Department of Commerce, Community, and Economic Development
Alaska Oil and Gas Conservation
Commission
HOME
EVENTS
DATA
Data List
Drilling
Production
Orders
Data Miner
Document Search
REPORTS
Reports and Charts
Pool Statistics
FORMS
LINKS
Links
Test Notification
Data Requests
Regulations
Industry Guidance Bulletins
How to Apply
ABOUT US
History
Staff
HELP
Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
222-108
DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 3 1 - 0 1 - 0 0 We l l N a m e / N o . GM T U M T 7 - 0 6 A Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 11 / 1 5 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 1 0 8 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 26 6 3 4 TV D 84 6 4 Cu r r e n t S t a t u s 1- O I L 6/ 4 / 2 0 2 5 UI C No We l l L o g I n f o r m a t i o n : Di g i t a l Me d / F r m t Re c e i v e d St a r t S t o p OH / CH Co m m e n t s Lo g Me d i a Ru n No El e c t r Da t a s e t Nu m b e r Na m e In t e r v a l Li s t o f L o g s O b t a i n e d : GR , R E S , P W D , D I R , A Z I , D E N , N E U , C A L I P E R , P O R O S I T Y , S O N I C No No Ye s Mu d L o g S a m p l e s D i r e c t i o n a l S u r v e y RE Q U I R E D I N F O R M A T I O N (f r o m M a s t e r W e l l D a t a / L o g s ) DA T A I N F O R M A T I O N Lo g / Da t a Ty p e Lo g Sc a l e DF 12 / 2 / 2 0 2 2 33 9 0 2 6 6 3 5 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ C O M P _ M E M . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 33 9 0 2 6 6 3 5 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ C O M P _ M E M _ N o H e a d e r . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ R U N 0 1 _ M E M _ A P - L O G _ T I M E . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ R U N 0 2 _ M E M _ A P - L O G _ T I M E . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ R U N 0 3 _ M E M _ A P - L O G _ T I M E . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ R U N 0 1 _ M E M _ V S S - L O G _ T I M E . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ R U N 0 2 _ M E M _ V S S - L O G _ T I M E . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 ### # # # # #### # # # # # El e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ R U N 0 3 _ M E M _ V S S - L O G _ T I M E . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 33 9 0 2 6 6 3 5 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ V S S - D E P _ M E M . l a s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A _ B a k e r MW D _ L W D _ D i s t r i b u t i o n A O G C C . d o c x 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ R U N 01 _ M E M _ A P - L O G _ T I M E . a s c 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ R U N 02 _ M E M _ A P - L O G _ T I M E . a s c 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ R U N 03 _ M E M _ A P - L O G _ T I M E . a s c 37 3 5 4 ED Di g i t a l D a t a We d n e s d a y , J u n e 4 , 2 0 2 5 AO G C C P a g e 1 o f 5 CP A I _ M T 7 - , 06A _ CO MP _ M E M . l a s DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 3 1 - 0 1 - 0 0 We l l N a m e / N o . GM T U M T 7 - 0 6 A Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 11 / 1 5 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 1 0 8 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 26 6 3 4 TV D 84 6 4 Cu r r e n t S t a t u s 1- O I L 6/ 4 / 2 0 2 5 UI C No DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ R U N 01 _ M E M _ V S S - L O G _ T I M E . a s c 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ R U N 02 _ M E M _ V S S - L O G _ T I M E . a s c 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ R U N 03 _ M E M _ V S S - L O G _ T I M E . a s c 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 06 A _ m e m _ L I T K _ R 3 _ L M G 1 0 0 _ 0 2 4 0 s c l . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 06 A _ m e m _ L I T K _ R 3 _ L M G 1 0 0 _ 0 2 4 0 s c l . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A _ m e m _ L T K _ R 3 . d l i s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A _ m e m _ S T K _ R 3 . d l i s 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 06 A _ m e m _ S T K _ R 3 _ L M G 1 0 0 _ 0 0 4 8 s c l . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 06 A _ m e m _ S T K _ R 3 _ L M G 1 0 0 _ 0 0 4 8 s c l . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 06 A _ m e m _ S T K _ R 3 _ L M G 1 0 0 _ 0 2 4 0 s c l . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 06 A _ m e m _ S T K _ R 3 _ L M G 1 0 0 _ 0 2 4 0 s c l . