXQWR ¶0'¶79'&HPHQW3ODQ 7RSRIVOXUU\LVGHVLJQHGWREHDW ¶0'ZKLFKLV¶0'RU¶79'DERYHWKHSURJQRVLVVKDOORZHVWK\GURFDUERQ EHDULQJ]RQH$OSLQH'$VVXPHH[FHVVDQQXODUYROXPH 7DLOVOXUU\IURP ¶0'WR ¶0'ZLWKSSJ&ODVV*$GGV 7RWDO9ROXPH IW !V[RISSJ&ODVV*$GGV#IWVN 'ULOOLQJ)OXLG3URJUDP Requirements of 20 AAC 25.005(c)(8)) 6XUIDFH,QWHUPHGLDWH ,QWHUPHGLDWH 3URGXFWLRQ +ROH6L]HLQ[ &DVLQJ6L]HLQ 'HQVLW\33* ±±±± 39F3 <3 OE IW )XQQHO 9LVFRVLW\VTW ,QLWLDO*HOVOE IW 0LQXWH *HOV OE IW $3,)OXLG /RVV FF PLQ1&± 1$ +3+7)OXLG /RVV FF PLQQD ± S+ ± ± ± 6XUIDFH+ROH $IUHVKZDWHUGULOOLQJIOXLG .6, ZLOOEHXVHGIRUWKHVXUIDFHLQWHUYDO.HHSIORZOLQHYLVFRVLW\DWrVHFTWZKLOH GULOOLQJDQGUXQQLQJFDVLQJ5HGXFHYLVFRVLW\SULRUWRFHPHQWLQJ0DLQWDLQPXGZHLJKWSSJE\XVHRIVROLGV FRQWUROV\VWHPDQGGLOXWLRQVZKHUHQHFHVVDU\ Surface hole will be drilled with 10.5 to 11.5 ppg mud per the attached email from J. Longo dated 12/15/2022. SFD 12/15/2022 'HQVLW\ $IUHVKZDWHUGULOOLQJIOXLG \33* ±±±± 07 6DYHG 1RY MT7-97 Page 10 of 14 Printed: 10-Nov-22 ,QWHUPHGLDWH )UHVKZDWHUSRO\PHUPXGV\VWHP(QVXUHJRRGKROHFOHDQLQJE\SXPSLQJUHJXODUVZHHSVDQGPD[LPL]LQJIOXLG DQQXODUYHORFLW\0DLQWDLQPXGZHLJKWIURP SSJDQGEHSUHSDUHGWRDGGORVVFLUFXODWLRQPDWHULDO*RRG ILOWHUFDNHTXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFHRIORZGULOOVROLGV E\GLOXWLQJDVUHTXLUHG ZLOODOOEHLPSRUWDQWLQ PDLQWDLQLQJZHOOERUHVWDELOLW\ ,QWHUPHGLDWH 7KHLQWHUPHGLDWHKROHVHFWLRQZLOOEHGULOOHGZLWK2%0ZHLJKWHGWRSSJ(QVXUHJRRGKROHFOHDQLQJE\ PD[LPL]LQJIOXLGDQQXODUYHORFLW\7KHUHLVDVOLJKWSRWHQWLDOIRUORVWFLUFXODWLRQSDUWLFXODUO\DIWHUWKHUHVHUYRLULV SHQHWUDWHG(QVXUHDGHTXDWH/&0PDWHULDOLVDYDLODEOHRQORFDWLRQDQGLQWKHILHOGWRDGGUHVVDQ\H[SHFWHGORVVHV 0DLQWDLQPXGZHLJKWZLOOEHWDUJHWLQJ(0:XVLQJ03'*RRGILOWHUFDNHTXDOLW\KROHFOHDQLQJDQG PDLQWHQDQFHRIORZGULOOVROLGV E\GLOXWLQJDVUHTXLUHG ZLOODOOEHLPSRUWDQWLQPDLQWDLQLQJZHOOERUHVWDELOLW\1RWH 0DQDJHG3UHVVXUH'ULOOLQJ 03' ZLOOEHXWLOL]HGIRUDGGLQJEDFNSUHVVXUHGXULQJFRQQHFWLRQVWRPLWLJDWHVKDOH LQVWDELOLW\DQGF\FOLQJ 3URGXFWLRQ+ROH 7KHKRUL]RQWDOSURGXFWLRQLQWHUYDOZLOOEHGULOOHGZLWKZDWHUEDVHGPXGGULOOLQIOXLGZHLJKWHGWR SSJ03' ZLOOEHXVHGWRKROGEDFNSUHVVXUHNHHSLQJWKHZHOOG\QDPLFDOO\EDODQFHG 'LDJUDPRI'R\RQ0XG6\VWHPRQILOH 'ULOOLQJIOXLGSUDFWLFHVZLOOEHLQDFFRUGDQFHZLWKDSSURSULDWHUHJXODWLRQV $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) 1$$SSOLFDWLRQLVQRWIRUDQRIIVKRUHZHOO (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) (YLGHQFHRIERQGLQJIRU&RQRFR3KLOOLSV$ODVND,QFLVRQILOHZLWKWKH&RPPLVVLRQ 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) ,QFLGHQWDOIOXLGVGHYHORSHGIURPGULOOLQJRSHUDWLRQVRQZHOO07 ZLOOEHLQMHFWHGLQWRDSHUPLWWHGDQQXOXVRQWKH 07SDGRUKDXOHGWRWKH&ODVVGLVSRVDOZHOORQ&' 7KH07 VXUIDFHLQWHUPHGLDWHFDVLQJDQQXOXVZLOOEHIOXVKHGZLWKEEOVRIIUHVKZDWHUSULRUWRIUHH]H SURWHFWLQJZLWKGLHVHOWRa 79'6LJQLILFDQWK\GURFDUERQ]RQHVLQFOXGHRQO\WKH$OSLQHVDQGEDVHGRQSUH GULOOLQWHUSUHWDWLRQV 2QFH07 KDVEHHQGULOOHGDQGFRPSOHWHGFRQVLGHUDWLRQPD\EHJLYHQWRSHUPLWWKLVZHOOIRUDQQXODULQMHFWLRQ 03' ZLOOEHXVHGW :XVLQJ03' FRQVLGHUDWLRQPD\EHJLYHQWRSHUPLWWKLVZHOOIRUDQQXODULQMHFWLRQ ZDWHUEDVHGPXGG HGULOOHGZLWK2%0Z )UHVKZDWHUSRO\PHUPXGV\VWHP SSJ 07 6DYHG 1RY MT7-97 Page 11 of 14 Printed: 10-Nov-22 $QDSSOLFDWLRQIRU6XQGU\2SHUDWLRQVIRUPZLOOWKHQEHILOHG$QQXODUSXPSLQJRIIOXLGVRFFXUULQJGXHWR GULOOLQJRSHUDWLRQVSHUUHJXODWLRQ$$&FRXOGWKHQEHJLQRQFHSURSHUO\SHUPLWWHG$VVWDWHGDERYHDQ\ ]RQHVFRQWDLQLQJVLJQLILFDQWK\GURFDUERQVZLOOEHLVRODWHGSULRUWRLQLWLDWLQJDQQXODUSXPSLQJ7KHUHZLOOEHQR 86': VRSHQEHORZWKHVKRHRUSRWDEOHLQGXVWULDOZDWHUZHOOVZLWKLQRQHPLOHRIWKHUHFHLYLQJ]RQH5HIHUHQFHWKH HQFORVHGGLUHFWLRQDOGULOOLQJSODQIRURWKHUIRUPDWLRQPDUNHUVLQWKLVZHOO 6XUIDFHFDVLQJZLOOEHVHWQHDUWKHEDVHRIWKH&IRUPDWLRQDERYHWKH.7KHVH WKLFNVKDOHVDUHSDUWRI WKH&ROYLOOH*URXSDQGDUHNQRZQWRSURYLGHYHUWLFDOEDUULHUVWRIOXLGIORZLQRWKHUDUHDV 7KHPD[LPXPYROXPHRIIOXLGVWREHSXPSHGGRZQWKHDQQXOXVRIWKLVZHOOZLOOQRWH[FHHGEEOZLWKRXWWKH VSHFLILFSHUPLVVLRQRIWKH$2*&&)OXLGGHQVLWLHVZLOOUDQJHIURPGLHVHOWRDPD[LPXPRISSJIRUGULOOLQJ IOXLGZDVWHV8VLQJSSJIOXLGDQGWKHULJ¶VVSHFLILHGPD[LPXPSXPSLQJSUHVVXUHRISVLIRUDQQXODU LQMHFWLRQWKHPD[LPXPSUHVVXUHDWWKHVXUIDFHFDVLQJVKRHLVHVWLPDWHGE\ 0D[6KRH3UHVVXUH SSJ 6XUI6KRH79' SVL SSJ ¶ SVL SVL 3RUH3UHVVXUH SVL 7KHUHIRUH 'LIIHUHQWLDO ± SVL 7KHLQWHUQDOFDVLQJSUHVVXUHLVFRQVHUYDWLYHVLQFHIULFWLRQDOORVVHVZKLOHSXPSLQJKDYHQRWEHHQWDNHQLQWR FRQVLGHUDWLRQ7KHVXUIDFHDQGLQWHUPHGLDWHFDVLQJVWULQJVH[SRVHGWRWKHDQQXODUSXPSLQJRSHUDWLRQVKDYH VXIILFLHQWVWUHQJWKE\XVLQJWKHFROODSVHDQGEXUVWUDWLQJVOLVWHGLQWKHIROORZLQJWDEOH 2':W SSI *UDGH5DQJH&RQQHFWLRQ 7\SH&ROODSVHRI &ROODSVH%XUVWRI %XUVW ´/+\GSVL SVLSVLSVL ´/+\GSVLSVLSVLSVL 07 6DYHG 1RY MT7-97 Page 12 of 14 Printed: 10-Nov-22 'ULOOLQJ+D]DUGV6XPPDU\ 7REHSRVWHGLQ5LJ)ORRU'RJKRXVH3ULRUWR6SXG +ROH´&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ &RQGXFWRU%URDFK/RZ0RQLWRUFHOODUFRQWLQXRXVO\GXULQJLQWHUYDO :HOO&ROOLVLRQ/RZ)LUVWZHOORQ3DGWUDYHOLQJF\OLQGHUGLDJUDPV *DV+\GUDWHV/RZ,IREVHUYHG±FRQWUROGULOOUHGXFHSXPSUDWHVDQG FLUFXODWLQJWLPHUHGXFHPXGWHPSHUDWXUHV &OD\%DOOLQJ0HGLXP0DLQWDLQSODQQHGPXGSDUDPHWHUVDQGIORZUDWHV ,QFUHDVHPXGZHLJKWXVHZHLJKWHGVZHHSV UHGXFHIOXLGYLVFRVLW\FRQWURO523 $EQRUPDO3UHVVXUHLQ 6XUIDFH)RUPDWLRQV /RZ'LYHUWHUGULOOVLQFUHDVHGPXGZHLJKW6KDOORZ KD]DUGVWXG\QRWHGPLQLPDOULVN /RVW&LUFXODWLRQ0HGLXP5HGXFHSXPSUDWHVPXGUKHRORJ\DGGORVW FLUFXODWLRQPDWHULDOXVHRIORZGHQVLW\FHPHQW VOXUULHVSRUWFROODUFRQWUROSLSHUXQQLQJVSHHGV ´+ROH ´&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVWFLUFXODWLRQ/RZ5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDO +ROHVZDEELQJRQWULSV0HGLXP5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ03'VWULSSLQJSUDFWLFHV $EQRUPDO3UHVVXUHLQ 2YHUEXUGHQ)RUPDWLRQV /RZ:HOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVLQFUHDVHPXGZHLJKW6KDOORZKD]DUG VWXG\QRWHGPLQLPDOULVN +ROH&OHDQLQJ/RZ0RQLWRU(&'DQGWRUTXHGUDJWUHQGVFRQWUROGULOO DQGXVHEHVWKROHFOHDQLQJSUDFWLFHV [ ´+ROH´/LQHU&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ 6ORXJKLQJVKDOH7LJKW KROH +LJK03'IRUVKDOHVWDELOLW\6WHHUDEOH'ULOOLQJ/LQHU ,QFUHDVHPXGZHLJKWFRQWURO523FRQQHFWLRQDQG WULSVSHHGVVZHHSVDQGUHDOWLPHHTXLYDOHQW FLUFXODWLQJGHQVLW\ (&' PRQLWRULQJUXQFDVLQJDV OLQHU /RVWFLUFXODWLRQ/RZ5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDO +ROHVZDEELQJRQWULSV0HGLXP5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ/LQHUZLOOEHLQSODFHDW7' $EQRUPDO5HVHUYRLU 3UHVVXUH /RZ:HOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVLQFUHDVHPXGZHLJKW +\GURJHQ6XOILGHJDV/RZ+6GULOOVGHWHFWLRQV\VWHPVDODUPVVWDQGDUGZHOO +LJK 07 6DYHG 1RY MT7-97 Page 13 of 14 Printed: 10-Nov-22 FRQWUROSUDFWLFHVPXGVFDYHQJHUV ´+ROH´/LQHU+RUL]RQWDO3URGXFWLRQ+ROH (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVWFLUFXODWLRQ/RZ5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDO +ROHVZDEELQJRQWULSV0HGLXP5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ $EQRUPDO5HVHUYRLU 3UHVVXUH /RZ:HOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVLQFUHDVHGPXGZHLJKW 'LIIHUHQWLDO6WLFNLQJ/RZ8QLIRUPUHVHUYRLUSUHVVXUHDORQJODWHUDONHHSSLSH PRYLQJFRQWUROPXGZHLJKW +\GURJHQ6XOILGHJDV/RZ+6GULOOVGHWHFWLRQV\VWHPVDODUPVVWDQGDUGZHOO FRQWUROSUDFWLFHVPXGVFDYHQJHUV :HOO3UR[LPLW\5LVNV 07ZLOOEHDPXOWLZHOOSDGFRQWDLQLQJDQRULJLQDOSODQRIZHOOV'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFH LQIRUPDWLRQLVSURYLGHGLQWKHIROORZLQJDWWDFKPHQWV 'ULOOLQJ$UHD5LVNV 5HVHUYRLU3UHVVXUH 2IIVHWLQMHFWLRQKDVWKHSRWHQWLDOWRLQFUHDVHUHVHUYRLUSUHVVXUHRYHUSUHGLFWHG$OWKRXJKWKLVLV XQOLNHO\WKHULJZLOOEHSUHSDUHGWRZHLJKWXSLIUHTXLUHG :HDNVDQGVWULQJHUVFRXOGEHSUHVHQWLQWKHRYHUEXUGHQ/&0PDWHULDOZLOOEHDYDLODEOHWRVHDOLQORVVHVLQWKH LQWHUPHGLDWHVHFWLRQ /RZHU6KDOH6WDELOLW\ +5=.DOXELN0LOXYHDFKLQWKHSLORWDQGLQWHUPHGLDWHKROHVHFWLRQVZLOOUHTXLUHKLJKHU PXGZHLJKWVWKDQKLVWRULFDOO\XVHGWRHQKDQFHZHOOERUHVWDELOLW\0DQDJHG3UHVVXUH'ULOOLQJZLOOEHXVHGLQ FRQMXQFWLRQZLWKDVWULQJFDVLQJGHVLJQWRPLWLJDWHVKDOHLQVWDELOLW\LQWKHDIRUHPHQWLRQHGIRUPDWLRQV6WDQGDUG /&0PDWHULDODQGZHOOERUHVWUHQJWKHQLQJSLOOVDUHH[SHFWHGWREHHIIHFWLYHLQGHDOLQJZLWKORVWFLUFXODWLRQLI QHHGHG *RRGGULOOLQJSUDFWLFHVZLOOEHVWUHVVHGWRPLQLPL]HWKHSRWHQWLDORIWDNLQJVZDEEHGNLFNV \ DVWULQJFDVLQJGHVLJQW T 0DQDJHG3UHVVXUH'ULOOLQJZLOOEHXVHG 07 6DYHG 1RY MT7-97 Page 14 of 14 Printed: 10-Nov-22 3URSRVHG&RPSOHWLRQ6FKHPDWLF 07 BZS3ODQ6XPPDU\ 'RJOHJ6HYHULW\ 0HDVXUHG'HSWK 6XUIDFH ,17,17 $]LPXWKIURP1RUWK>@YV7UDYHOOLQJ&\OLQGHU6HSDUDWLRQ>XVIWLQ@ 07 073% 07 07 07 07 BZS 07 *07 ZS 07 07 7UXH9HUWLFDO'HSWK 9HUWLFDO6HFWLRQDW 6XUIDFH ,17,17 &HQWUHWR&HQWUH6HSDUDWLRQ 0HDVXUHG'HSWK 07 07 07 07 BZS07 BZS 07 07 07 (TXLYDOHQW0DJQHWLF'LVWDQFH '', 6859(< 352*5$0 'DWH 7 9DOLGDWHG <HV9HUVLRQ 'HSWK)URP 'HSWK 7R 6XUYH\3ODQ 7RRO 07 BZS 07 6',B.HHSHUB$'. 