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 2 M D _ C O M P _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 2 T V D _ C O M P _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 5 M D _ C O M P _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 5 T V D _ C O M P _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ A P - TI M E _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ V S S - DE P _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ V S S - TI M E _ M E M . c g m 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 2 M D _ C O M P _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a We d n e s d a y , J u n e 4 , 2 0 2 5 AO G C C P a g e 2 o f 5 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 3 1 - 0 1 - 0 0 We l l N a m e / N o . GM T U M T 7 - 0 6 A Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 11 / 1 5 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 1 0 8 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 26 6 3 4 TV D 84 6 4 Cu r r e n t S t a t u s 1- O I L 6/ 4 / 2 0 2 5 UI C No DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 2 T V D _ C O M P _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 5 M D _ C O M P _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ 5 T V D _ C O M P _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ A P - TI M E _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ V S S - DE P _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ V S S - TI M E _ M E M . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A D e f i n i t i v e S u r v e y s - Pe t r e l . t x t 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A N A D 2 7 D e f i n i t i v e Su r v e y s . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A N A D 2 7 D e f i n i t i v e Su r v e y s . t x t 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A N A D 8 3 D e f i n i t i v e Su r v e y s . p d f 37 3 5 4 ED Di g i t a l D a t a DF 12 / 2 / 2 0 2 2 E l e c t r o n i c F i l e : M T 7 - 0 6 A N A D 8 3 D e f i n i t i v e Su r v e y s . t x t 37 3 5 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 21 1 3 4 0 0 E l e c t r o n i c D a t a S e t , F i l e n a m e : C P A I _ M T 7 - 06 A _ M T 7 - 0 6 A _ T O C _ L A S . l a s 37 4 1 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ M T 7 - 06 A _ T O C . d l i s 37 4 1 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ M T 7 - 06 A _ T O C _ 1 0 0 0 M D _ R M . P d f 37 4 1 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ M T 7 - 06 A _ T O C _ 2 0 0 M D _ R M . P d f 37 4 1 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ M T 7 - 06 A _ T O C _ 6 0 0 0 M D _ R M . P d f 37 4 1 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ M T 7 - 06 A _ T O C _ 8 0 0 0 M D _ R M . P d f 37 4 1 4 ED Di g i t a l D a t a DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 0 6 A _ T O C La b e l e d _ 4 0 0 0 M D _ R M . P d f 37 4 1 4 ED Di g i t a l D a t a We d n e s d a y , J u n e 4 , 2 0 2 5 AO G C C P a g e 3 o f 5 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 3 1 - 0 1 - 0 0 We l l N a m e / N o . GM T U M T 7 - 0 6 A Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 11 / 1 5 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 1 0 8 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 26 6 3 4 TV D 84 6 4 Cu r r e n t S t a t u s 1- O I L 6/ 4 / 2 0 2 5 UI C No We l l C o r e s / S a m p l e s I n f o r m a t i o n : Re c e i v e d St a r t S t o p C o m m e n t s To t a l Bo x e s Sa m p l e Se t Nu m b e r Na m e In t e r v a l IN F O R M A T I O N R E C E I V E D DF 1/ 4 / 2 0 2 3 E l e c t r o n i c F i l e : C P A I _ M T 7 - 06 A _ T O C _ 5 0 0 M D _ R M . P d f 37 4 1 4 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 17 9 0 5 1 2 6 6 6 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 1 0 _ 4 5 f p m f l o w i n g . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 12 6 3 9 1 8 0 8 5 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 1 _ 8 0 f p m d o w n F l o w i n g . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 18 0 8 9 1 2 6 1 3 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 2 _ 4 5 f p m U p F l o w i n g . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 12 6 4 4 1 7 9 3 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 3 _ 8 0 f p m D o w n S h u t i n . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 17 9 4 6 1 2 6 2 6 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 4 _ 4 5 f p m U p S h u t i n . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 12 6 4 9 1 8 0 8 7 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 5 _ 8 0 f p m D o w n S h u t i n . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 18 0 9 8 1 2 6 5 3 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 6 _ 4 5 f p m U p S h u t i n . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 12 6 5 5 1 7 6 3 1 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 7 _ 8 0 f p m f l o w i n g . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 17 6 4 3 1 2 6 6 2 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 8 _ 4 5 f p m f l o w i n g . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 12 6 5 9 1 7 8 9 3 E l e c t r o n i c D a t a S e t , F i l e n a m e : M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P a s s 9 _ 8 0 f p m f l o w i n g . l a s 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 E l e c t r o n i c F i l e : 2 0 2 3 - 0 6 - 2 5 _ 2 2 1 0 2 _ G M T U _ M T 7 - 06 A _ P r e s s u r e _ T e m p e r a t u r e S u r v e y _ T r a n s m i t t a l . d oc x 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 E l e c t r o n i c F i l e : G M T U _ M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P r e s s u r e _ T e m p e r a t u r e S u r v e y . p d f 37 7 8 7 ED Di g i t a l D a t a DF 6/ 2 9 / 2 0 2 3 E l e c t r o n i c F i l e : G M T U _ M T 7 - 0 6 A _ 2 5 - J u n - 23 _ P r e s s u r e _ T e m p e r a t u r e S u r v e y . t i f 37 7 8 7 ED Di g i t a l D a t a We d n e s d a y , J u n e 4 , 2 0 2 5 AO G C C P a g e 4 o f 5 DA T A S U B M I T T A L C O M P L I A N C E R E P O R T AP I N o . 50 - 1 0 3 - 2 0 8 3 1 - 0 1 - 0 0 We l l N a m e / N o . GM T U M T 7 - 0 6 A Co m p l e t i o n S t a t u s 1- O I L Co m p l e t i o n D a t e 11 / 1 5 / 2 0 2 2 Pe r m i t t o D r i l l 22 2 1 0 8 0 Op e r a t o r Co n o c o P h i l l i p s A l a s k a , I n c . MD 26 6 3 4 TV D 84 6 4 Cu r r e n t S t a t u s 1- O I L 6/ 4 / 2 0 2 5 UI C No Co m p l e t i o n R e p o r t Pr o d u c t i o n T e s t I n f o r m a t i o n Ge o l o g i c M a r k e r s / T o p s Y Y / N A Y Co m m e n t s : Co m p l i a n c e R e v i e w e d B y : Da t e : Mu d L o g s , I m a g e F i l e s , D i g i t a l D a t a Co m p o s i t e L o g s , I m a g e , D a t a F i l e s Cu t t i n g s S a m p l e s Y / N A Y Y / N A Di r e c t i o n a l / I n c l i n a t i o n D a t a Me c h a n i c a l I n t e g r i t y T e s t I n f o r m a t i o n Da i l y O p e r a t i o n s S u m m a r y Y Y / N A Y Co r e C h i p s Co r e P h o t o g r a p h s La b o r a t o r y A n a l y s e s Y / N A Y / N A Y / N A CO M P L I A N C E H I S T O R Y Da t e C o m m e n t s De s c r i p t i o n Co m p l e t i o n D a t e : 11 / 1 5 / 2 0 2 2 Re l e a s e D a t e : 8/ 2 9 / 2 0 2 2 We d n e s d a y , J u n e 4 , 2 0 2 5 AO G C C P a g e 5 o f 5 M. G u h l 6/ 4 / 2 0 2 5 C:\Users\kmjunke\AppData\Local\Microsoft\Windows\INetCache\Content.Outlook\99RGP1KB\2023-06-25_22102_GMTU_MT7-06A_Pressure_TemperatureSurvey_Transmittal.docx DELIVERABLE DISCRIPTION Ticket # Field Well # API # Log Description Log Date 22102 GMTU MT7-06A 50-103-20831-01 Pressure Temperature Survey 25-Jun-23 DELIVERED TO Company & Address DIGITAL FILE # of Copies LOG PRINTS # of Prints CD’s # of Copies 1 AOGCC Attn: Natural Resources Technician 333 W. 7th Ave., Suite 100 Anchorage, Ak. 99501-3539 Delivered By: CPAI Sharefile ______________________________ ______________________________________ Date received Signature PLEASE RETURN COPY VIA EMAIL TO: DIANE.WILLIAMS@READCASEDHOLE.COM READ CASED HOLE, INC., 4141 B STREET, SUITE 308, ANCHORAGE, AK 99503 PHONE: (907)245-8951 E-MAIL : READ-Anchorage@readcasedhole.com WEBSITE : WWW.READCASEDHOLE.COM PTD: 222-108 T37787 Kayla Junke Digitally signed by Kayla Junke Date: 2023.06.29 13:19:00 -08'00' WELL NAME API #SERVICE ORDER # FIELD NAMESERVICE DESCRIPTION DELIVERABLE DESCRIPTION DATA TYPE DATE LOGGED CDDirectional SurveyMT7-06A 50-103-20831-01-00 222-108 GMTU MEMORY SonicScope TOC FINAL FIELD 1#REF! #REF! #REF! #REF! #REF! #REF! #REF! #REF!MT7-06A is located in a federal oil and gas unit. Only with respect to the MT7-06A Well Data, CPAI hereby waives its right to indefinite confidentiality, under 5 U.S.C. 552(b)(4) and (9). Nothing in this communication should be construed as a waiver of indefinite confidentiality on any other wells.Transmittal Receipt________________________________ X____________________________________________Print Name Signature DatePlease return via courier or sign/scan and email a copy to Schlumberger.VTuong@slb.comSLB Auditor -A Transmittal Receipt signature confirms that a package (box, envelope, etc.) has been received and the contents of the package have been verified to match the media noted above. The specific content of the CDs and/or hardcopy prints may or may not have been verified for correctness or quality level at this point.# Schlumberger-PrivateBy Meredith Guhl at 9:12 am, Jan 04, 2023222-108T37414Meredith GuhlDigitally signed by Meredith Guhl Date: 2023.01.04 09:13:38 -09'00' 1. Operations Susp Well Insp Plug Perforations Fracture Stimulate Pull Tubing Operations shutdown Performed: Install Whipstock Perforate Other Stimulate Alter Casing Change Approved Program Mod Artificial Lift Perforate New Pool Repair Well Coiled Tubing Ops Other: ______________________ Development Exploratory Stratigraphic Service 6. API Number: 7. Property Designation (Lease Number): 8. Well Name and Number: 9. Logs (List logs and submit electronic data per 20AAC25.071): 10. Field/Pool(s): 11. Present Well Condition Summary: Total Depth measured 26,634 feet feet true vertical 8,464 feet feet Effective Depth measured 26,634 feet 12,097 / 11,969 feet true vertical 8,464 feet 8,245 / 8,208 feet Perforation depth Measured depth N/A feet True Vertical depth N/A feet Tubing (size, grade, measured and true vertical depth) 4.5" 12.6# L80 12104' 8,249' ZXHD LTP 12,097' 8,245' Packers and SSSV (type, measured and true vertical depth) HES TNT 11,969' 8,208' 12. Stimulation or cement squeeze summary: Intervals treated (measured): Treatment descriptions including volumes used and final pressure: 13a. Prior to well operation: Subsequent to operation: 13b. Pools active after work: 15. Well Class after work: Daily Report of Well Operations Exploratory Development Service Stratigraphic Copies of Logs and Surveys Run 16. Well Status after work: Oil Gas WDSPL Electronic Fracture Stimulation Data GSTOR GINJ SUSP SPLUG Sundry Number or N/A if C.O. Exempt: Authorized Name and Digital Signature with Date: Contact Name: Contact Email: Authorized Title: Contact Phone: 2260 measured TVD Production Plugs Junk measured 13-3/8"3425 3052 