07 BZS 07 0:'2:6* 07 BZS 07 0:',)56$*06 07 BZS 07 0:',1&B21/< ,1&! 07 BZS 07 0:'2:6* 07 BZS 07 0:',)56$*06 07 BZS 07 0:',1&B21/< ,1&! 07 BZS 07 0:'2:6* 07 BZS 07 0:',)56$*06 07 BZS 07 0:',1&B21/< ,1&! 07 BZS 07 0:'2:6* 07 BZS 07 0:',)56$*06 6XUIDFH/RFDWLRQ 1RUWK (DVW *URXQG &$6,1* '(7$,/6 79' 0' 1DPH 6XUIDFH ,17 ,17 0DJ0RGHO 'DWH %**0 )HE 0DJQHWLF1RUWKLV(DVWRI7UXH1RUWK 0DJQHWLF'HFOLQDWLR 0DJ'LS )LHOG6WUHQJWK Q7 6(&7,21'(7$,/6 6HF 0' ,QF $]L 79' 16 (: 'OHJ 7)DFH 96HFW $QQRWDWLRQ )250$7,21723'(7$,/6 79'3DWK )RUPDWLRQ 3HUPDB)URVW & & & & . 6&3 $OELDQB $OELDQB $OELDQB $OELDQB $OELDQB 6XE$OELDQB $OELDQB $OELDQB 6XVLWQD +5= ,17 /&8 $OSLQHB' ,17 $OSLQHB& %\VLJQLQJWKLV,DFNQRZOHGJHWKDW,KDYHEHHQLQIRUPHGRIDOOULVNVFKHFNHGWKDWWKHGDWDLVFRUUHFWHQVXUHGLW VFRPSOHWHQHVVDQGDOOVXUURXQGLQJZHOOVDUHDVVLJQHGWRWKHSURSHUSRVLWLRQDQG,DSSURYHWKHVF DQDQGFROOLVLRQDYRLGDQFHSODQDVVHWRXWLQWKHDXGLWSDFN,DSSURYHLWDVWKHEDVLLV IRUWKHILQDOZHOOSODQDQGZHOOVLWHGUDZLQJV,DOVRDFNQRZOHGJHWKDWXQOHVVQRWLILHGRWKHUZLVHDOOWDUJHWVKDYHDIHHWODWHUDOWROHUDQFH 3UHSDUHGE\&KHFNHGE\$FFHSWHGE\$SSURYHGE\ 3ODQ# XVIW 2ULJLQDO:HOO(OHY 7UXH9HUWLFDO'HSWK XVIWLQ 9HUWLFDO6HFWLRQDW XVIWLQ 07 B/DQGLQJB5HY07 B7'B5HY 6XUIDFH,17,17 07 07 BZS6WDUW%XLOG6WDUW'/67)26WDUW KROGDW0'6WDUW KROGDW0'6WDUW'/67)26WDUWKROGDW0'6WDUW'/67)26WDUWKROGDW 0'6WDUW'/67)26WDUW'/67)26WDUW KROGDW0'7'DW 6HFWLRQ9LHZ3URMHFW :HVWHUQ1RUWK6ORSH6LWH *075HQGH]YRXV3DG:HOO 07 :HOOERUH 07 'HVLJQ 07 BZS 3ODQ9LHZ3URMHFW :HVWHUQ1RUWK6ORSH6LWH *075HQGH]YRXV3DG:HOO 07 :HOOERUH 07 'HVLJQ 07 BZS6RXWK 1RUWK XVIWLQ :HVW (DVW XVIWLQ 07 B7'B5HY 07 B/DQGLQJB5HY07073%070707070707$073%0707 07 07 07 6XUIDFH,17,1707 BZS !" " # $% &' & ' ! ( )* + !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 1 0 ( .+0 2 4 1 0.+02 3 , )0#( 03 , ) 4, ) 42# 5 6 7% 2 #$ ( # 2 #$$ #( ( ( " "" 5 0 " ,"+ , 3"+ "" 6"1 ' !"3 7 "3 (" *3 -. /% 8 "+ . # 443 46 4 9. 8 :.. 96, 86: 9 & & "" , 3"+ ,"+ 7 "3 ' !"3 879& 8'9 "" 6"1 ( +,* 449 46 4 6. & !7 *" 8 :.. 9, 86: 6 3 9 .3 9 . 9 & . "" :;< 5" 3! :< 0 . ." #3 :;< '03" ;--. .. .<<. . 6 . 3 4 6 ! / " #+"' . "3+1 7, /" " . !5 0:/.< :+ -< 8'9 :+ -< ."" :;< 879& :+ -< ". ! 9. 9 , )0#( 03 !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 . !5 0 :+ -< +*1 30 0$ '0+*1:& < . ! :+ -< . <3<. .. *+= += *= # = +1 !& 4 "- "- +1 !&4 .4 . ?*@ .?-? "-?*@ .?$? +1 !&.4 46 *,'+",7A!*,'B 8& *,'+",7A+@*77 !*,' +1 !& 46 46 6 "- "- +1 !& 46 64 ?*@ .?-? "-?*@ .?$? +1 !&64 34. . .9 *,'+",7A!*,'B 8& *,'+",7A+@*77 !*,' +1 !&34. . .34 "- "- +1 !&34 4 3 ?*@ .?-? "-?*@ .?$? +1 !&4 4 *,'+",7A!*,'B 8& *,'+",7A+@*77 !*,' +1 !&4 4 "- "- +1 !&4 4 ?*@ .?-? "-?*@ .?$? +1 !& 4 . 46 . !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 % "" :;< #)"0+! :;< 879& :+ -< 5 :;< 8'9 :+ -< + . ! :+ -< /" . ! :+ -< . 3 3 :;9+ -< =+" :;9+ -< + :;9+ -< " 3 6 39 3. 9. 9 6 . 3 3 .. 6 33 6.. 6 ... 39.46 .6. 3 . .46 9 3. 4 6 . 3 . 46 4 .6.4 94. .. 3 . 4 3 99 6 . .4.9. .4. .46 34. . 4.3 ...49 .463 9 34. . . 4.6 3.49 6 634 . 34.. . 9 6 . 99 3 . 4. 9 34.33 63 493 3 6 49 34. 63 4 96 . 43 3 34 63 43 .. . . 3 .64 3 .34 9 336 .336 93 4 3 . 664. . 34 6 6 .336 93 4. 3 . 9. . 64 346 3 4 64 4 9 334639 3 . 46 !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 + . ! :+ -< % "" :;< #)"0+! :;< 879& :+ -< /" " :+ -< . 3 3 :;9+ -< 8'9 :+ -< =+" :;9+ -< + :;9+ -< +*1 /" . ! :+ -< . . 6 6 6 9 6 . 9 . 9 6 39 9 9 9 69 9. 9 3. 3 3 6 6 9 . 6 . 3 9 6 . 9 . 6 . 33 3 3 9 . 3 . 3 3 3 6 . 9 4 3 6 6 63 9. . 6. 36 . 3 9 6 3. 4 9 . 9 4 9 9 . 6 3 6 9 9 . 63 4. 9 6 . 49 .. 9 . . 9. 66 6 . 4 9 . .. 4. 9 . . 9 . 46 3 . 3 4 6 9 9 3 . 6 9 3 6 4 6 .. 66 46 .3 3 6 . 3 6 49 . 93 .. 4 . 6 6 . . 3 9 . 6 9 6 4 6 .3 6 4933 6 9 9 . 9 . . 6 9 43 . . 3 436 6. . 6 . 3 6 . 9 . . 4 9. .. 6 43 .3 96 . 66 36 6 . . 9 . .4 .. . 6 4. .. . 9 . . .4 .6 6. . 3 .4 96 9 6 96 . 6 3 3 . 6 99 .46 9 . . 3 .46 .6 9 3 . . 39 6 .. . 6. 6 .4. . . 3 .46 9 6 . . 6 .4 . . 3 .4.6 9 3 .. 36 .46 . . 3 .4 6 96 .. .66 .6 .4 . . 3 .46. . 6 .9. . .96 96 .49 . . 3 .4 . . 96 9 .3 .4 . . 3 .49 6 . . 6 .43 . . 3 .49 6 .9. 9 . 3. .4 . . 3 .43 63 . 6 69 .. 4 . . 3 .43 . 99 66 3 99 9. 4 . . 3 .49 9. 6 9 6. 66 3 46 . . 3 4 6 9 3. 4. . . 3 4 9 36 9 3 6 6 4 . . 3 46 9 6 9 9 6. 3 46 . . 3 4. 3 66 9 9 . 663 . 4 . . 3 4 . 69 3 96 33 693 49 . . 3 46 9 93 936 .6 633 4 . . 3 4 9 6 3 .. 9 43 . . 3 49 9 9 9 9 . 3 4 . . 3 4939 3 . 3 64 . . 3 49 .6 9.3 3 93 64 . . 3 4399 9 . 39 6 64. . . 3 49 3 93 6 6 9 64 . . 3 64 69 6 . . . 9 9 646 . . 3 64 9 . 9. 9 64 . . 3 64..9 3 . 4 . 6 9. 649 . . 3 64 9 99 3 . 4 9 3 9. 64 . . 3 646 9 36. .. 4 9 643 . . 3 6469 3 3. 466 6 !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 + . ! :+ -< % "" :;< #)"0+! :;< 879& :+ -< /" " :+ -< . 3 3 :;9+ -< 8'9 :+ -< =+" :;9+ -< + :;9+ -< +*1 /" . ! :+ -< 64 . . 3 6439 3 . 43. 6 6 4 . . 3 6499 6 4.. . 6 4 . . 3 649 96 .6 4. 9 6 4. . . 3 643 3 6 6 4. 3 4 . . 3 646 4 . . 4 9 3 . 46 . . 3 4 .. 4 4 6 39 . 4 . . 3 4. . 4 39 . 46 39 49 . . 3 4. 9 49 9 46 6. 39 4 . . 3 4 6 46 .9 463 3 43 . . 3 4 4 9 4.3 6 4 . . 3 463 4. 3 . 499 3 94 . . 3 4 96 4. 3 49 6 39 3 6 94 . . 3 499 4.9 .3 496 .. 3 3 94. . . 3 4 3 4. 3 493 3 4 . 94 . . 3 436 3 4 .3 4 6 4 93 946 . . 3 4 . 4 9 43 4 9 3 94 . . 3 94 . 4 . 49 99 4 3 6 949 . . 3 943 9 46. 43 . 4 3 94 . . 3 94. 3 46. 43 3 4. . 943 . . 3 94.3 . 463. 3 4 6 46 99 94 . . 3 94 33 . 4 4 49. 9 4 . . 3 9463 6 46 3 433 6 43. 6 4 3 . . 3 94. . 4 6 .4 4 .6 4 .9 . 9493 46 . ..4 . . 4. . 3 6 . 4. . . . 949 6 49 3 39 . ..4 93 6 4.. 3 6 4 . . 9469 63 496 36 . ..4 4. . . 46 .3 6 9 943 6 6. 493 3 . ..4 4.6 3 9 4 9 . 94. 69 4.3 . ..4. 4.3 . 6. 49 .9 3 4 63 46 . ..4.9 9 4.9 99 . 3 4 . 36 3 4 . 43. .. . ..4 3 6 4. 9 . . 43 3 3 . 49 9 436 96 . ..4 9 9 4. 6 . 9 4 . 3 4.3 6 4.3 . ..46. 9 4. . 6 . 34 9 9 4 . 43 6 . ..46 9 4. 6 . 6 34 3 . 6 463 .4 66 33 . ..4 9 4.9 6 . .6 34. . 46 .4 9 39 . ..4. . 4.9. . . 34. . . 463 9 .4 3 .49 . 4.3 .. 34.. . 4 . .4 3 9 .49 6 63 4.6 3 34 6 9 93 46 .493 .4996 99 4. . . 6 . 9 346 6. 96 9 496 9 .4. 6 .3 .4. 36 4. . . 63 . 34 6 9 99 3 4. .4 .4 9 4..6 6 . . 349 6 6 96 96 4 .4 99 .439 36 4. 9 3 . . 6 34 6 9. 9 43 9 .46 .46 . 43 9 . 9 343 . 3 9 3 4 .4. 4 6 9 49 . 96 3. 34 9 4 . .49 9 4 4 . . 99 4 3 34 6 .496 493 4 . . . 9 9 4 9 6 9 34 3 33 .43 4.63 . 4 93 . . 4. 9 9 6 9. 34. . .4393 4 .3 36 4 .6 . . 6 4 99 6 .9 349 . .4 6 46 . 3 . 9 46 9 .6 34. 9 6 4 63 46. 6 63 . 4 9 34.6 46 6 4 . 6 . 9 .9 49 6 9 6 6 34.93 6 4. 6 3 493 . 3 9 . 9 .. 493 63 34.33 4 4. 9 3 . . 4 63 34.. 3 4 . . 46 6. 3 . 4 63 34. 4 3 9 49 3 6 !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 + . ! :+ -< % "" :;< #)"0+! :;< 879& :+ -< /" " :+ -< . 3 3 :;9+ -< 8'9 :+ -< =+" :;9+ -< + :;9+ -< +*1 /" . ! :+ -< 43 63 34 46 3 43 3 96 . 43 66 63 34 . 46. 3 . 43.6 6 6 3 . 4 6 34 6 3 43 9 . 4 6 . 3 . 3 4 3. 9 69 9 34 49 3 . 4 963 3 . 4 36 6 6 34 9. 9 4 3 93 . 64 . . . 9 . 9 4 3 36 93 6 .3 34 9 33 4. 6 . 64 3 . 3 . . 4. 36 93 6 .3 34 . 43 6 646 9 4. 36 93 6 .3 34 6 43 64. . . 6 4 3 6 3 34 3 6 433 33 . 64. 9 9 6 6 46 39 6 93 34 33 96 46 3 . 64 9. 6.6 6 9 4 3 . 6 3 34 6 6 64 9 . 646 6 . 3 9 49 33 . 3 34 3 643 . . 646 . .. 9 4 3 . 346 9 64.3 . 64 .9 9 9 9 4 3 346 64 36 . 64 . 9 9 43 3 346 .9 64 39 64993 3 . 6 4 3 346 . 64636 64 3 3 4 3 346 643 64369 4 3 346 33 6493 3 64 9 6 4. 3 346 6 643 6 4 . 6 4 3 346 9 643 46 .3 9 46 3 346 9 64 93 4. 3 6 96 4 3 346 3 4 9 .3 4.. 63 3 6 49 3 346 3 . 46 33 4 3 . 66 4 3 346 4. 6 46 9 3 43 3 346 4 . 4 .. . 4 3 346 3 46 99 4963 3 .93 9 .4 3 346 49 .9 4 9 6 .4 3 346. 9. 499 39 43. 9 6. .4. 3 346 499 6 49 9 6 6 3. .4 3 3466 439 94 .9 6 .. .46 3 346 . 49 9 94 6 6 9 .4 3 3469 . 94 9. .6 943 6 6 .49 3 346 949 36 94.. 39 6 .4 3 346 3 94. 6 94 9 96 9 3 .43 3 3463 6 94 3 946 6 9 . .4 3 346 9. 9469 9 94 36 .. 9 4 3 346. 6 94 .. 949.3 6 93 4 3 346. 949 3. 943 3 6 4. 3 346.. .6 94. 6. 943 33 4 3 346. . 943 9439 . 6 46 3 346. 