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS 222-108 50-103-20831-01-00 P.O. Box 100360 Anchorage, AK 99510-03603. Address: MT7-06A Length 80 3425 120Conductor Surface Intermediate 20" x 34" Size 120 9-5/8" 11590 800 14. Attachments (required per 20 AAC 25.070, 25.071, & 25.283) 3000 5. Permit to Drill Number:2. Operator Name 4. Well Class Before Work: AA081800, AA081781, AA081736 Greater Mooses Tooth - Rendezvous ConocoPhillips Alaska Inc. 4,396,552 lbs 20/40 Wanli Ceramic proppant, 42,749 lbs 100M, 61,740 bbls seawater, and 28,770 gals of LVT. Final pressure: 5019 psi 7" Liner 10177 2644 14517 Casing Structural 7438 8292 4-1/2" 10177 12275 26614 MD 26568, 25883, 25197, 24509, 23821, 23093, 22370, 21641, 20916, 20185, 19455, 18725, 17954, 17184, 16496, 15496, 14811, 14128, 13441, 12754 400 measured true vertical Packer Representative Daily Average Production or Injection Data Casing Pressure Tubing Pressure 0 1000 8461 3810, 5090 7030, 8530 5020 6330, 8150 8160, 11220 Burst Collapse Sr Pet Eng: 7500 Sr Pet Geo: Sr Res Eng: WINJ WAG 0 Water-BblOil-Bbl 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. Madeline Woodard madeline.e.woodard@cop.com 907-265-6086Completion Engineer Rendezvous Gas-Mcf 2795 20003900 p k ft t Fra O s O 222 6. A G L PG , Form 10-404 Revised 10/2022 Due Within 30 days of Operations Submit in PDF format to aogcc.permitting@alaska.gov By Samantha Carlisle at 9:09 am, Jan 13, 2023 Digitally signed by Madeline Woodard DN: CN=Madeline Woodard, E=madeline.e.woodard@ conocophillips.com Reason: I am the author of this document Location: Date: 2023.01.13 09:04:19-09'00' Foxit PDF Editor Version: 12.0.1 Madeline Woodard Page 1/2 MT7-06 Report Printed: 1/4/2023 AOGCC Well History Report Daily Operations Start Date End Date AFE / RFE Last 24hr Sum 12/24/2022 06:00 12/24/2022 18:00 10447750 (MISC) 10K TREE/THA SWAP TO 5K (COMPLETE). T PPPOT (PASS), TREE SHELL TEST (PASS) 12/23/2022 06:00 12/23/2022 18:00 10447750 (MISC) : CMIT-TxIA PASSED TO 2515/2520 PSI, POT-T PASSED, POT-IC PASSED, CDDT-TxIA PASSED, BPV TEST PASSED TO 1505 PSI. 12/21/2022 00:01 12/21/2022 23:59 10447750 HALLIBURTON CREW SWAP, GREAT NORTH RIG DOWN LAUNCHER AND LAUNCH VALVES, HALLIBURTON START RIG DOWN PROCESS 12/20/2022 00:01 12/20/2022 23:59 10447750 PUMPED INTERVAL 19 TO DESIGN, INTERVAL 20 CUT SHORT INTERVAL 19 BALL SIZE 3.420":2 BALL SEAT SIGNATURES OBSERVED 230,734 LB PROPPANT PLACED:2499 BBL SLURRY PUMPED; MAX RATE 31.1 BBL MAX PRESSURE 3422, MAX PPG 7.04 INTERVAL 20 BALL SIZE 3.465"; 2 BALL SEAT SIGNATURES OBSERVED AND A THIRD PRESSURE RESPONSE; 84,387 LB PROPPANT PLACED; 2198 BBL SLURRY PUMPED; MAX RATE 31.3 MAX PRESSURE 4747 MAX PPG 4.02 PROPPANT CUT SHORT DUE TO PRESSURE DROP DURING TREATING. AU DART WAS LAUNCHED AND SEATED SHUT DOWN FOR 5,10,15, WELL SHUT WELL COMPLETED 12/19/2022 00:01 12/19/2022 23:59 10447750 PUMPED INTERVALS 17 AND 18 TO DESIGN INTERVAL 17 BALL SIZE 3.31": 236,358 LB PROPPANT PLACED:3223 BBL SLURRY PUMPED; MAX RATE 30.8 BBL MAX PRESSURE 4108, MAX PPG 7.06 INTERVAL 18 BALL SIZE 3.375";227,674 LB PROPPANT PLACED; 2813 BBL SLURRY PUMPED; MAX RATE 30.8 MAX PRESSURE 2919 MAX PPG 7.15 AFTER THE INITIAL BALL SEAT AT 3669 SLURRY VOLUME A SECOND BALL SIGNATURE WAS WITNESSED 10BBL AFTER THE INITIAL@ 3679 SLURRY VOLUME 12/18/2022 00:01 12/18/2022 23:59 10447750 PRIMED/PRESSURE TESTED: WHEN PULLING ON CHEMS FOR BUCKET TESTING/JOB THE CL28 WAS NOT FLOWING, THE SOLIDS FELL OUT OF THE SUSPENSION MAKING A HARD CAKE LAYER ON THE BOTTOM OF THE TOTES, CURRENTLY LOOKING FOR RE-SUSPENSION OPTIONS. 12/17/2022 00:01 12/17/2022 23:59 10447750 DOWN FOR MAINTENANCE, CHEMICAL (CL-28) MIXING, 12/16/2022 00:01 12/16/2022 23:59 10447750 PUMPED INTERVALS 15 AND 16 TO DESIGN INTERVAL 15 BALL SIZE 3.242":DFIT COMPLETED 20 BBL, 20 MIN SHUTIN, 231,118 LB PROPPANT PLACED: 3047 BBL SLURRY PUMPED; MAX RATE 31.1 BBL MAX PRESSURE 4293, MAX PPG 6.97 INTERVAL 16 BALL SIZE 3.285"; 227,329 LB PROPPANT PLACED; 2744 BBL SLURRY PUMPED; MAX RATE 31.3 MAX PRESSURE 4124 MAX PPG 7.14 12/15/2022 00:01 12/15/2022 23:59 10447750 COMPLETED INTERVALS 12,13,14 TO DESIGN INTERVAL 12; 3.112" BALL 225,904LB PLACED; 2511 BBL SLURRY PUMPED; MAX RATE 30.6, MAX PRESSURE 4322; MAX PPG 7.04 INTERVAL 13; 3.155" BALL 222,463LB PLACED; 2488 BBL SLURRY PUMPED; MAX RATE 30, MAX PRESSURE 4190; MAX PPG 7.06 INTERVAL 14; 3.199" BALL 215,477LB PLACED; 2852 BBL SLURRY PUMPED; MAX RATE 31.3, MAX PRESSURE 4021; MAX PPG 6.97 12/14/2022 00:01 12/14/2022 23:59 10447750 PUMPED INTERVALS 10 AND 11 TO DESIGN INTERVAL 10 BALL SIZE 3.028": 227,573 LB PROPPANT PLACED: 2,604 BBL SLURRY PUMPED; MAX RATE 31.2 BBL MAX PRESSURE 4329, MAX PPG 6.09 INTERVAL 11 BALL SIZE 3.07"; 227,155 LB PROPPANT PLACED; 2920 BBL SLURRY PUMPED; MAX RATE 32.8 MAX PRESSURE 4569 MAX PPG 6.06 THIRD INTERVAL OMITTED FOR THE DAY DUE TO GEL BULKER BLOCKAGE 12/13/2022 00:01 12/13/2022 23:59 10447750 RESUMED PUMPING INTERVAL 8 AND COMPLETED INTERVAL 9 INTERVAL 8 BALL SIZE 2.946" NO SEATING OBSERVED, CONTINUED INTERVAL TOTAL PROPPANT PLACED ON SECOND DAY PUMPING INTERVAL 8, 160,000 LB. TOTAL SLURRY VOLUME DAY 2, 2154 BBL INTERVAL 9 PUMPED TO DESIGN BALL SIZE 2.987" TOTAL PROPANT PLACED 228,389 LB NO 100 MESH DUE TO CASTLE GATE FAILURE TOTAL SLURRY VOLUME 2,958 BBL SHUT DOWN FOR HALLIBURTON GEL BAULKER VALVE FAILURE, 12/12/2022 00:01 12/12/2022 23:59 10447750 DOWN FOR REPAIRS Page 2/2 MT7-06 Report Printed: 1/4/2023 AOGCC Well History Report Daily Operations Start Date End Date AFE / RFE Last 24hr Sum 12/11/2022 00:01 12/11/2022 23:59 10447750 STARTED STIM ON INTERVAL 8 , DURING THE 4LB SAND STAGE THE ADP BLENDER DEVELOPED A LEAK ON THE WATER INJECTION MANIFOLD FOR THE MIXING BOWL, SAND WAS CUT, WELL WAS FLUSHED, 59589LB OF PROPPANT WAS PLACED. INTERVAL 8 (BALL SIZE 2.946") BREAKDOWN psi 5514, TOTAL PROPPANT 55589 lbs TOTAL CLEAN VOLUME 3302 bbls THE REPLACEMENT PART WILL BE SHIPPED IN FROM PRUDHOE SHOP TOMORROW AND INSTALLED, PLAN TO RESUME OPERATIONS ON STAGE 8 ON TUESDAY. 12/10/2022 00:01 12/10/2022 23:59 10447750 COMPLETED STAGES 6 AND 7 TO DESIGN STAGE #6 BALL SIZE 2.866" BREAKDOWN psi 5857 TOTAL PROPPANT 228207 lbs.TOTAL CLEAN VOLUME 2782 bbls. MAX RATE 30.7 bpm MAX psi 5210 MAX ppg 6.10 STAGE #7 BALL SIZE 2.906 BREAKDOWN psi 6592 TOTAL PROPPANT 228968 lbs.TOTAL CLEAN VOLUME 2937 bbls. MAX RATE 30.2 bpm MAX psi 4854 MAX ppg 6.16 12/9/2022 00:01 12/9/2022 23:59 10447750 COMPLETED STAGES 4 AND 5 TO DESIGN STAGE #4 BALL SIZE 2.787" BREAKDOWN psi 6146 TOTAL PROPPANT 232476 lbs.TOTAL CLEAN VOLUME 2800 bbls. MAX RATE 30 bpm MAX psi 5260 MAX ppg 6.06 STAGE #5 BALL SIZE 2.826 BREAKDOWN psi 6882 TOTAL PROPPANT 233474 lbs.TOTAL CLEAN VOLUME 3094 bbls. MAX RATE 30 bpm MAX psi 5260 MAX ppg 6.16 12/8/2022 05:00 12/8/2022 23:59 10447750 COMPLETED STAGES 2 AND 3 TO DESIGN STAGE #2; BALL SIZE 2.71" TOTAL PROPPANT PLACED; 230,918 lbsTOTAL CLEAN VOLUME; 2981 bbls.MAX RATE 30.3 bpm, MAX psi. 5994 MAX ppg 5.26 STAGE #3; BALL SIZE 2.749" TOTAL PROPPANT PLACED; 233806 lbsTOTAL CLEAN VOLUME; 3134 bbls.MAX RATE 30.1 bpm, MAX psi. 6428 MAX ppg 5.97 12/7/2022 06:00 12/7/2022 23:59 10447750 TRAVELED TO ALPINE, PICKED UP SHIPPED ITEMS AT CD1, INSTALLED NEW DISCHARGE HOSES, STARTED AND FUNCTION TESTED EQUIPMENT 12/6/2022 06:00 12/6/2022 18:00 10447750 HALLIBURTON CREW & COP REP MAKE CHANGE OUT. STAND BY UNTIL 1ST AVAILABLE FLIGHT TO ALPINE ON WEDNESDAY. NEW DISCHARGE HOSES AND VALVE ARRIVED IN ALPINE 12/5/2022 00:00 12/6/2022 00:00 10447750 HALLILBURTON CREW & COP REP MOBILIZE TO KUPARUK FOR CHANGE OUT ON TUESDAY. DUE TO NO EAST WEST FLIGHTS TO KUPARUK ON TUESDAY. 12/4/2022 05:00 12/5/2022 00:00 10447750 FINISH RIGGING UP EQUIPMENT THAT ARRIVED LAST NIGHT. PUMP D-FIT & MINI FRAC. DURING STAGE #1 HAD PUMP ISSUES & A HOSE FAILURE THAT LED TO FLUSH. MAKE PUMP REPAIRS & REPLACE HOSE. DURING NEXT ATTEMPT HAD 2ND HOSE PIN HOLE, BUT WAS ABLE TO ISOLATE THE HOSE & CONTINUE. STIMULATE STAGE #1 w/ 228,446 LBS OF 20/40 UP TO A 5.36 PPG. IN PROGRESS 12/3/2022 06:00 12/3/2022 18:00 10447750 GET CONFIRMATION THAT EQUIPMENT WILL ARRIVE IN ALPINE VIA HERC @ ~1:00 PM. BEGIN LOADING WATER TANKS & PREPPING TO PUMP TOMORROW. EQUIPMENT DID NOT ARRIVE IN ALPINE UNTIL 7:00 PM. IN PROGRESS 12/2/2022 06:00 12/2/2022 18:00 10447750 LOAD CHEMS & DRY PRODUCT. RIG UP GOAT HEAD, STANDPIPES TO THE WELL & FRONT YARD IRON. RIGGED UP DOWNHOLE GAUGE. STANDBY FOR FRAC EQUIPMENT TO ARRIVE ON THE HERC. IN PROGRESS. 12/1/2022 06:00 12/1/2022 18:00 10447750 MOBILIZE TO ALPINE. WORK ON GETTING EQUIPMENT RUNNING & START PREPPING FOR THE JOB. MOST OF THE EQUIPMENT SHIPPED VIA HERC DID NOT MAKE IT TO ALPINE. IN PROGRESS Last Tag Annotation Depth (ftKB) Wellbore End Date Last Mod By Last TAG: MT7-06A oberr Last Rev Reason Annotation Wellbore End Date Last Mod By Rev Reason: Pre Flowback GLVD MT7-06A 12/31/2022 oberr Notes: General & Safety Annotation End Date Last Mod By NOTE: oberr Casing Strings Csg Des OD (in) ID (in) Top (ftKB) Set Depth (ftKB) Set Depth (TVD) (ftKB) Wt/Len (lb/ft) Grade Top Thread Intermediate 9 5/8 8.68 37.0 10,177.0 7,438.3 43.50 L80 Hyd563 Scab Liner 8.3 6.23 9,631.2 9,681.3 7,119.8 26.00 L-80 Liner 7 6.18 9,672.3 12,275.0 8,295.0 29.00 L-80 TSH 563 LINER 4 1/2 3.96 12,097.8 26,619.0 8,465.0 12.60 P-110 Hyd 563 Tubing Strings: string max indicates LONGEST segment of string Top (ftKB) 34.6 Set Depth 12,104.3 Set Depth 8,249.5 String Ma 4 1/2 Tubing Description Tubing Completion Upper Wt (lb/ft) 12.60 Grade L-80 Top Connection Hyd563 ID (in) 3.96 Completion Details: excludes tubing, pup, space out, thread, RKB... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 34.6 34.6 0.00 Hanger 11.000 FMC 4-1/2" Tubing Hanger Hydril HYD 563 Min ID 3.92" FMC TC-EMS 3.958 2,068.0 2,028.0 24.87 Nipple - X 4.500 NIPPLE,LANDING,4 1/2","X",3.813", H563 HES X Nipple 3.813 4,028.3 3,474.9 45.92 Mandrel 4.500 4-1/2" x 1" KBG 4-5 GLM,12.6# H563 Camco KBG4-5 3.865 7,917.2 5,984.6 50.00 Mandrel 4.500 4-1/2" x 1" KBG4-5 GLM, 12.6# H563 Camco KBG4-5 3.860 11,761.9 8,144.5 70.77 Mandrel 4.500 4-1/2" x 1" KBG4-5 GLM, 12.6# H563 Camco KBG4-5 3.860 11,869.2 8,179.0 71.62 Gauge / Pump Sensor 4.500 Halliburton Opsis Mandrel w/ Downhole guage HES DHG 3.920 12,073.8 8,240.8 73.34 Nipple - DB 4.500 NIPPLE,LANDING,4 1/2",DB,3.75", H563 SLB DB-6 nipple 3.750 Other In Hole (Wireline retrievable plugs, valves, pumps, fish, etc.) Top (ftKB) Top (TVD) (ftKB)Top Incl (°)Des Com Make Model SN Run Date ID (in) 37.2 37.2 0.00 EMERGENCY SLIPS Set 9 5/8" E-slips as per FMC w/ 347k. FMC 10/10/2022 7.625 Mandrel Inserts : excludes