946 9 943 6 4 3 346.6 3 4 63 . 4 6 6. 6 3 49 3 346. 6 469 3 49 . 4 6 3 4 3 346.9 9 4.6 6 4.. 9. 4 3 3 43 3 346. 6 4 6 4 6 4 3 4 3 346.3 9 466. 46 3 49 64 3 346. .6 46 4 4.. 64 3 346 49 3 49 4.9 64. 3 346 4 3 3 493 4 . 64 3 346 39 43 9 3 43 . 4 3 9 646 3 346 . 4 439 46 9 64 3 346 9 34 6 49 6 4663 9 649 3 346 6 63 34 . 34 6 6 466 9 64 3 346 9 34. 9 346 4 !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 + . ! :+ -< % "" :;< #)"0+! :;< 879& :+ -< /" " :+ -< . 3 3 :;9+ -< 8'9 :+ -< =+" :;9+ -< + :;9+ -< +*1 /" . ! :+ -< 643 3 346 9 . 34 . 9 34. . 9 43 64 3 346 346.3 34 . 3 49 4 3 346 3 34. 346 33 49 6 4 3 346 3 39 349. 346 3 4. 6 4. 3 346 34.6 6 343 3 499 6 4 3 3466 9 343.. 6 3493 43. 6 46 3 3466 63 34. 6 349 . 43 4 3 3466. 4 . 3439 4 . 49 3 3466 . 43 346 69 463 4 3 34666 4. . 4 6 9 4 43 3 34666 3 4 . 4. 99 .4 . 4 3 3466 3 466 . 4.. 9 .4 36 . 94 3 34669 4 4 3 .4. . 94 3 3466 9 49 4 .4 . 94. 3 34663 6 4 463 .4.. 94 3 3466 43 3 49 .4.99 946 3 346 .. 4 493 .6 .4 94 3 346 4 9 46 6 .4 9 949 3 346 4 6 9 43 9 66 .46 . 94 3 346. 3 4. . 4. .466 943 3 346 . 4 33 4 6 9 .46 94 3 3466 46 63 4 .4 3 6 4 3 346 6 46 3 4. 3 .43 3 4 3 3469 6 4 9 4.3 . .49. . 4. 3 346 .. 499 . 4 . .496 9 4 3 3463 46 3 469 . .4. 3 46 3 3463 43 69 46 .. .49 63 4 3 346 36 4. 9 49 3 .43 33 49 3 3469 . 4 99 4. 6 .439 . 4 3 3469 43 . 439 .4 9 43 3 3469. 69 4.3 3 4 9 .46 4 3 3469 6 4 39 66 46 .4. 6 34 3 34696 . 463 6 4 3 3 4 39 34 3 3469 43 96 4. 4 3 .9 34. 3 3469 9 493. . 4.9 4.3 99 34 3 34699 36 43 3 4 46 9 346 3 3469 43 6 466 4. 6 34 3 34693 43 . 4. . 4.96 3 349 3 3469 69 .4 9 9. 493 3 4 . 34 3 346 .4 .. 4 63 4 9 343 3 346 . .4. 3 49 3 46 6 34 3 346. 3 .4 . 6 433 9 4669 66 4 3 346. 9 .46 46 46 36 4 3 346 3 .49 9 .4 9 3 4 . 4. 3 3466 .4993 . .4. 43. 9 4 3 346 3 .499 .4.6. 9 49.3 46 3 3469 6 .439 .4 9 49 6 4 3 346 .49 .46. .9 43 3. 49 3 3463 . 4 9. 3 .4 496 .. 4 3 346 3 49 3 .43 6 43 9. 43 3 346 4. .493 43 . 4 3 3463 3 4 3 .49 9 4 6 . 4 3 3463 469 .439 6 46 3 . 4 3 3463. 3 4 9 .46 36 4 . !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 + . ! :+ -< % "" :;< #)"0+! :;< 879& :+ -< /" " :+ -< . 3 3 :;9+ -< 8'9 :+ -< =+" :;9+ -< + :;9+ -< +*1 /" . ! :+ -< . 4. 3 3463 6 496 9 4 6 6 64 9 9 . 4 3 34636 . 4. 9 4 6 64 3. . 46 3 3463 . 43 4... 64. 6 . 46 3 34639 46 . 4 9 3 64 3'0 !"90" 3 ! /. :+ -< ' !"3 :+ -< 7 "3 :+ -< 8'9 :+ -< 879& :+ -< . "33 , 3"+,"+ ." #3 :;< ." ."> :;< +7#$+ % 346 44 .6 46.4 .64 . 8: 6, 86:6. 9.6 )# $( # ++ % 34639 4 .4 46 46 . 4 9 64 83:. 99, 8 : 6 )# $( # /" . ! :+ -< + . ! :+ -< "3 ."0 :"< ? ."0 :"<'0 "3 " ( 4 6 3 4 6 9 *,463 934. . . 9. . . *,.34. 4 3 !" " , " -. !"#$# %&/. -' ( )# # *(+, 0 1 !"#$# %&. - , ) 2 ' ! --. /% " ##0 0' % +*1 + " ! & & +1 . "3 + . ! :+ -< /" . ! :+ -< ." ."" :;<'0 ,"! 31 ." :;< 5 0" 3 9 0+@ 4 39 6. '6 4 3 .9 46. ' 46 6 496 6 '. 4966 .4 . . ' 49 46 69 = 4 6 9 4 6 ' 4 6 3 43.3 C#+ 49.. 64 6 33 C#+9 43 64. 6 C#+64 . 9 643 C#+6649 6 4 63 C#+ 64 . 43 C C#+ 463 94 3 C#+.94. 3 9 946 93 C#+94.66 4.9 #94 9. 34 6 D 5469 .. 34. . . *,463 34 6 7'249 6 493 .. #+34.33 4 *,.34. 439 #+'34 .3 ! ! "#$ % &' %#$()*(#$()*(#$()*( + , - . /0"#$ % &' %)#$()*()#$()*()#$()*( + ,$ '1% ! 2 ' . 3! - 4 % 05*56 (1*!7, 51783( 9 :1*6;!597:,71; 4. < /0 =,*15 -3 / 8 '4 / 0 1 7*51 -1# %. 1 > 05 15?%0*8 % @ %1 A -- @ %1# 28 1 - !" #" $ $ $ 0 $ 0 %& - #$()*()#$()*( + , ! ) ! ). /=# %. 3 -4#. 3 -48 3 -4=# %. - A % @ %1 A -- @ %1# 28 1 - ! / 0 1 7*51 -1# %. 1$ '1% ! 2 ' . 3! - 4 - . /0"#$ % &' %)#$()*()#$()*()#$()*( + ,# %. 3 -4 ? %# /"#$ % &' %'() ")'() ")'() "* & % +,& %-&-+ +-&(" .,& .-+,& / )'() ")'() ")'() "* &"( " & , %-&(+ " & ."&,%+" & , )'() ")'() ")'() "(%&+. - +&%( ( &(. - %& "*&+%(- +&%(/ )'() ")'() "")'() ""* & % +,& %-&-+ +-&(" .,& .-+,& / )'() ")'() "")'() ""* &"( " & , %-&(+ " & ."&,%+" & , )'() ")'() "")'() ""(%&+. - +&%( ( &(. - %& "*&+%(- +&%(/ )'() )'() )'() (,&(" ",-&( (-&+( & %,&"".",-&( / )'() )'() )'() (,&(( .-&( (-& % & %"&+%% .-&( )'() )'() )'() .((&., +0* &- . (&"( +0*% & *&(, +0* &- / )'() +)'() +)'() +,,&,% +,& ,-&( +,&, -"&*+++,& / )'() +)'() +)'() +" & % "(+&- ,-&% "(%& %(&--."(+&- )'() +)'() +)'() + -(&"* 0+ (&(, (+&% 0 % & "& %( 0+ (&(,/ )'() .)' ) 1 .)'() ."" &+% "0 -&( " *& . "0 & "-&+(+"0 -&( / )'() .)' ) 1 .)'() ."" &.% "0 * &+ " *&"% "0 % & "(&-.%"0 * &+ )'() .)' ) 1 .)'() .*+*&-, +0*""& * %((&*% +0*(%& " &(%"+0*""& */ )'() %)'() %)'() %"+,&,, +,& "+-&(* +,&. "".&++(+,& / )'() %)'() %)'() %". &%- ,,& , "+-& " + & %,&+* ,,& , )'() %)'() %)'() %+ &"- 0.%*& * -,&(( 0+% & .&+*% 0.%*& */ )'() *)'() *)'() *"%,&-, +,& "%-&** +,&%% "+ &%-,+,& / )'() *)'() *)'() *"*"& % "0"+.&. "%.&. "0" %& .&+" "0"+.&. )'() *)'() *)'() *(%.&** +0%,(&-, *,+&." +0*(%& " &+ "+0%,(&-,/ )'() *)'() *)'() *"%,&-, +,& "%-&%% +,&%% "",&-(,+,& / )'() *)'() *)'() *"*"& % "0"+.&. "%.&+ "0" %& +&,"*"0"+.&. )'() *)'() *)'() *(. &% +0* %& % *(-&,. +0*(%& " & %+0* %& %/ )'() *)'() *)'() *2 +"%,&-, +,& "%-&** +,&%% "+ &%-,+,& / )'() *)'() *)'() *2 +"*"& % "0"+.&. "%.&.+ "0" %& .&+"""0"+.&. )'() *)'() *)'() *2 +(%+& , +0%,-&*- *,"&-" +0*(%& " & -,+0%,-&*-/ )'() *)'() *")'() *""%,&-, +,& "%-&** +,&%% "+ &%-,+,& / ) - #$()*()#$()*( + , ! ) ! ). /=# %. 3 -4#. 3 -48 3 -4=# %. - A % @ %1 A -- @ %1# 28 1 - ! / 0 1 7*51 -1# %. 1$ '1% ! 2 ' . 3! - 4 - . /0"#$ % &' %)#$()*()#$()*()#$()*( + ,# %. 3 -4 ? %# /'() *)'() *")'() *""*"& % "0"+.&. "%.&. "0" %& .&+" "0"+.&. )'() *)'() *")'() *"(%.&** +0%,(&-, *,+&." +0*(%& " &+ "+0%,(&-,/ )'() ()'() ()'() ("(,&,, +,& "(-&(( +,&. ".(& ,+,& / )'() ()'() ()'() ("- & , ,,& "(-&*% " & " .&- ,,& )'() ()'() ()'() (+ *&(+ 0 (+&. +"%&*+ 0"% & ,&. + 0 (+&. / )'() -)'() -)'() - .",,&,- % &" ",*&.. % & %*&% (% &" / )'() -)'() -)'() - . &", * & , ",*&"( * & .,&(*** & , )'() -)'() -)'() - .,* & - +0*""& % -,,&(" +0( %& "%&+((+0*""& %/ )'() ,)'() ,)'() , & " +,& "-&(, . &%" "(,&*,*+,& / )'() ,)'() ,)'() , &"( " +& , "-&*. " %& ".+&-- " +& , )'() ,)'() ,)'() ,+-+& % 0.%*&, +( & + 0+ %& -&,-+ 0.%*&, / )'()" )'()" )'()" 2 + +,&," % &"% +*&(. % & (%&*,"% &"%/ )'()" )'()" )'()" 2 + +,&,, %% &"* +*&*" %% & ("&" *%% &"* )'()" )'()" )'()" 2 +"0" -& * +0* +& , "0 **&%( +0(% & "-&+.*+0* +& ,/ )'(),%)'(),%)'(),%2 +,&,- +% & +(&.+ +% & "%&*((+% & / )'(),%)'(),%)'(),%2 . &." "0 .(&%- +.&, "0 % & (&+. "0 .(&%- )'(),%)'(),%)'(),%2 "0"+(&+( "-0.-,&,- *%(&-* %0-, & " &+( "-0.-,&,-/ )'(),*)'(),*)'(),*,&*% % &(. *&+ % %& &-(,% &(. )'(),*)'(),*)'(),* +(&* ,0"*-& - "% & ,0* %& &(" ,0"*-& -/ )'(),-)'(),-)'(),-"(&- .,,&.* ".&* % & %&%++.,,&.*/ )'(),-)'(),-)'(),-"(&-% % .&." ".&% % %& %&+**% .&." )'(),-)'(),-)'(),-"-&.. %(.& - ".&, %(%& %& " %(.& -/ )'(),-)'(),-)'(),-"(&- .,,&.* ".&* % & %&%++.,,&.*/ )'(),-)'(),-)'(),-"(&-% % .&." ".&% % %& %&+**% .&." )'(),-)'(),-)'(),-"-&.. %(.& - ".&, %(%& %& " %(.& -/ )'(),-)'(),-)'(),-2 ,",&-, . .&+ "*&-. . %& *&%"%. .&+ / )'(),-)'(),-)'(),-2 , & * % .& . "*&.- % %& %&*"+% .& . )'(),-)'(),-)'(),-2 , &"" *.-&-. "(&- *% & %&"%**.-&-./ )'(),,)'(),,)'(),,+%&%( - .&*, +"&( - %& ,& +*- .&*,/ )'(),,)'(),,)'(),,+%&*+ -.,&*, +"&** -% & -&,-%-.,&*, ) - #$()*()#$()*( + , ! ) ! ). /=# %. 3 -4#. 3 -48 3 -4=# %. - A % @ %1 A -- @ %1# 28 1 - ! / 0 1 7*51 -1# %. 1$ '1% ! 2 ' . 3! - 4 - . /0"#$ % &' %)#$()*()#$()*()#$()*( + ,# %. 3 -4 ? %# /'(),,)'(),,)'(),,"0","&"" 0.-%&(* (*,&- 0, %& &- ( 0.-%&(*/ )'(),,)'(),,)'(),,+%&%( - .&*, +"&( - %& ,& +*- .&*,/ )'(),,)'(),,)'(),,+%&*+ -.,&*, +"&** -% & -&,-%-.,&*, )'(),,)'(),,)'(),,"0","&"" 0.-%&(* (*,&- 0, %& &- ( 0.-%&(*/ ) 3 "()' 4 +) %)' )4 +)' +-&*" +*.&% +*& +% & ".&(**+*.&% / ) 3 "()' 4 +) %)' )4 +)' 715* 6*61,()6617 ( 1 1,5 6*61,( A A B) 3 "()' 4 +) %)' )4 +)' 51( *,1*)1 17( 1((* *,1*8 A B) 3 "()' 4 *)" .)' )4 *)' ,(& %--& - ,.& ( %(%& +"& %*%--& - ) 3 "()' 4 *)" .)' )4 *)' "0"%,&* ,0",%&( "0 *,& ( ,0+(%& " &- *,0",%&( / ) 3 "()' 4 () +)' )4 ()' ""-&%, +*.&% ""%&,( +% & .%&+"*+*.&% / ) 3 "()' 4 () +)' )4 ()' ""-&- %".&". ""%&%, % & +(& ".%".&". ) 3 "()' 4 () +)' )4 ()' ,( & +0%,%&,. ,",&(- +0- & ",& ..+0%,%&,./ ) 3 "()' 4 -)" +)' )4 -)' "+-&.+ .*.&"% "+%&** .% & .,&,,".*.&"%/ ) 3 "()' 4 -)" +)' )4 -)' "+-&.* %"+&-" "+%&%. % & .