pulled inserts Top (ftKB) Top (TVD) (ftKB) Top Incl (°) St ati on No /S Serv Valve Type Latch Type OD (in) TRO Run (psi) Run Date Com Make Model Port Size (in) 4,028.3 3,474.9 45.92 1 GAS LIFT GLV BK 1 1,810.0 12/24/2022 CAMCO 0.188 7,917.2 5,984.6 50.00 2 GAS LIFT GLV BK 1 1,782.0 12/24/2022 CAMCO 0.188 11,761.9 8,144.5 70.77 3 GAS LIFT OV BK 1 12/24/2022 CAMCO 0.313 Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 9,672.3 7,114.0 49.86 Packer 8.300 Baker 7" x 9.625" HRDE ZXP HD Liner Top Packer Baker ZXP HD 6.230 12,186.0 8,271.9 74.48 Landing Collar 7.000 7" Baker Landing Collar H563 Loose Baker LFC 6.200 12,669.9 8,380.2 80.59 FRAC Sleeve/Port 5.000 Advanced Upstream Re-closeable frac sleeve, Hyd563 C110 (SN:107343-000006) Advance d Upstrea m 3.505 12,754.6 8,393.0 82.08 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #22, Hyd563 C110 SN:(H809340004) 3.464" Ball OD Baker 3.429 13,090.1 8,421.7 88.03 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 20 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 13,441.0 8,431.9 88.36 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #21, Hyd563 C110 SN:(H809340005) 3.419" Ball OD Baker 3.383 13,776.9 8,435.7 90.13 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 19 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 14,128.4 8,435.4 89.51 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #20, Hyd563 C110 SN:(H809340006) 3.373" Ball OD Baker 3.339 14,462.4 8,440.8 88.45 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 18 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 14,811.1 8,452.6 88.89 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #19, Hyd563 C110 SN:(H809340007) 3.329" Ball OD Baker 3.294 15,146.2 8,452.8 90.29 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 17 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 15,496.9 8,451.8 90.08 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #18, Hyd563 C110 SN:(H809340008) 3.284" Ball OD Baker 3.251 15,832.6 8,451.2 90.05 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 16 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 HORIZONTAL, MT7-06A, 1/4/2023 9:43:47 AM Vertical schematic (actual) LINER; 12,097.8-26,619.0 Shoe; 26,614.2-26,619.0 FRAC Sleeve/Port; 26,568.8- 26,572.7 Swell Packer; 26,216.0-26,236.8 FRAC Sleeve/Port; 25,883.4- 25,887.3 Swell Packer; 25,532.8-25,553.8 FRAC Sleeve/Port; 25,197.1- 25,201.0 Swell Packer; 24,844.6-24,865.6 FRAC Sleeve/Port; 24,509.0- 24,512.9 Swell Packer; 24,157.2-24,178.0 FRAC Sleeve/Port; 23,821.7- 23,825.6 Swell Packer; 23,429.2-23,450.2 FRAC Sleeve/Port; 23,093.5- 23,097.3 Swell Packer; 22,703.7-22,724.0 FRAC Sleeve/Port; 22,370.2- 22,374.0 Swell Packer; 21,976.7-21,997.5 FRAC Sleeve/Port; 21,641.9- 21,645.8 Swell Packer; 21,248.6-21,268.4 FRAC Sleeve/Port; 20,912.7- 20,916.6 Swell Packer; 20,520.8-20,541.6 FRAC Sleeve/Port; 20,185.1- 20,188.9 Swell Packer; 19,790.9-19,811.7 FRAC Sleeve/Port; 19,455.1- 19,459.0 Swell Packer; 19,061.2-19,082.0 FRAC Sleeve/Port; 18,725.5- 18,729.4 Swell Packer; 18,331.7-18,352.6 FRAC Sleeve/Port; 17,954.8- 17,958.7 Swell Packer; 17,561.5-17,582.2 FRAC Sleeve/Port; 17,184.6- 17,188.5 Swell Packer; 16,831.8-16,852.7 FRAC Sleeve/Port; 16,496.3- 16,500.2 Swell Packer; 16,143.7-16,164.4 Swell Packer; 15,832.6-15,853.5 FRAC Sleeve/Port; 15,496.9- 15,500.8 Swell Packer; 15,146.2-15,167.1 FRAC Sleeve/Port; 14,811.1- 14,814.9 Swell Packer; 14,462.4-14,483.2 FRAC Sleeve/Port; 14,128.4- 14,132.3 Swell Packer; 13,776.9-13,797.7 FRAC Sleeve/Port; 13,441.0- 13,444.9 Swell Packer; 13,090.1-13,110.9 FRAC Sleeve/Port; 12,754.6- 12,758.5 FRAC Sleeve/Port; 12,669.9- 12,671.9 Liner; 9,672.3-12,275.0 Float Shoe; 12,271.4-12,275.0 Collar - Float; 12,211.8-12,213.7 Landing Collar; 12,186.0- 12,189.4 Hanger; 12,114.2-12,123.5 Packer (Liner Top); 12,097.8- 12,114.2 Nipple - DB; 12,073.8 Packer (Tubing); 11,970.0 Gauge / Pump Sensor; 11,869.1 Mandrel; 11,761.9 Intermediate String 2 Cement; 10,557.0 ftKB Intermediate; 37.0-10,177.0 Casing Shoe; 10,173.9-10,177.0 Collar - Float; 10,084.8-10,087.6 Hanger; 9,689.4-9,698.7 Scab Liner; 9,631.2-9,681.3 Packer; 9,672.3-9,689.4 Baker 7" Tie Back Bullet Seal Assy (1' Above fully located); 9,659.6-9,681.3 Baker 7" x 9.625" SLZXP (HRD0E) Liner Top HNGR Packer ; 9,631.2-9,659.6 Mandrel; 7,917.2 Intermediate String 1 Cement; 5,038.0 ftKB Mandrel; 4,028.3 SURFACE; 36.1-3,425.0 Float Shoe; 3,423.2-3,425.0 Float Collar; 3,343.1-3,344.3 Cross Over; 2,200.1-2,202.9 Nipple - X; 2,068.0 CONDUCTOR; 40.0-120.0 Casing Hanger; 36.1-39.6 Casing Hanger; 37.0-38.0 EMERGENCY SLIPS; 37.2 Hanger; 34.6 WNS PROD KB-Grd (ft) 39.50 RR Date 10/10/202 1 Other Elev MT7-06A ... TD Act Btm (ftKB) 26,634.0 Well Attributes Field Name RENDE Wellbore API/UWI 501032083101 Wellbore Status PROD Max Angle & MD Incl (°) 92.74 MD (ftKB) 26,418.34 WELLNAME WELLBOREMT7-06A Annotation Last WO: End Date 11/15/2022 H2S (ppm) DateComment Liner Details: Excludes Liner, Pup, Joints, casing, float, sub, shoe... Top (ftKB) Top (TVD) (ftKB) Top Incl (°) Item Des OD Nominal (in)Com Make Model Nominal ID (in) 16,143.7 8,450.8 90.07 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 15 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 16,496.3 8,450.0 90.20 