(&+"+%"+&-" ) 3 "()' 4 -)" +)' )4 -)' "0+((&(+ +0*" &,( "0+ &+% +0- %& "-& (%+0*" &,(/ ) 3 "()' 4 ,) )' )4 ,)' "%-&%, +*.&% "%%&,( +% & * &%,.+*.&% / ) 3 "()' 4 ,) )' )4 ,)' "%-&(- %".& * "%%&%( % & .,&.* %".& * ) 3 "()' 4 ,) )' )4 ,)' "0.%(&+" +0* %&-* "0. -&-- .0 %& + & , +0* %&-*/ ) 3 "()' 4" )" )' )4" )' "(-&%- +".&% "(*&+ + & (,& -++".&% / ) 3 "()' 4" )" )' )4" )' "(-&*, +-,&.. "(*&"% +(%& ( &.% +-,&.. ) 3 "()' 4" )" )' )4" )' "0*-+& - +0* "&- "0* .&"- +0,(%& "&++++0* "&- / ) 3 "()' 4"") ")' )4"")' )",-&%, +*.&% ",%&,( +% & (%&-(++*.&% / ) 3 "()' 4"") ")' )4"")' )",-&(( %"+&,- ",%&%* % & *"&,".%"+&,- ) 3 "()' 4"") ")' )4"")' ) -&%+ "0" .&(* +& , "0" %& +,&(-."0" .&(*/ ) 3 "()' 4" )" ")' )4" )' "-&%- +".&% "*&+" + & ,*&+%%+".&% / ) 3 "()' 4" )" ")' )4" )' "-&(" +*.&% "*& . +% & --&-%-+*.&% ) 3 "()' 4" )" ")' )4" )' 0 ,-&" +0*" &+ 0 *&+ .0 %& ,& (+0*" &+ / ) 3 "()' 4"+) ")' )4"+)' +-&"* ---&"+ ++&(" -(%& %+&% "---&"+/ ) 3 "()' 4"+) ")' )4"+)' +-& + ,+*&(- ++&%* , %& % &,.*,+*&(- ) 3 "()' 4"+) ")' )4"+)' --&*% "0++%&+% -"&," "0+(%& . &- *"0++%&+%/ ) - #$()*()#$()*( + , ! ) ! ). /=# %. 3 -4#. 3 -48 3 -4=# %. - A % @ %1 A -- @ %1# 28 1 - ! / 0 1 7*51 -1# %. 1$ '1% ! 2 ' . 3! - 4 - . /0"#$ % &' %)#$()*()#$()*()#$()*( + ,# %. 3 -4 ? %# / 3 "()' 4".) )' )4".)' ) %-&%- +".&% %*& + & " ,&%".+".&% / ) 3 "()' 4".) )' )4".)' ) %-&-" .-,& % %%&( .(%& -+&"++.-,& % ) 3 "()' 4".) )' )4".)' )+ &. "0++"& * +"%&( "0+(%& .-&"*%"0++"& */ ) 3 "()' 4"%) +)' )4"%)' ) (-&%- +".&% (*& + & ""(&-, +".&% / ) 3 "()' 4"%) +)' )4"%)' ) (-&(% .".&+" (%&-, . & ,(&% %.".&+" ) 3 "()' 4"%) +)' )4"%)' )+%*& . "0+ *&-% +.,&%, "0+(%& %+&*"-"0+ *&-%/ ) 3 "()' 1"")"" )' ) 1 "")' %,&(% %*.&,. %*& " %% & (+&.*%%*.&,./ ) 3 "()' 1"")"" )' ) 1 "")' %,&(% %-,&,. %*&"( %(%& ( &+(,%-,&,. ) 3 "()' 1"")"" )' ) 1 "")'+-.&% 0" .&-+ +(%&.+ "0,% & . &. " 0" .&-+/ ) 3 "()' 1" ) " )' ) 1" )' (,&-( .*.&- (*&(( .% & , & +*.*.&- / ) 3 "()' 1" ) " )' ) 1" )' (,&,. %".&,+ (*&* % & -.&"%(%".&,+ ) 3 "()' 1" ) " )' ) 1" )'"0 ",&%+ +0%,%&+, "0"* & +0( %& "& - +0%,%&+,/ ) 3 )'()/")'()/")'()/" "+",&*. "0.+"&+" +""&%* "0. %& +,&%%-"0.+"&+" ) 3 )'()/")'()/")'()/" "+.*& % "0*" &*( ++*&,. "0*% & +(& "0*" &*(/ ) 3 )'()/ )'()/ )'()/ " ("&(" "0.- &". *+&+( "0.(%& + &%-*"0.- &". ) 3 )'()/ )'()/ )'()/ " -,&"+ "0* +& * (,&-. "0*% & +"&"++"0* +& */ ) - #$()*()#$()*( + , A 3 -4$3 -4 ' C ' $+,& "0 & '(),(2 + 25 25"0 & 0 & '(),(2 + '11 0 & +0".+&"( '(),(2 + '1! ! !' +0".+&"( +0%.+&"( '(),(2 + '1)4/24674/8" 9:+0%.+&"( .0 & '(),(2 + '11 .0 & -0 & " '(),(2 + '1! ! !' -0 & " -0% & '(),(2 + '1)4/24674/8" 9:-0% & ,0 & '(),(2 + '11 ,0 & ,0(+ &,, '(),(2 + '1! ! !' ,0(+ &,, ,0,+ &,, '(),(2 + '1)4/24674/8" 9:,0,+ &,, " 0% & '(),(2 + '11 " 0% & 0.,%& '(),(2 + '1! ! !' 3 ; <= ) & ; > &/ ; ; $ &/ ? $ #7 $ ) :& @ > > & ; ; @' 3;3/; < ; 3& - #$()*()#$()*( + ,/ = 3 A ",-+0 B C .&/ ' )"% & 90 / < @ ; $ )"&%,9&D < E"+,&% ; $7 @ 1 <:&4 @ @ <'(),(& *% "+ ",% / / 7*% ; $# : +% ( " % ". "(% ' ; 7+% ; $# : 3 "()' 4".) 0' )4".0' ) "D 3 "()' 4 () +0' )4 (0' ) + "D'() -0'() -0'() - .D '() (0'() (0'() (D '() "0'() ""0'() ""D '() "0'() "0'() "D 3 "()' 4"+) "0' )4"+0' ) " "D'() +0'() +0'() +D 3 "()' 4"%) +0' )4"%0' ) + "D 3 "()' 4 -)" +0' )4 -0' )" + "D'() 0'() 0'() D '() ,0'() ,0'() ,D 3 )'()/ 0'()/ 0'()/ "D '() .0' ) 1 .0'() .D 3 "()' 4"") "0' )4""0' ) " "D 3 "()' 4" )" 0' )4" 0' )" "D'(),%0'(),%0'(),%2 D 3 "()' 1" ) " 0' ) 1" 0' ) " "D'(),,0'(),,0'(),,D '()" 0'()" 0'()" 2 +D 3 "()' 1"")"" 0' ) 1 ""0' )"" " 3 "()' 4 *)" .0' )4 *0' )" . "D'() *0'() *0'() *D '() *0'() *0'() *D '() *0'() *0'() *2 +D '() *0'() *"0'() *"D 3 "()' 4" )" "0' )4" 0' )" " "D'(),-0'(),-0'(),-D / < ;4 $ & - #$()*()#$()*( + , A 0# %. ' 3 4A & "& % &% +&(%%& *& %(&% -&(%" & 7 &% # : "(% +% % % ( -(% " % " % ". "%(% "(% ", % " ' ; 7+% ; $# :4 3 / ; ' / = B33 @ 3 "()' 4".) 0' )4".0' ) "D 3 "()' 4 () +0' )4 (0' ) + "D '() -0'() -0'() - .D '() (0'() (0'() (D '() "0'() ""0'() ""D '() "0'() "0'() "D 3 "()' 4"+) "0' )4"+0' ) " "D'() +0'() +0'() +D 3 "()' 4"%) +0' )4"%0' ) + "D 3 "()' 4 -)" +0' )4 -0' )" + "D '() 0'() 0'() D '() ,0'() ,0'() ,D 3 )'()/ 0'()/ 0'()/ "D '() .0' ) 1 .0'() .D 3 "()' 4"") "0' )4""0' ) " "D 3 "()' 4" )" 0' )4" 0' )" "D '(),%0'(),%0'(),%2 D 3 "()' 1" ) " 0' ) 1" 0' ) " "D'(),,0'(),,0'(),,D '()" 0'()" 0'()" 2 +D 3 "()' 1"")"" 0' ) 1 ""0' )"" "D 3 "()' 4 *)" .0' )4 *0' )" . "D '() *0'() *0'() *D '() *0'() *0'() *D '() *0'() *0'() *2 +D '() *0'() *"0'() *"D 3 "()' 4" )" "0' )4" 0' )" " "D '(),-0'(),-0'(),-D !" ! " #$% & ' & $%()*( $%()*( +$%()*( , - . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- $ 0+ # 2 0+ 3 $ 5 + 02 0+2 3 / 1 $/ 3 4 42 - 5 6 7 ) 2( % 2(( - % + 6 0+ . & + .4& + 7 + " 4+ 4+ # & 4 + + , - .)$- !"8 &+ !,## "4 "4"3#!##$% 46 #4#9,!##$% #!##$% #8 #:,,!96 " 86 : 9! ! ! .4& + . & + 4+ " 4+ 89)! 8"9) 7 # &. + #!##$% #!##$% "4 "49#! $% 46 #4 "!6,$% ##!"#$% ! & +#!##$% #8 #:,,!"9 " 86 : 6!3#9 ! 2 :;< 6 & 4 :%< 0 2 2 4 :;< $& " 0 $ 4 ;++ ,#,, ,< <,#, 6!,# 3#! " "4 # !6 +1 + &" + 2 4 0# 7 1 + 2 6 0:%12< :/< 8"9) :/< 2 :;< 89)! :/< % 2 + !## 9,!9##!###!## !## 6 0 :/< % 4 0 2 %" 0 :! < % :/< 2 #< 3<,#,, 1= 1= 1= $- 1= > ! !## 4###!## 0# & * 1' + ' + 1 -- 4###!## ,4###!## 0# & * 1?@ ,? +? ' + 1?@ ,? (? $ ,4###!## 4 6 ! 0# & * 1 ' 7A& B #8* 1 ' 7A@77 & B #8* 4 6 ! 4"6 ! 0# & * 1' + ' + 1 -- 4"6 ! 64###!## 0# & * 1?@ ,? +? ' + 1?@ ,? (? $ 64###!## 34,#,!, 0# & * 1 ' 7A& B #8* 1 ' 7A@77 & B #8*34,#,!, 34"##!## 0# & * 1' + ' + 1 --34"##!## 4###!## 0# & * 1?@ ,? +? ' + 1?@ ,? (? $ 4###!## 4 #! 0# & * 1 ' 7A& B #8* 1 ' 7A@77 & B #8*4 #! 4 #! 0# & * 1' + ' + 1 --4 #! #4"##!## 0# & * 1?@ ,? +? ' + 1?@ ,? (? $ #4"##!## ,#46"!## 0# & * . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- % 4 0 0 %" 0 :! < 2 #< 3<,#,, 2 % :/< 2 6 0 :/< 1= 1= 1= $- 1= 0# & * !## 4###!## 1' + ' + 1 -- 0# & *, 4###!## ,4###!## 1?@ ,? +? ' + 1?@ ,? (? 0# & * ,4###!## 4 6 ! 1 ' 7A& B #8* 1 ' 7A@77 & 0# & *6 4 6 ! 4"6 ! 1' + ' + 1 -- 0# & *" 4"6 ! 64###!## 1?@ ,? +? ' + 1?@ ,? (? 0# & *9 64###!## 34,#,!, 1 ' 7A& B #8* 1 ' 7A@77 & 0# & *34,#,!, 34"##!## 1' + ' + 1 -- 0# & *3 34"##!## 4###!## 1?@ ,? +? ' + 1?@ ,? (? 0# & *4###!## 4 #! 1 ' 7A& B #8* 1 ' 7A@77 & 0# & * #4 #! 4 #! 1' + ' + 1 -- 0# & * 4 #! #4"##!## 1?@ ,? +? ' + 1?@ ,? (? 0# & * , #4"##!## ,#46"!## =4& $ & 2 :/< :/< > :/< '0 :;< :;< . :/< > :/< 1 :/< > :/< $ 4& /> :/< 0)0 0)0 3 :/< :/< '0 :;< % & 1 2 :/< !## #!## #!## !## #!## #!###!## #!###!## #!## #!## #!###!## #!## 2 1@ 1 ##!## #!## #!## ##!## ,! # #!###! #!###! 6 #!## #!## #!###! 6 #! 1= 1=& * ,##!## #!## #!## ,##!## ,! # #!###! 6 #!###! 3 #!## #!## #!###! 3 #! 6 1= 1=& * ##!## #!## #!## ##!## ,! # #!###!"" #!###!9, #!## #!## #!###!9, #!"" 1= 1=& * #!## #!## #!## #!## ,! #!###!9 #!###! #!## #!## #!###! #!9 1= 1=& * 6##!## #!6" #!## 6##!## ,! , #!###!3 #!###!3 #!## #!## 33!#!39 #!9 1= 1=& * "##!## !" #!## 6! ,! #!###! #!## !# #!## #!## 3,!"" !# #! 1= 1=& * 9##!## !6" #!## "!39 ,! " #!## !,# #!## ! #!## #!## 3!63 ! ! 3 1= 1=& * . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- =4& $ & 2 :/< :/< > :/< '0 :;< :;< . :/< > :/< 1 :/< > :/< $ 4& /> :/< 0)0 0)0 3 :/< :/< '0 :;< % & 1 2 :/< 9,#!## !" #!## 9 !3, ,! " #!## !,6 #!## ! " #!## #!## !6 ! 3 !,, 1= 1=& * ##!## 6!" #!## 9!" ,! #!## !6 #!## !"6 #!## #!## "!36 !"9 !6# 1= 1=& * 3##!## 9!6" #!## !# ,!6# #!## !96 #!## ! #!## #!## 6!3, !3# !9, 1= 1=& * ##!## !" #!## 33! # ,!6 #!## !33 #!##,!## #!## #!## "! ,!#6 !3 1= 1=& * ,#!## 3!," #!## 3! # ,!66 #!## ! #!##,!#" #!## #!## "! ,!# !, 1= 1=& * 4###!## !# 3! 6 !6# ,!63 #!##,! 9 #!##,!,, #!## #!## !#",!,3 ,! 1= 1=& * 4 ##!## 9!#" ,!9 4#9!9 ,!" #!##,! 6 #!##,! # #!## #!## 3!3,!6# ,!,9 1' +&,* 4,##!## 9!#6 , !" 4 9!,, ,!"3 #!##,!6 #!##,! #!## #!## 3"!,,!63 ,! 1' +&,* 4 ##!## 9! ," !,, 4,"!" ,!9 #!##,!9 #!##,!6 #!## #!## 3!,,!9" ,!66 1' +&,* 46##!## 3!" , 3! 4 6!9 ,!9 #!##,!36 #!##,!9, #!## #!## 36!, ,!# ,!9# 1' +&,* 4"##!## #!"6 ,,!66 46 !,3 ,!" #!## ! " #!##,!3" #!## #!## ! , !, ,!3 1' +&,* 49##!## ,!93 ,, !# 4" !, ,!3 #!## !"" #!## ! #!## #!## 9! !99 !#" 1' +&,* 4##!## 6! , 3!6" 4933! 6 ,!3 #!##6!#3 #!## ! #!## #!## 9 !"6!, ! 1' +&,* 43##!## !," , "!#3 436!6, ,!6 #!##6! #!## !9 #!