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #17, Hyd563 C110 SN:(H809340009) 3.241" Ball OD Baker 3.207 16,831.8 8,454.3 88.35 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 14 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 17,184.6 8,460.0 89.64 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #16, Hyd563 C110 SN:(H809340010) 3.197" Ball OD Baker 3.164 17,561.5 8,462.5 89.67 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 13 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 17,954.8 8,465.5 89.02 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #15, Hyd563 C110 SN:(H809340011) 3.154" Ball OD Baker 3.122 18,331.7 8,471.9 88.60 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 12 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 18,725.5 8,483.5 88.85 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #14, Hyd563 C110 SN:(H809340012) 3.112" Ball OD Baker 3.080 19,061.2 8,485.9 90.10 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 11 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 19,455.1 8,485.1 90.18 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #13, Hyd563 C110 SN:(H809340013) 3.070" Ball OD Baker 3.038 19,790.9 8,484.4 90.08 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 10 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 20,185.1 8,478.0 91.92 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #12, Hyd563 C110 SN:(H809340014) 3.028" Ball OD Baker 2.997 20,520.8 8,471.8 89.52 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 9 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 20,912.7 8,475.8 89.11 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #11, Hyd563 C110 SN:(H809340015) 2.987" Ball OD Baker 2.956 21,248.6 8,477.6 90.24 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 8 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 21,642.0 8,476.1 90.25 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #10, Hyd563 C110 SN:(H809340016) 2.946" Ball OD Baker 2.916 21,976.7 8,475.1 90.16 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 7 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 22,370.2 8,474.2 90.24 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #9, Hyd563 C110 SN:(H809340017) 2.906" Ball OD Baker 2.876 22,703.7 8,473.3 90.14 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 6 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 23,093.5 8,480.8 88.16 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #8, Hyd563 C110 SN:(H809340018) 2.866" Ball OD Baker 2.836 23,429.3 8,493.3 87.89 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 5 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 23,821.7 8,501.0 89.47 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #7, Hyd563 C110 SN:(H809340019) 2.826" Ball OD Baker 2.797 24,157.2 8,502.5 90.44 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 4 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 24,509.0 8,500.2 90.39 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #6, Hyd563 C110 SN: (H809340020) 2.787" Ball OD Baker 2.759 24,844.6 8,497.8 90.47 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 3 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 25,197.1 8,493.6 90.50 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #5, Hyd563 C110 SN:(H809340021) 2.749" Ball OD Baker 2.720 25,532.8 8,491.6 89.86 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 2 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 25,883.5 8,489.6 90.57 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #4, Hyd563 C110 SN: (H809340022) 2.710" Ball OD Baker 2.682 26,216.1 8,481.3 92.16 Swell Packer 4.500 Baker 5.5" OD Swell Packer # 1 (assy ), 4-1/2",12.6#, P110, H563 Baker Rapidswell 922 3.900 26,568.8 8,467.0 92.24 FRAC Sleeve/Port 5.000 Baker CMB 2.0 Frac Sleeve #3, Hyd563 C110 SN:(H809340023) 2.672" Ball OD Baker 2.645 HORIZONTAL, MT7-06A, 1/4/2023 9:43:48 AM Vertical schematic (actual) LINER; 12,097.8-26,619.0 Shoe; 26,614.2-26,619.0 FRAC Sleeve/Port; 26,568.8- 26,572.7 Swell Packer; 26,216.0-26,236.8 FRAC Sleeve/Port; 25,883.4- 25,887.3 Swell Packer; 25,532.8-25,553.8 FRAC Sleeve/Port; 25,197.1- 25,201.0 Swell Packer; 24,844.6-24,865.6 FRAC Sleeve/Port; 24,509.0- 24,512.9 Swell Packer; 24,157.2-24,178.0 FRAC Sleeve/Port; 23,821.7- 23,825.6 Swell Packer; 23,429.2-23,450.2 FRAC Sleeve/Port; 23,093.5- 23,097.3 Swell Packer; 22,703.7-22,724.0 FRAC Sleeve/Port; 22,370.2- 22,374.0 Swell Packer; 21,976.7-21,997.5 FRAC Sleeve/Port; 21,641.9- 21,645.8 Swell Packer; 21,248.6-21,268.4 FRAC Sleeve/Port; 20,912.7- 20,916.6 Swell Packer; 20,520.8-20,541.6 FRAC Sleeve/Port; 20,185.1- 20,188.9 Swell Packer; 19,790.9-19,811.7 FRAC Sleeve/Port; 19,455.1- 19,459.0 Swell Packer; 19,061.2-19,082.0 FRAC Sleeve/Port; 18,725.5- 18,729.4 Swell Packer; 18,331.7-18,352.6 FRAC Sleeve/Port; 17,954.8- 17,958.7 Swell Packer; 17,561.5-17,582.2 FRAC Sleeve/Port; 17,184.6- 17,188.5 Swell Packer; 16,831.8-16,852.7 FRAC Sleeve/Port; 16,496.3- 16,500.2 Swell Packer; 16,143.7-16,164.4 Swell Packer; 15,832.6-15,853.5 FRAC Sleeve/Port; 15,496.9- 15,500.8 Swell Packer; 15,146.2-15,167.1 FRAC Sleeve/Port; 14,811.1- 14,814.9 Swell Packer; 14,462.4-14,483.2 FRAC Sleeve/Port; 14,128.4- 14,132.3 Swell Packer; 13,776.9-13,797.7 FRAC Sleeve/Port; 