## #!## ""!""6!3 !9 1' +&,* 4##!## !9, , ,!6 43!,3 !#, #!##"!" #!##6!# #!## #!## "#!"6"!9" !" 1' +&,* ,4###!## ,,!# , #!6" 4,!" ! # #!##9!6 #!##6! 6 #!## #!## 69!"#9!"9 6!, 1?@ ,? +? & * ,4 ##!## ,6!6, ,#3! ,4#96!9" !# #!##9!3 #!##6!" #!## #!## 6"! 3! " 6!"3 1?@ ,? +? & * ,4 "6!9 ,"!" ,#3!## ,4 6!,6 ! #!##!#3 #!##6!" #!## #!## 6"!# !, 6!9 1?@ ,? +? & * ,4,##!## ,"!" ,#3!## ,4 "6! ! " #!##! #!##6!" #!## #!## 66!9 ! 6!9 1?@ ,? +? & * ,4 ##!## ,"!" ,#3!## ,4,6"!#9 !,6 #!##!6 #!##6!" #!## #!## 6 !"9!96 6!# 1?@ ,? +? & * ,46##!## ,"!" ,#3!## ,4 "! ! " #!##!3# #!##6!9 #!## #!## 6,!6!9 6!3# 1?@ ,? +? & * ,4"##!## ,"!" ,#3!## ,46,"!,# !69 #!##3! 9 #!##6!3 #!## #!## 6 ! 3! 6!, 1?@ ,? +? & * ,49##!## ,"!" ,#3!## ,4" "!, !" #!##3!"9 #!##6!9 #!## #!## 6#! 93!# "!#9 1?@ ,? +? & * ,4##!## ,"!" ,#3!## ,49#"! 6 !, #!##3! #!##"! #!## #!## ! 3! "!,, 1?@ ,? +? & * ,43##!## ,"!" ,#3!## ,49"!6 !39 #!##!6" #!##"! #!## #!## 3!63!"9 "!6# 1?@ ,? +? & * ,4##!## ,"!" ,#3!## ,43"!63 6!## #!##! #!##"!"6 #!## #!## !99 #!#, "!9# 1?@ ,? +? & * 4###!## ,"!" ,#3!## ,43"!"" 6! " #!## #!6, #!##"! #!## #!## 9! #!" "!3 1?@ ,? +? & * 4 ##!## ,"!" ,#3!## ,49"!9, 6! #!## #! #!##9!#, #!## #!## 9!, !# 9!# 1?@ ,? +? & * 4 6 ! ,"!" ,#3!## 4##6!"# ! !#6 !#9 #!##9!#3 #!## ! " "! ! "!" 1 ' 7A& B #8*&6* 4,##!## ,"!" ,#3!## 4#""!9 ! " !#3 ! " #!##9!#3 #!## !,# "!6 !6, "!9 1 ' 7A& B #8*&6* 4 ##!## ,"!" ,#3!## 4 6"!9 ! 3 ! " "!#9 #!##9! #!## !, !9" "!# 9!#9 1 ' 7A& B #8*&6* 46##!## ,"!" ,#3!## 4, "!3 !, !,,,"!69 #!##9! #!## ! " ,! 6,"!69 9! " 1 ' 7A& B #8*&6* 4"##!## ,"!" ,#3!## 4 ,"!# !,9 !,6,! 3 #!##9!," #!## !66 ,3!6#6,! 3 9!, 1 ' 7A& B #8*&6* 49##!## ,"!" ,#3!## 46 "! 6!3 #!##",! , #!##9! # #!## #!## ,3!,",! , 9!63 1' +&"* 4##!## ,"!" ,#3!## 4"#9!#6 6!" #!##",!, #!##9! #!## #!## ,3! #",!, 9!", 1' +&"* 43##!## ,"!" ,#3!## 4"9! # "!# #!##",!63 #!##9!6# #!## #!## ,3! ,",!6 9!9# 1' +&"* 4##!## ,"!" ,#3!## 4939! "!,# #!##",! #!##9!" #!## #!## ,3! "",!, 9!9 1' +&"* 64###!## ,"!" ,#3!## 49!,6 "! 6 #!##",! #!##9!96 #!## #!## ,3! ",!3 9!3, 1' +&"* 64 ##!## ,"!" ,#3!## 4399! "!6 #!##" ! " #!##9!, #!## #!## ,3! 3" ! " 9!# 1?@ ,? +? &9* 64,##!## ,"!" ,#3!## 4"9! 3 "!" #!##" !, #!##9!" #!## #!## ,3! " !, 9!6 1?@ ,? +? &9* 64 ##!## ,"!" ,#3!## 64#69!6" "! #!##" ! #!##9! #!## #!## ,3!6#" ! 9! 1?@ ,? +? &9* 646##!## ,"!" ,#3!## 64 9!", "!36 #!##" !6# #!##9!3" #!## #!## ,3!6#" !6# !#9 1?@ ,? +? &9* 64"##!## ,"!" ,#3!## 64,,9!" "!3 #!##" !"# #!##9!6 #!## #!## ,3!6 " !"# ! " 1?@ ,? +? &9* 649##!## ,"!" ,#3!## 64 9!99 9! , #!##" !9 #!##!#6 #!## #!## ,3!6," !9 !,9 1?@ ,? +? &9* 64##!## ,"!" ,#3!## 646#9! 9!, #!##" !, #!##! 9 #!## #!## ,3!6," !, ! 3 1?@ ,? +? &9* 643##!## ,"!" ,#3!## 6469!3# 9!6 #!##" !3" #!##! #!## #!## ,3!6 " !3" !" 1?@ ,? +? &9* 64##!## ,"!" ,#3!## 64"39!3 9!" #!##" !3 #!##!69 #!## #!## ,3!6 " !3 !99 1?@ ,? +? &9* "4###!## ,"!" ,#3!## 6499!6 9!" #!##"6! #!##!96 #!## #!## ,3!6 "6! !3, 1?@ ,? +? &9* "4 ##!## ,"!" ,#3!## 649!# 9!, #!##"6!,9 #!##!3 #!## #!## ,3!66"6!,9 ! 1?@ ,? +? &9* "4,##!## ,"!" ,#3!## 643"!#3 ! # #!##"6!6 #!##3!# #!## #!## ,3!66"6!6 3! 3 1?@ ,? +? &9* "4 ##!## ,"!" ,#3!## 646! " !,3 #!##"6!" #!##3!,6 #!## #!## ,3!6""6!" 3! 3 1?@ ,? +? &9* "46##!## ,"!" ,#3!## "4# !,, !69 #!##"6!6 #!##3!6 #!## #!## ,3!6""6!6 3!"3 1?@ ,? +? &9* "4"##!## ,"!" ,#3!## "4 ,!, !9" #!##"6! #!##3! #!## #!## ,3!6""6! 3!3# 1?@ ,? +? &9* "49##!## ,"!" ,#3!## "4, ! 9 !36 #!##""!# #!##3!9 #!## #!## ,3!6"""!# !# 1?@ ,? +? &9* . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- =4& $ & 2 :/< :/< > :/< '0 :;< :;< . :/< > :/< 1 :/< > :/< $ 4& /> :/< 0)0 0)0 3 :/< :/< '0 :;< % & 1 2 :/< "4##!## ,"!" ,#3!## "4 #!6 3!# #!##""!,3 #!##!, #!## #!## ,3!69""!,3 !,9 1?@ ,? +? &9* "43##!## ,"!" ,#3!## "4 !"# 3!, #!##""!63 #!##!63 #!## #!## ,3!69""!63 !"# 1?@ ,? +? &9* "4##!## ,"!" ,#3!## "463!" 3!6 #!##""!93 #!##!" #!## #!## ,3!69""!93 !" 1?@ ,? +? &9* 94###!## ,"!" ,#3!## "4"!96 3!96 #!##""!3 #!## #!# #!## #!## ,3!69""!3 #!# 1?@ ,? +? &9* 94 ##!## ,"!" ,#3!## "499! 3!36 #!##"9! # #!## #! , #!## #!## ,3!69"9! #!, 1?@ ,? +? &9* 94,##!## ,"!" ,#3!## "4"!3 !#9 #!##"9! #!## #!9 #!## #!## ,3!69"9! #!" 1?@ ,? +? &9* 94 ##!## ,"!" ,#3!## "436!3" !, #!##"9!"9 #!## #! #!## #!## ,3!69"9!"9 #!3 1?@ ,? +? &9* 946##!## ,"!" ,#3!## "4 !, !6 #!##"9! #!## !, #!## #!## ,3!69"9! !#3 1?@ ,? +? &9* 94"##!## ,"!" ,#3!## 94#,! ! #!##"!# #!## !", #!## #!## ,3!69"!#6 ! 1?@ ,? +? &9* 949##!## ,"!" ,#3!## 94 3!#9 ! #!##"!,3 #!## !3 #!## #!## ,3!69"!,3 !9" 1?@ ,? +? &9* 94##!## ,"!" ,#3!## 94,#3! #! 9 #!##"!"6 #!## ,! " #!## #!## ,3!69"!"6 !6 1?@ ,? +? &9* 943##!## ,"!" ,#3!## 94,3!,# #! 3 #!##"!3# #!## ,!6 #!## #!## ,3!69"!3# ,!,6 1?@ ,? +? &9* 94##!## ,"!" ,#3!## 94 33!, #!9 #!##"3!# #!## ,! #!## #!## ,3!69"3!# ,!" 1?@ ,? +? &9* 4###!## ,"!" ,#3!## 9463! 6 #!3" #!##"3! 6 #!## ! , #!## #!## ,3!6""3! 6 ,!3 1?@ ,? +? &9* 4# 3! ,"!" ,#3!## 94" ,!, #!6 #!##"3!66 #!## !," #!## #!## ,3!6""3!6" ,!" 1?@ ,? +? &9* 4 ##!## ,9! ,#"! 94"93! !#3 #!##"3!"6 #!## !, #!## #!## ,3!6""3!9, ! 6 1?@ ,? +? &9* 4,##!## ,!## ,# !,# 949"!6 ! , #!##"3!69 #!## "! 3 #!## #!## ,3!6 "3! !66 1?@ ,? +? &9* 4 ##!## ,!, ! # 9469!63 !"9 #!##"3! 9 #!## ! #!## #!## ,3!6#"!,# !" 1?@ ,? +? &9* 46##!## ,3!6 !9" 943 6!6, !3# #!##"!9 #!## !,9 #!## #!## ,3! 6"!" 6!#9 1?@ ,? +? &9* 4"##!## #!#9 #!, 94, !69 ,!#" #!##"!#" #!##, ! 3 #!## #!## ,3!,"!3, 6! 1?@ ,? +? &9* 49##!## !,9 3!#" 4##!63 ,!, #!##"9! #!##, ! #!## #!## ,3! 9#! 6!9 1?@ ,? +? &9* 4##!## ,!" 36!#3 4#,! ,!"6 #!##""!"9 #!##,"!,, #!## #!## ,3!#39#!6" 6!3 1?@ ,? +? &9* 43##!## !3 3 ! , 4 9!#9 ,! #!##"6!" #!##,9!39 #!## #!## ,!99#!3 "!, 1?@ ,? +? &9* 4##!## "!, 3!" 4,"3!6 !#" #!##" !6 #!##,3!, #!## #!## ,!3,9 ! "!9# 1?@ ,? +? &9* 34###!## 9! 9! " 4 ! , ! # #!##" ! 6 #!##,!", #!## #!## ,!99 !66 "!, 1?@ ,? +? &9* 34 ##!## 3!, 6! 46 3!# !"9 #!##",! 9 #!## #!"" #!## #!## ,!69 ! 9!, 1?@ ,? +? &9* 34 ",!, !## !## 46"!"# !# #!##" ! #!## !# #!## #!## ,! 9 ! 9!6# 1?@ ,? +? &9* 34,#,!, !## !## 463! 9 !3 #!##",! 3 #!## ! # #!## #!## ,!,9,! 6 9!" 1?@ ,? +? &9* 34,",!, !## !## 4" !, 3!" 9!,9",!, #!## ! " #!## 3!#" ,! 9,! 3 "!3" 1 ' 7A& B #8*&* 34 ##!## 6#! 9 !93 4"6!#" 3!"3 9! ," !" #! , !6" #! 3! 6 ,!,9,!6 "!, 1 ' 7A& B #8*&* 346##!## 6,!96 9! 496!#9 3!9# 9!69" !## #! " !3, #!" 3! , ,9!""9,! 9!9 1 ' 7A& B #8*&* 34"##!## 6"! 9 99!3 4, ! ! 6 #!6" ! #!6" !39 #!, #!3" ,"!69 !3 ! , 1' +&3* 349##!## 6!6 96!96 4#!# !,3 #!6"#!63 #!6 !9" #! #!3" ,"! #96!6 !66 1' +&3* 34##!## "#! 6 9,!9 43""!"9 !6, #!6"#!#6 #!6 ! #! #!3" ,6!69"!#, ! 1' +&3* 343##!## ",!3 9#!3" 4 !" !"3 #!66!3, #! #!", #! #!3" ,6!#99"!9 ,#! 6 1' +&3* 34##!## ""!9" "! " 4"!, !" #!66!39 #! ,!9 #! #!3" , !,699!66 ,#!9 1' +&3* 4###!## "3! "!"" 34# #!6# !,, #!66!"9 #! ",3!9# #!, #!3" ,,!39! , !,3 1?@ ,? +? &* 4 ##!## 9 !#6 "9!#" 34#3#!33 ! # #!663!3 #! 6,! , #! #!3" ,,!9"9! , !66 1?@ ,? +? &* 4,##!## 9 !9 "6!9, 34 ,!, !6# #!663! 9 #! ,,"!# #!# #!3" ,,!6#9!" , !9 1?@ ,? +? &* 4 ##!## 99!6 " !,9 34 9!, !6 #!66!9# #! ,6! #!93 #!3" ,,! #9!3, , ! 1?@ ,? +? &* 46##!## 9!,6 " !" 34,#9!6 !" #!66! " #!,,,! #!9 #!3" , !"93! # ,,! 6 1?@ ,? +? &* 4"##!## ! "#!9 34,6#! !# #!669! #!,3, ! #!9" #!3" , ! 993! ,,!3 1?@ ,? +? &* 49##!## 6!9 6!6 34,93!6 !3 #!669!"6 #!,9 !"9 #!9, #!3" ,#! 93! , ! 1?@ ,? +? &* 493#! !## 63!"# 34,33!"# ! #!669!6 #!," 3! #!9# #!3" ,#!" 93!3 , !3# 1?@ ,? +? &* 4##!## !## 63!"# 34,,!3 ! #!669!"9 #!," 3! #!9# #!3" ,#!6,9!#6 , !, 1?@ ,? +? &* 4 #! !## 63!"# 34,!" !", ,!3 69!9 #!," 3! 6 #!9# ! !399!,9 ,,!", 1 ' 7A& B #8*& #* 43#! !## 63!"# 34 !## !", ,!3669! #!," 3! " #!9# #!#6 !3 9!, ,,!" 1 ' 7A& B #8*& #* 43##!## !66 63! 34 "!,# !" ,!3"69!9 #!,3 3!#" #!93 #!# !3 9!,3 ,,!9 1 ' 7A& B #8*& #* 4##!## !" 6! 34 6!3 !" ,!3369!3 #!6" 9!" !# #!,# ! 9!"3 ,6!# 1 ' 7A& B #8*& #* #4###!## 3,!#9 69! 9 34 "#! ,!3 ! 363! # #!", "!, !,3 !" 3!6#!6" ,!, 1' +& * #4 ##!## 36! 6"!6 34 9,!9 ,!" ! 36! # #!" 6!,# !,9 !" ! !, ,!" 1' +& * #4 ! 3 36!93 6"!,3 34 9 !33 ,!9 ! 36!,6 #!" 6!#3 !," !" !, ! " ,3!#3 1' +& * #4,##!## 36!93 6"!,3 34 !, !#" ! 3"#!3 #!" 6! 9 !," !" 9!#6,! ,!# 1' +& * #4,"!# 36!93 6"!,3 34 !6# ! ! 3",! #!" 6!, !," !" "! ",!, ,! 1' +& * . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- =4& $ & 2 :/< :/< > :/< '0 :;< :;< . :/< > :/< 1 :/< > :/< $ 4& /> :/< 0)0 0)0 3 :/< :/< '0 :;< % & 1 2 :/< #4 ##!## 3"! 6"!3 34 3 !#6 !,# ! 3" !" #!", 6! , !," !" 6!"# ! 9 #! 9 1' +& * #46##!## 39! 6!93 34 33!96 ! ! 3"! #!"6 !" !, !" ,!6! !3 1' +& * #4"##!## 3!, 6! 3 34 6!6# !6" ! 3"! #!" ! !,, !" !""! 3 ,!" 1?@ ,? +? & ,* #49##!## 33!, " !#3 34 3! !6 ! 39 ! #!" !9 !,# !" !66"!" ,!9 1?@ ,? +? & ,* #4##!## 3! " ",! 346##! 9 !"# ! 39,! #!9 !" ! !" ! #"!33 !,# 1?@ ,? +? & ,* #4 !" 3!"# " !## 346##!"# !"# ! 39 !, #!9, !" ! !" !#""! !, 1?@ ,? +? & ,* #43##!## 3!"# " !## 346# !,9 !"6 ! 39 !, #!9, !" ! !" #!,9!,3 !69 1?@ ,? +? & ,* #4##!## 3!"# " !## 346#,! !9 ! 396! " #!9, !9 ! !" #! ,9! !9 1?@ ,? +? & ,* 4###!## 3!"# " !## 346# !# !93 ! 39"!# #!9, !# ! !" !33! 6!#3 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346# !33 ! ! 39"!" #!9, ! ! !" !6 !99 6!6, 1?@ ,? +? & ,* 4,##!## 3!"# " !## 346#6!" !33 ! 399!", #!9, !# ! !" 3!,3! 3 6! 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346#"!9 6!## ! 39! #!9, 6!#, ! !" 3!6#3! "! 3 1?@ ,? +? & ,* 46##!## 3!"# " !## 346#9!"# 6! ! 393! #!9, 6! " ! !" !3"! "!" 1?@ ,? +? & ,* 4"##!## 3!"# " !## 346#! 3 6!,3 ! 39!#3 #!9, 6!, ! !" !,3!, 9!# 1?@ ,? +? & ,* 49##!## 3!"# " !## 346#3!," 6!66 ! 3#!# #!9, 6!6" ! !" 9!#3#!"9 9!66 1?@ ,? +? & ,* 4##!## 3!"# " !## 346#! 6!9 ! 3#! #!9, 6!9, ! !" 9!#3 !, 9!33 1?@ ,? +? & ,* 43##!## 3!"# " !## 346 #!## 6! ! 3 ! #!9, 6!3# ! !" "!63 !6 ! , 1?@ ,? +? & ,* 4##!## 3!"# " !## 346 #!3 6!3 ! 3 !# #!9, "!## ! !" 6!363,!93 ! 1?@ ,? +? & ,* ,4###!## 3!"# " !## 346 !" "! ! 36!#3 #!9, "!,# ! !" 6! 3 !66 3!, 1?@ ,? +? & ,* ,4 ##!## 3!"# " !## 346 ,!9, "!6 ! 3"! #!9, "!6, ! !" !"636!,6 3!93 1?@ ,? +? & ,* ,4,##!## 3!"# " !## 346 !"# "!9 ! 39! # #!9, "!9" ! !" ,!333"!# ! 6 1?@ ,? +? & ,* ,4 ##!## 3!"# " !## 346 6! "!3 ! 3!69 #!9, "!33 ! !" ,!, 3"!6 !" 1?@ ,? +? & ,* ,46##!## 3!"# " !## 346 "!," 9! , ! 33!96 #!9, 9! ! !" !"639!3 6#!#6 1?@ ,? +? & ,* ,4"##!## 3!"# " !## 346 9! , 9! ! 3!3" #!9, 9! 3 ! !" #!33!" 6#!63 1?@ ,? +? & ,* ,49##!## 3!"# " !## 346 !## 9!9 ! 33 !#3 #!9, 9!96 ! !" #!, 33! 6#!, 1?@ ,? +? & ,* ,4##!## 3!"# " !## 346 !3 9! ! 33,! 6 #!9, 9! ! !" !""3!9 6 ! " 1?@ ,? +? & ,* ,43##!## 3!"# " !## 346 3!6 ! 3 ! 33 !9 #!9, ! ! !" 3!3#!# 6 ! 1?@ ,? +? & ,* ,4##!## 3!"# " !## 346 !9, !6 ! 336! #!9, !63 ! !" 3!,6 !6 6,! 1?@ ,? +? & ,* 4###!## 3!"# " !## 346,#!6 !9 ! 339!, #!9, ! ! !" !",!3 6,!" 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346, ! 3!#9 ! 33!" #!9, 3!# ! !" 9!9 ! 6,! 1?@ ,? +? & ,* 4,##!## 3!"# " !## 346,,!,6 3! ! 333! #!9, 3! 3 ! !" 9! 6"!# 6 ! 3 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346, ! , 3!93 ! 3#! #!9, 3!9 ! !" "! 9! 3 6 !9 1?@ ,? +? & ,* 46##!## 3!"# " !## 346, ! !## ! 3 !# #!9, !# ! !" "! ! " 66! , 1?@ ,? +? & ,* 4"##!## 3!"# " !## 346,6!3 ! ! 3 ! #!9, ! ! !" 6!"63!"" 66!63 1?@ ,? +? & ,* 49##!## 3!"# " !## 346,"!6 !9" ! 36!" #!9, !99 ! !" !! 66!3 1?@ ,? +? & ,* 4##!## 3!"# " !## 346,9!9 ! ! 3"! #!9, ! ! !" !6 # !#, 6"! 1?@ ,? +? & ,* 43##!## 3!"# " !## 346,!6 ,#! ! 3!6 #!9,,#! ! !" ,!3 #,!,3 6"!"# 1?@ ,? +? & ,* 4##!## 3!"# " !## 346,3! 9 ,#!9 ! 33!# #!9,,#!9 ! !" ,! 6 # !" 6"!3 1?@ ,? +? & ,* 64###!## 3!"# " !## 346,!,6 , !#, ! 3 ##! 3 #!9,, !#, ! !" !3 #6!33 69! 6 1?@ ,? +? & ,* 64 ##!## 3!"# " !## 346 #! , ! ! 3 # !3 #!9,, ! ! !" ! #9!,# 69!66 1?@ ,? +? & ,* 64,##!## 3!"# " !## 346 #! , !, ! 3 # ! #!9,, !, ! !" #!36 #!"" 69!6 1?@ ,? +? & ,* 64 ##!## 3!"# " !## 346 !39 ,,!#3 ! 3 #6!3 #!9,,,!#3 ! !" #! #3! 6!# 1?@ ,? +? & ,* 646##!## 3!"# " !## 346 ,! ,,!66 ! 3 #9!6 #!9,,,!66 ! !" 9!, #!, 6! 1?@ ,? +? & ,* 64"##!## 3!"# " !## 346 !9 ,,!3 ! 3 #!" #!9,,,!3 ! !" 9!63 !9 6!"3 1?@ ,? +? & ,* 649##!## 3!"# " !## 346 6!63 , ! 3 ! 3 #!"# #!9,, ! 3 ! !" 9!#" ! 6!36 1?@ ,? +? & ,* 64##!## 3!"# " !## 346 "! 9 , !"" ! 3 !#" #!9,, !"" ! !" 93!96 6!"6 63! # 1?@ ,? +? & ,* 643##!## 3!"# " !## 346 9!, , !, ! 3 ,!9, #!9,, !, ! !" 93!,6 "!3 63! " 1?@ ,? +? & ,* 64##!## 3!"# " !## 346 ! ,6! # ! 3 6! #!9,,6! # ! !" 9!3" !66 63!" 1?@ ,? +? & ,* "4###!## 3!"# " !## 346 !3 ,6!93 ! 3 "!3 #!9,,6!93 ! !" 9!63 3! 63!3 1?@ ,? +? & ,* "4 ##!## 3!"# " !## 346 3!39 ,"!#9 ! 3 ! #!9,,"!#9 ! !" 9! , ,#! 6!#9 1?@ ,? +? & ,* "4,##!## 3!"# " !## 346 ! ,"!6" ! 3 3! #!9,,"!66 ! !" 99! , !3 6!, 1?@ ,? +? & ,* "4 ##!## 3!"# " !## 3466#!9# ,"!3 ! 3 ,#!" #!9,,"!3 ! !" 99!6 , !6# 6!" 1?@ ,? +? & ,* "46##!## 3!"# " !## 3466 !63 ,9!,, ! 3 ,,! #!9,,9!,, ! !" 99! # ,6!, 6!, 1?@ ,? +? & ,* "4"##!## 3!"# " !## 3466,! " ,9!9 ! 3 , !3 #!9,,9!9 ! !" 9"! ,9!6" 6! 1?@ ,? +? & ,* . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- =4& $ & 2 :/< :/< > :/< '0 :;< :;< . :/< > :/< 1 :/< > :/< $ 4& /> :/< 0)0 0)0 3 :/< :/< '0 :;< % & 1 2 :/< "49##!## 3!"# " !## 3466 !, ,!# ! 3 ,"!6 #!9,,!## ! !" 9"!6 ,! "#! 6 1?@ ,? +? & ,* "4##!## 3!"# " !## 34666! # ,!6# ! 3 ,!#9 #!9,,!6# ! !" 9"! ,!"6 "#! 6 1?@ ,? +? & ,* "43##!## 3!"# " !## 34666!3 ,!3# ! 3 ,3!# #!9,,! ! !" 96! ! # "#!"6 1?@ ,? +? & ,* "4##!## 3!"# " !## 3466"!3" ,3!,# ! 3 #! " #!9,,3! ! !" 96!9 ,!9 "#! 1?@ ,? +? & ,* 94###!## 3!"# " !## 34669! ,3!9# ! 3 ,!## #!9,,3!" ! !" 96! 6!," "#!, 1?@ ,? +? & ,* 94 ##!## 3!"# " !## 3466!9# ,!## ! 3 !9" #!9,,3! ! !" 96! "!36 " ! # 1?@ ,? +? & ,* 94,##!## 3!"# " !## 34663!6 ,!6# ! 3 "! , #!9,,!6# ! !" 9 !39 !6 " !,3 1?@ ,? +? & ,* 94 ##!## 3!"# " !## 3466! " ,!3 ! 3 9!3 #!9,,!3# ! !" 9 !9, !#6 " !69 1?@ ,? +? & ,* 946##!## 3!"# " !## 346"#!,, #!, ! 3 3!9" #!9, #!, ! !" 9 ! 6#!9" " !9 1?@ ,? +? & ,* 94"##!## 3!"# " !## 346" ! # #!9, ! 3 6#! #!9, #!9 ! !" 9 ! 6,!,9 " !3# 1?@ ,? +? & ,* 949##!## 3!"# " !## 346" ! !# ! 3 6,!# #!9, !#, ! !" 9,!" 6 !3 " ! 1?@ ,? +? & ,* 94##!## 3!"# " !## 346",!3" !66 ! 3 6 !9 #!9, !6 ! !" 9,!6 6"!", ",! 1?@ ,? +? & ,* 943##!## 3!"# " !## 346" !, !3" ! 3 6"! 3 #!9, !36 ! !" 9,!" 6! 9 ",! # 1?@ ,? +? & ,* 94##!## 3!"# " !## 346"6!" ,!,9 ! 3 6!#3 #!9, ,!,9 ! !" 9,! 6 63!3# ",!69 1?@ ,? +? & ,* 4###!## 3!"# " !## 346""!6 ,!93 ! 3 63! #!9, ,!9 ! !" 9,! " "#!6" ",!9 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346"9! 6 !# ! 3 "#!6 #!9, !#3 ! !" 9 !9 ",! # ",! 1?@ ,? +? & ,* 4,##!## 3!"# " !## 346"!,, !" ! 3 ",! 3 #!9, !"# ! !" 9 !3 " ! ",!, 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346"3!# ! ! 3 " !3 #!9, !, ! !" 9 !9 ""!6 " !# 1?@ ,? +? & ,* 46##!## 3!"# " !## 346"3! 6! 6 ! 3 ""!9# #!9, 6! ! !" 9 !66 "! # " !,, 1?@ ,? +? & ,* 4"##!## 3!"# " !## 346"!36 6!9 ! 3 "! #!9, 6!" ! !" 9 !,3 "3!3 " ! 1?@ ,? +? & ,* 49##!## 3!"# " !## 3469#!, "! 3 ! 3 "!# #!9, "! ! !" 9 ! , 9#!69 " !" 1?@ ,? +? & ,* 4##!## 3!"# " !## 3469 !" "!9# ! 3 9#!" #!9, "!" ! !" 9#! 9,! 6 " !99 1?@ ,? +? & ,* 43##!## 3!"# " !## 3469,!69 9!#, ! 3 9,!6 #!9, 9!# ! !" 9#!3, 9 !3 " !3# 1?@ ,? +? & ,* 4##!## 3!"# " !## 3469 ! 6 9!66 ! 3 96!,# #!9, 9!6 ! !" 9#!9 9"!", " !6 1?@ ,? +? & ,* 34###!## 3!"# " !## 34696!, 9!3 ! 3 9"! #!9, 9!39 ! !" 9#!" 9!,, "6!#3 1?@ ,? +? & ,* 34 ##!## 3!"# " !## 3469"!# !, ! 3 9!99 #!9, !,3 ! !" 9#!6# 93!, "6!, 1?@ ,? +? & ,* 34,##!## 3!"# " !## 3469"!9 ! ! 3 9!6# #!9, !# ! !" 9#!,9 #!9 "6! " 1?@ ,? +? & ,* 34 ##!## 3!"# " !## 34699!36 3! 6 ! 3 ! 6 #!9, 3! ! !" 9#! 6 ,! 6 "6!63 1?@ ,? +? & ,* 346##!## 3!"# " !## 3469! 3!" ! 3 ,!33 #!9, 3!"9 ! !" 9#!# 6!#" "6!9, 1?@ ,? +? & ,* 34"##!## 3!"# " !## 34693!" 3! ! 3 6!9, #!9, 3!3 ! !" "!3 "!9 "6!" 1?@ ,? +? & ,* 349##!## 3!"# " !## 3469!69 !6, ! 3 9! 9 #!9, !6 ! !" "! !63 "6!33 1?@ ,? +? & ,* 34##!## 3!"# " !## 346#! !3" ! 3 3! #!9, !36 ! !" "!99 !,# ""!# 1?@ ,? +? & ,* 343##!## 3!"# " !## 346 !, 6#!, ! 3 !39 #!9,6#!,9 ! !" "!"" 3#! ""! 6 1?@ ,? +? & ,* 34##!## 3!"# " !## 346,!#3 6#!# ! 3 3 !9 #!9,6#!9 ! !" "!66 3,!99 ""!, 1?@ ,? +? & ,* 4###!## 3!"# " !## 346,!9 6 ! ! 3 3 ! 9 #!9,6 ! , ! !" "! 36! ""! 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346 !3 6 !"9 ! 3 3"! , #!9,6 !"" ! !" "!, 39! , ""!", 1?@ ,? +? & ,* 4,##!## 3!"# " !## 3466! 6 ! ! 3 39!33 #!9,6 !3 ! !" "! 3!39 ""!9" 1?@ ,? +? & ,* 4 ##!## 3!"# " !## 346"!"3 6,!6, ! 3 33!96 #!9,6,!6 ! !" "!# 3!9# ""! 1?@ ,? +? & ,* 46##!## 3!"# " !## 3469!6" 6,!3" ! 3 #!6# #!9,6,!36 ! !" "3!6 ! 6 ""!# 1?@ ,? +? & ,* 4"##!## 3!"# " !## 346! 6 !,3 ! 3 ,! 9 #!9,6 !, ! !" "3!36 !#3 "9!#, 1?@ ,? +? & ,* 49##!## 3!"# " !## 3463!,# 6 !, ! 3 ! #!9,6 ! ! !" "3!" 6!3 "9! 6 1?@ ,? +? & ,* 4##!## 3!"# " !## 346!#3 66! " ! 3 "!9 #!9,66! 6 ! !" "3!9 9!"3 "9!,9 1?@ ,? +? & ,* 43##!## 3!"# " !## 346!" 66!"3 ! 3 !69 #!9,66!" ! !" "3!"3 3! "9! 1?@ ,? +? & ,* 4##!## 3!"# " !## 3463#!3 6"!#, ! 3 !, #!9,6"!## ! !" "3!"#,##!#3 "9!" 1?@ ,? +? & ,* ,#4###!## 3!"# " !## 3463 !# 6"!6" ! 3,# !## #!9,6"!66 ! !" "3!6,,# !3 "9!9 1?@ ,? +? & ,* ,#4 ##!## 3!"# " !## 3463,!"3 6"!33 ! 3,#,!3 #!9,6"!3 ! !" "3! 6,# !" "9!" 1?@ ,? +? & ,* ,#4,##!## 3!"# " !## 3463 !6" 69! , ! 3,#6!"" #!9,69! ! !" "3!,9,#"! " "9!3 1?@ ,? +? & ,* ,#4 ##!## 3!"# " !## 34636! , 69!" ! 3,#9! #!9,69!6 ! !" "3! 3,#! "9! 1?@ ,? +? & ,* ,#46##!## 3!"# " !## 3463"!,# 6! ! 3,#3! # #!9,6! 3 ! !" "3! ,#3!3 "! # 1?@ ,? +? & ,* ,#46"!## 3!"# " !## 34639!# 6!9# ! 3,#! #!9,6!" ! !" "3!#6, #!"" "!,, 1?@ ,? +? & ,* . ) & / + 0 + !"#$% &'( )*%12 / + 3 + !"#$% &'( )*$2 / ++ , - .)$- + $ " / + ! + /$/$) $ $ &+ ! + 0# 2 4+ ,!##(/ 2 +1 "- % 4 " 0 )90 4 ) %12 :/< " 4 :/< 4 :/< 8"9) :/< 89)! :/< 2 4% 4 .4& . & 2 4 :;< 22 ? :;< 7-( ) 346##!"# "4 4#,6!" 46,4 !,64" !" ,#!###!## #!###8: !6 " 86 :6,!9,6 ( 1 ) 34639!# "4#,4 #! 46 4 6!, 4 #9! 64 #!" #!## #!###83: ,!#99 " 8 : 6! ( 1 2 :/< $ & 2 :/< 4 2 0 :< = 2 0 :<" 0 4 $% 4#6!3# 4 !6 ! " 9!### 463! 934,#,!, !9," ,!,"# ,34,!"4 #!!### 3!"## $ & 2 :/< 1 2 :/< 2 2 :;<" 0 .4 2 :;< 6 0 3 !9 /@ !"# 4#39!6, 6# 4#3 !,9 46, !# # 46 !6 49"6!6 ,# 4966!# ,4#,"!, # 49! " 4 6 !69 = 4##6!9 4 !6 4#6!3# 43,3!" C 49,,!## 64#6 !33 C9 43 ! 64," !6 C"64##,!9 643#! C664"9#!6 "4 " !63 C 64"! , "43"!# $CC "463 ! " 94 !3 C,94, 3!9" 946#!93 C 94,66! 4 ,9!## $ 94" !9, 34 " ! 6 D 5469#!,, 34,#,!, 463! 34 6#! 7249#6! 493 !,, 134,33!"" 4 !## ,34,!" 439!" 34 ,3! ) -;EF -;EF 1 F 1 Davies, Stephen F (OGC) From:Longo, Joseph J <Joseph.J.Longo@conocophillips.com> Sent:Monday, November 28, 2022 4:11 PM To:Davies, Stephen F (OGC) Subject:RE: [EXTERNAL]GMTU MT7-97 (PTD 222-150) - Question Steve, Sorryfortheconfusion,thatisanerror.The12Ͳ1/4”holesectionwillbedrilledwithWBM.The8Ͳ1/2”x9Ͳ7/8”willbe drilledwithOBM.6Ͳ1/8”ProductionwillbedrilledwithWBM,currentplanistodisplaceOBMpriortodrillingoutthe shoe. JosephLongo StaffDrillingEngineer Cell:907Ͳ947Ͳ4323 UserID:JJLONGO From:Davies,StephenF(OGC)<steve.davies@alaska.gov> Sent:Monday,November28,20222:42PM To:Longo,JosephJ<Joseph.J.Longo@conocophillips.com> Subject:[EXTERNAL]GMTUMT7Ͳ97(PTD222Ͳ150)ͲQuestion HiJoe, Couldyoupleaseclarifythedrillingfluidprogramforme?Item11intheProposedDrillingProgramforthe12Ͳ1/4”hole section(p.5)states“Displacewellto12.0VersacleanOBM”,buttheDrillingFluidProgramforIntermediate#1(p.10) indicates“Freshwaterpolymermudsystem.”Also,changingthemudsystembacktowaterͲbasedmudforthe productionholeinterval(seep.10)isn’tmentionedintheProposedDrillingProgramwithinthe30Ͳseriesnumbered itemsonpage6.OramImisunderstandingsomething? Thanksforyourhelp, SteveDavies AlaskaOilandGasConservationCommission(AOGCC) CONFIDENTIALITYNOTICE:ThiseͲmailmessage,includinganyattachments,containsinformationfromtheAlaskaOilandGasConservationCommission (AOGCC),StateofAlaskaandisforthesoleuseoftheintendedrecipient(s).Itmaycontainconfidentialand/orprivilegedinformation.Theunauthorizedreview,use ordisclosureofsuchinformationmayviolatestateorfederallaw.IfyouareanunintendedrecipientofthiseͲmail,pleasedeleteit,withoutfirstsavingorforwarding it,and,sothattheAOGCCisawareofthemistakeinsendingittoyou,contactSteveDaviesat907Ͳ793Ͳ1224orsteve.davies@alaska.gov. From:Davies,StephenF(OGC) Sent:Monday,November28,20221:16PM To:Longo,JosephJ<Joseph.J.Longo@conocophillips.com> Subject:RE:[EXTERNAL]FW:GMTUMT7Ͳ97(PTD222Ͳ150)ͲDirectionalSurveyDatainDigitalForm ThanksJoe,Iappreciateyourhelp. Thanksagain, SteveDavies 2 AlaskaOilandGasConservationCommission(AOGCC) CONFIDENTIALITYNOTICE:ThiseͲmailmessage,includinganyattachments,containsinformationfromtheAlaskaOilandGasConservationCommission (AOGCC),StateofAlaskaandisforthesoleuseoftheintendedrecipient(s).Itmaycontainconfidentialand/orprivilegedinformation.Theunauthorizedreview,use ordisclosureofsuchinformationmayviolatestateorfederallaw.IfyouareanunintendedrecipientofthiseͲmail,pleasedeleteit,withoutfirstsavingorforwarding it,and,sothattheAOGCCisawareofthemistakeinsendingittoyou,contactSteveDaviesat907Ͳ793Ͳ1224orsteve.davies@alaska.gov. From:Longo,JosephJ<Joseph.J.Longo@conocophillips.com> Sent:Monday,November28,202212:43PM To:Davies,StephenF(OGC)<steve.davies@alaska.gov> Subject:RE:[EXTERNAL]FW:GMTUMT7Ͳ97(PTD222Ͳ150)ͲDirectionalSurveyDatainDigitalForm HeySteve, Sorryaboutthat.Pleasefindtheattached. JosephLongo StaffDrillingEngineer Cell:907Ͳ947Ͳ4323 UserID:JJLONGO From:Davies,StephenF(OGC)<steve.davies@alaska.gov> Sent:Monday,November28,202211:55AM To:Longo,JosephJ<Joseph.J.Longo@conocophillips.com> Subject:[EXTERNAL]FW:GMTUMT7Ͳ97(PTD222Ͳ150)ͲDirectionalSurveyDatainDigitalForm CAUTION:This email originated from outside of the organization. Do not click links or open attachments unless you recognize the sender and know the content is safe. HiJoe, CouldCPAIalsoprovideadigitalcopyoftheproposeddirectionalsurveydataforthiswellinspreadsheetorASCIItable format?HavingtheplannedMD,inclinationandazimuthdataindigitalformspeedsloadingoftheinformationintomy workstationandspeedsmyportionofAOGCC’sreview. Thanksforyourhelpandstaysafe, SteveDavies AlaskaOilandGasConservationCommission(AOGCC) CONFIDENTIALITYNOTICE:ThiseͲmailmessage,includinganyattachments,containsinformationfromtheAlaskaOilandGasConservationCommission (AOGCC),StateofAlaskaandisforthesoleuseoftheintendedrecipient(s).Itmaycontainconfidentialand/orprivilegedinformation.Theunauthorizedreview,use ordisclosureofsuchinformationmayviolatestateorfederallaw.IfyouareanunintendedrecipientofthiseͲmail,pleasedeleteit,withoutfirstsavingorforwarding it,and,sothattheAOGCCisawareofthemistakeinsendingittoyou,contactSteveDaviesat907Ͳ793Ͳ1224orsteve.davies@alaska.gov. From:Davies,StephenF(OGC) Sent:Monday,November28,202211:21AM CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. 3 To:Joseph.j.longo@conocophillips.com Cc:Prysunka,AnneE(OGC)<anne.prysunka@alaska.gov>;Boyer,DavidL(OGC)<david.boyer2@alaska.gov> Subject:GMTUMT7Ͳ97(PTD222Ͳ150)Ͳ401Form HiJoe, I’mreviewingCPAI’sPTDapplicationforthiswellandI’venoticedthatonthepastfewapplicationformsreceivedfrom CPAI,the“yes/no”boxesinthelowerrightportionofthe401formgeneratedbyCPAIaresuperimposedonsomeofthe ConditionsofApprovaltext.CouldyoupleaseaskwhomevergeneratesthisformatCPAItofixtheseboxesonallfuture applicationformsforclarity?ResubmittaloftheapplicationformforMT7Ͳ97isnotnecessary. Thanksforyourhelpandstaysafe, SteveDavies AlaskaOilandGasConservationCommission(AOGCC) CONFIDENTIALITYNOTICE:ThiseͲmailmessage,includinganyattachments,containsinformationfromtheAlaskaOilandGasConservationCommission (AOGCC),StateofAlaskaandisforthesoleuseoftheintendedrecipient(s).Itmaycontainconfidentialand/orprivilegedinformation.Theunauthorizedreview,use ordisclosureofsuchinformationmayviolatestateorfederallaw.IfyouareanunintendedrecipientofthiseͲmail,pleasedeleteit,withoutfirstsavingorforwarding it,and,sothattheAOGCCisawareofthemistakeinsendingittoyou,contactSteveDaviesat907Ͳ793Ͳ1224orsteve.davies@alaska.gov. 1 Davies, Stephen F (OGC) From:Longo, Joseph J <Joseph.J.Longo@conocophillips.com> Sent:Thursday, December 15, 2022 11:04 AM To:Davies, Stephen F (OGC) Cc:Loepp, Victoria T (OGC) Subject:RE: [EXTERNAL]GMTU MT7-97 (PTD 222-150) - Question Steve, Howareyoudoingtoday?Ihopeyouarefairingwellwithallthesnow!IapologizethestatedmudweightsintheAPD arelow.Westartthesurfacesectionwitha10.5andweightupto11ppgpriortoenteringtheSeabee’s.Pleaseseemy responsesbelowinred.Ifyouhaveanyadditionalquestionspleasedonothesitate. Questions: 1. WhywasthelighterweightmudprogramchosenforMT7Ͳ97? a. Thiswasanerror,plannedMW’sare10.5Ͳ11.5 2. WillMPDalsobeusedduringdrillingofthesurfacehole? a. NoMPDwillnotbeutilized 3. Ifnot,whywillCPAI’sproposedlighterweightprogrambesufficienttoallowadiverterwaivervariance? a. PlannedMW’sare10.5Ͳ11.5ppg 4. Howandhowoftenwilldrillingoperationsandmudweightbemonitoredtoensuresafedrillingtosurface casingpoint? a. Pitwatcherscheckin/outmudweightsandfunnelviseveryhour.Additionally,ourmudengineertakes4 mudchecksaday. JosephLongo StaffDrillingEngineer Cell:907Ͳ947Ͳ4323 UserID:JJLONGO From:Davies,StephenF(OGC)<steve.davies@alaska.gov> Sent:Wednesday,December14,20221:47PM To:Longo,JosephJ<Joseph.J.Longo@conocophillips.com> Cc:Loepp,VictoriaT(OGC)<victoria.loepp@alaska.gov> Subject:[EXTERNAL]GMTUMT7Ͳ97(PTD222Ͳ150)ͲQuestion CAUTION:This email originated from outside of the organization. Do not click links or open attachments unless you recognize the sender and know the content is safe. Joe, I’mreviewingCPAI’sPermittoDrillforMT7Ͳ97andIhaveaquestionrelatedtothediverterwaiver.Inoticethatthe proposedmudprogramforMT7Ͳ97significantlylighteracrossthesurfaceholeintervalthantheprogramusedforthe CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. 2 samesectionofdrillinginnearbywellMT7Ͳ09andforothernearbywellswhiledrillingthroughthissameinterval (Rendezvous2,MT7Ͳ04,MT7Ͳ05;seebelow). Questions: 1. WhywasthelighterweightmudprogramchosenforMT7Ͳ97? 2. WillMPDalsobeusedduringdrillingofthesurfacehole? 3. Ifnot,whywillCPAI’sproposedlighterweightprogrambesufficienttoallowadiverterwaivervariance? 4. Howandhowoftenwilldrillingoperationsandmudweightbemonitoredtoensuresafedrillingtosurface casingpoint? Thanksandstaysafe, SteveDavies AlaskaOilandGasConservationCommission(AOGCC) CONFIDENTIALITYNOTICE:ThiseͲmailmessage,includinganyattachments,containsinformationfromtheAlaskaOilandGasConservationCommission (AOGCC),StateofAlaskaandisforthesoleuseoftheintendedrecipient(s).Itmaycontainconfidentialand/orprivilegedinformation.Theunauthorizedreview,use ordisclosureofsuchinformationmayviolatestateorfederallaw.IfyouareanunintendedrecipientofthiseͲmail,pleasedeleteit,withoutfirstsavingorforwarding it,and,sothattheAOGCCisawareofthemistakeinsendingittoyou,contactSteveDaviesat907Ͳ793Ͳ1224orsteve.davies@alaska.gov. ProposedMudProgramforMT7Ͳ97: FromPermittoDrillforMT7Ͳ09: Informationfromothernearbywells: Rendezvous2(201Ͳ007) Nodrillingproblemsreportedinopssummarytosurfacecsgpt. 3 MDMW/ECD 550'MD10.8ppg PFB598'MD 2050'MD10.0ppg 2230'MD10.1ppg 2320'MD10.0ppg 2340'MD10.05ppg Csg_Surf2673'MD 2680'MD9.5ppg 2890'MD9.5ppg MT7Ͳ04(221Ͳ017)(Plannedsurfaceholemudprogram9.0to10.0ppgwithMPD) Nodrillingproblemsreportedinopssummarytosurfacecsgpt. MDMW/ECD 970'MD10.87ECD PFB981'MD 1250'MD10.87ECD 1546'MD10.87ECD 2078'MD10.94ECD 3183'MD11.05ECD 3397'MD11.05ECD Csg_Surfat3387’MD MT7Ͳ05(221Ͳ087) Nodrillingproblemsreportedinopssummarytosurfacecsgpt. MDMW/ECD 279'MD10.5ppg 970'MD11.0ppg PFB980'MD 2345'MD11.0ppg 2957'MD11.0ppg 3450'MD11.0ppg 3525'MD11.0ppg Csg_Surf3515'MD WELL PERMIT CHECKLISTCompanyConocoPhillips Alaska, Inc.Well Name:GMTU MT7-97Initial Class/TypeDEV / PENDGeoArea890Unit10750On/Off ShoreOnProgramDEVField & PoolWell bore segAnnular DisposalPTD#:2221500GRTR MOOSES TOOTH, RENDEZV OIL - 28220NA1Permit fee attachedYesSurface Location lies within AA081800; Top Prod Int & TD lie within AA081781.2Lease number appropriateYes3Unique well name and numberYesGRTR MOOSES TOOTH, RENDEZV OIL - 2822004Well located in a defined poolYes5Well located proper distance from drilling unit boundaryYes6Well located proper distance from other wellsYes7Sufficient acreage available in drilling unitYes8If deviated, is wellbore plat includedYes9Operator only affected partyYes10Operator has appropriate bond in forceYes11Permit can be issued without conservation orderYes12Permit can be issued without administrative approvalYes13Can permit be approved before 15-day waitNA14Well located within area and strata authorized by Injection Order # (put IO# in comments) (For NA15All wells within 1/4 mile area of review identified (For service well only)NA16Pre-produced injector: duration of pre-production less than 3 months (For service well only)NA17Nonconven. gas conforms to AS31.05.030(j.1.A),(j.2.A-D)Yes80' conductor18Conductor string providedYes3143' MD19Surface casing protects all known USDWsYes91% excess20CMT vol adequate to circulate on conductor & surf csgNo21CMT vol adequate to tie-in long string to surf csgNouncemented liner with swell packers and frac sleeves22CMT will cover all known productive horizonsYes23Casing designs adequate for C, T, B & permafrostYesRig has steel tanks; all waste to approved disposal wells24Adequate tankage or reserve pitNA25If a re-drill, has a 10-403 for abandonment been approvedYesAnti collision analysis complete; no major risk failures26Adequate wellbore separation proposedYesDiverter variance granted per 20 AAC 25.035(h)(2)27If diverter required, does it meet regulationsYesMax formation pressure is 3927 psig(8.9 ppg EMW); will drill w/ 8.8-13.0 ppg EMW28Drilling fluid program schematic & equip list adequateYes29BOPEs, do they meet regulationYesMPSP is 3078 psig; will test BOPs to 3500 psig30BOPE press rating appropriate; test to (put psig in comments)Yes31Choke manifold complies w/API RP-53 (May 84)Yes32Work will occur without operation shutdownNo33Is presence of H2S gas probableNA34Mechanical condition of wells within AOR verified (For service well only)YesNone anticipated from nearby wells. Rig has sensors and alarms.35Permit can be issued w/o hydrogen sulfide measuresYesAnticipated pressure is 0.45 - 0.46 psi'ft (8.6 - 8.9 ppg EMW). Will be drilled using MPD and plan mud36Data presented on potential overpressure zonesNAweights that appear sufficient to control anticipated pressure. MPD will mitigate wellbore instability.37Seismic analysis of shallow gas zonesNAShallow gas and gas hydrates are not expected based on nearby wells.38Seabed condition survey (if off-shore)NA39Contact name/phone for weekly progress reports [exploratory only]ApprSFDDate11/28/2022ApprVTLDate12/14/2022ApprSFDDate12/5/2022AdministrationEngineeringGeologyGeologic Commissioner:Date:Engineering Commissioner:DatePublic CommissionerDateJLC 12/16/2022 5HYLVHG 75$160,77$//(77(5&+(&./,67 :(//1$0( BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 37' BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBB'HYHORSPHQW BBB6HUYLFH BBB([SORUDWRU\ BBB6WUDWLJUDSKLF7HVW BBB1RQ&RQYHQWLRQDO ),(/' BBBBBBBBBBBBBBBBBBBBBBBBBB 322/ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KHFN%R[IRU$SSURSULDWH/HWWHU3DUDJUDSKVWREH,QFOXGHGLQ7UDQVPLWWDO/HWWHU &+(&. 237,216 7(;7)25$33529$//(77(5 08/7, /$7(5$/ ,IODVWWZRGLJLWV LQ$3,QXPEHUDUH EHWZHHQ 7KH SHUPLW LV IRU D QHZ ZHOOERUH VHJPHQW RI H[LVWLQJ ZHOO 3HUPLW 1XPEHU BBBBBBBBBBBBB$3, 1XPEHUBBBBBBBBBBBBBBBBBBBBBB 3URGXFWLRQ IURPRULQMHFWLRQ LQWRWKLVZHOOERUHPXVW EHUHSRUWHGXQGHU WKHRULJLQDO$3,1XPEHUVWDWHGDERYH 6SDFLQJ ([FHSWLRQ 7KHSHUPLWLVDSSURYHGVXEMHFWWRIXOOFRPSOLDQFHZLWK$$& $SSURYDO WR SURGXFH RU LQMHFW LV FRQWLQJHQW XSRQ LVVXDQFH RI D FRQVHUYDWLRQ RUGHU DSSURYLQJ D VSDFLQJ H[FHSWLRQ 7KH 2SHUDWRU DVVXPHVWKHOLDELOLW\RIDQ\SURWHVWWRWKHVSDFLQJH[FHSWLRQWKDWPD\ RFFXU 'U\'LWFK6DPSOH $OOGU\GLWFKVDPSOHVHWVVXEPLWWHGWRWKH$2*&& PXVWEHLQQRJUHDWHU WKDQIRRW VDPSOHLQWHUYDOVIURPEHORZWKHSHUPDIURVWRUIURPZKHUH VDPSOHVDUHILUVWFDXJKWDQGIRRW VDPSOHLQWHUYDOVWKURXJKWDUJHW ]RQHV 1RQ &RQYHQWLRQDO :HOO 3OHDVHQRWHWKHIROORZLQJVSHFLDOFRQGLWLRQRIWKLVSHUPLW 3URGXFWLRQRU SURGXFWLRQWHVWLQJRIFRDOEHGPHWKDQHLVQRWDOORZHGIRUWKLVZHOO XQWLO DIWHUWKH2SHUDWRUKDVGHVLJQHGDQGLPSOHPHQWHGDZDWHUZHOOWHVWLQJ SURJUDPWRSURYLGHEDVHOLQHGDWDRQZDWHUTXDOLW\DQGTXDQWLW\7KH 2SHUDWRU PXVWFRQWDFWWKH$2*&& WRREWDLQDGYDQFHDSSURYDORIVXFK D ZDWHUZHOOWHVWLQJSURJUDP :HOO/RJJLQJ 5HTXLUHPHQWV 5HJXODWLRQ$$& D DXWKRUL]HVWKH$2*&&WRVSHFLI\W\SHV RIZHOOORJVWREHUXQ,QDGGLWLRQWRWKHZHOOORJJLQJSURJUDPSURSRVHG E\ WKH2SHUDWRULQWKHDWWDFKHGDSSOLFDWLRQWKHIROORZLQJZHOOORJVDUH DOVRUHTXLUHGIRUWKLVZHOO 3HU6WDWXWH$6 G % DQG5HJXODWLRQ$$& FRPSRVLWHFXUYHVIRU DOO ZHOOORJVUXQPXVWEHVXEPLWWHGWRWKH$2*&& ZLWKLQ GD\VDIWHUFRPSOHWLRQVXVSHQVLRQRUDEDQGRQPHQWRIWKLV ZHOORUZLWKLQ GD\VRIDFTXLVLWLRQRIWKHGDWDZKLFKHYHURFFXUVILUVW Rendezvous Oil MT7-97 222-150 Greater Moose's Tooth Unit