13,441.0- 13,444.9 Swell Packer; 13,090.1-13,110.9 FRAC Sleeve/Port; 12,754.6- 12,758.5 FRAC Sleeve/Port; 12,669.9- 12,671.9 Liner; 9,672.3-12,275.0 Float Shoe; 12,271.4-12,275.0 Collar - Float; 12,211.8-12,213.7 Landing Collar; 12,186.0- 12,189.4 Hanger; 12,114.2-12,123.5 Packer (Liner Top); 12,097.8- 12,114.2 Nipple - DB; 12,073.8 Packer (Tubing); 11,970.0 Gauge / Pump Sensor; 11,869.1 Mandrel; 11,761.9 Intermediate String 2 Cement; 10,557.0 ftKB Intermediate; 37.0-10,177.0 Casing Shoe; 10,173.9-10,177.0 Collar - Float; 10,084.8-10,087.6 Hanger; 9,689.4-9,698.7 Scab Liner; 9,631.2-9,681.3 Packer; 9,672.3-9,689.4 Baker 7" Tie Back Bullet Seal Assy (1' Above fully located); 9,659.6-9,681.3 Baker 7" x 9.625" SLZXP (HRD0E) Liner Top HNGR Packer ; 9,631.2-9,659.6 Mandrel; 7,917.2 Intermediate String 1 Cement; 5,038.0 ftKB Mandrel; 4,028.3 SURFACE; 36.1-3,425.0 Float Shoe; 3,423.2-3,425.0 Float Collar; 3,343.1-3,344.3 Cross Over; 2,200.1-2,202.9 Nipple - X; 2,068.0 CONDUCTOR; 40.0-120.0 Casing Hanger; 36.1-39.6 Casing Hanger; 37.0-38.0 EMERGENCY SLIPS; 37.2 Hanger; 34.6 WNS PROD MT7-06A ... WELLNAME WELLBOREMT7-06A Hydraulic Fracturing Fluid Product Component Information Disclosure 2022-12-04 Alaska HARRISON BAY 50-103-208301 CONOCOPHILLIPS MT7 06A -151.6945 70.1728 NAD83 none Oil 8503 2564295 Hydraulic Fracturing Fluid Composition: Trade Name Supplier Purpose Ingredients Chemical Abstract Service Number (CAS #) Maximum Ingredient Concentration in Additive (% by mass)** Maximum Ingredient Concentration in HF Fluid (% by mass)** Ingredient Mass lbs Comments Company First Name Last Name Email Phone SEAWATER (SG 8.52) Halliburton Base Fluid Water 7732-18-5 100.00%81.88097%21847794 Density = 8.52 Halliburton BE-6(TM) Bactericide Halliburton Microbiocide Listed Below Listed Below 0 CL-22 UC Halliburton Crosslinker Listed Below Listed Below 0 CL-28M CROSSLINKER Halliburton Crosslinker Listed Below Listed Below 0 LoSurf-300D Halliburton Non-ionic Surfactant Listed Below Listed Below 0 LVT-200 Baker Hughes Additive Listed Below Listed Below 0 NA MO-67 Halliburton pH Control Listed Below Listed Below 0 OPTIFLO-III DELAYED RELEASE BREAKER Halliburton Breaker Listed Below Listed Below 0 SP BREAKER Halliburton Breaker Listed Below Listed Below 0 WG-36 GELLING AGENT Halliburton Gelling Agent Listed Below Listed Below 0 Ceramic Proppant - Wanli Wanli Proppant Listed Below Listed Below 0 NA Sand-Common White-100 Mesh, SSA-2 Halliburton Proppant Listed Below Listed Below 0 Ingredients Listed Above Listed Above 1,2,4 Trimethylbenzene 95-63-6 1.00%0.00070%188 2-Bromo-2-nitro-1,3-propanediol 52-51-7 100.00%0.00144%385 2-Methyl-4-isothiazolin-3-one 2682-20-4 0.01%0.00002%7 5-Chloro-2-methyl-3(2H)- Isothaiazolone 26172-55-4 0.01%0.00002%7 Acrylate polymer Proprietary 1.00%0.00000%0 Denise Tuck, Halliburton, 3000 N. Sam Houston Pkwy E., Houston, TX 77032, 281-871- 6226 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Ammonium persulfate 7727-54-0 100.00%0.01874%5000 Borate salts Proprietary 60.00%0.14752%39364 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Calcium magnesium carbonate 16389-88-1 1.00%0.00246%657 Corundum 1302-74-5 65.00%10.71028%2857759 Crystalline silica, quartz 14808-60-7 100.00%0.16608%44315 Distillates (petroleum), hydrotreated light 64742-47-8 100.00%0.74614%199089 Ethanol 64-17-5 60.00%0.04225%11273 Gluteraldehyde 111-30-8 1.00%0.00246%657 Guar gum 9000-30-0 100.00%0.33677%89859 Heavy aromatic petroleum naphtha 64742-94-5 30.00%0.02112%5637 Inorganic mineral 1317-65-3 5.00%0.01229%3281 Inorganic mineral Proprietary 1.00%0.00246%657 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Magensium chloride 7786-30-3 0.01%0.00002%7 Magnesium nitrate 10377-60-3 0.01%0.00002%7 Methanesulfonic acid, 1-hydroxy-, sodium salt 870-72-4 0.10%0.00025%66 Mullite 1302-93-8 45.00%7.41481%1978449 Naphthalene 91-20-3 5.00%0.00352%940 Oxyalkylated nonyl phenolic resin Proprietary 30.00%0.02112%5637 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Oxyalkylated phenolic resin Proprietary 10.00%0.00704%1879 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Oxylated phenolic resin Proprietary 30.00%0.00562%1500 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Poly(oxy-1,2-ethanediyl), alpha-(4- nonylphenyl)-omega-hydroxy-, branched 127087-87-0 5.00%0.00352%940 Polymer Proprietary 1.00%0.00246%657 Halliburton Denise Tuck Denise.Tuck @Halliburton. com 281-871-6226 Potassium chloride 7447-40-7 5.00%0.01229%3281 Potassium formate 590-29-4 30.00%0.00000%0 Sodium bisulfate 7681-38-1 0.10%0.00025%66 Sodium carboxymethyl cellulose 9004-32-4 1.00%0.00000%0 Sodium chloride 7647-14-5 5.00%4.09467%1092556 Sodium glycolate 2836-32-0 1.00%0.00000%0 Sodium hydroxide 1310-73-2 30.00%0.01862%4969 Sodium persulfate 7775-27-1 100.00%0.00000%0 Sodium sulfate 7757-82-6 0.10%0.00000%0 Water 7732-18-5 100.00%0.20960%55926 * Total Water Volume sources may include fresh water, produced water, and/or recycled water _ ** Information is based on the maximum potential for concentration and thus the total may be over 100% Note: For Field Development Products (products that begin with FDP), MSDS level only information has been provided.Version web 1.3 All component information listed was obtained from the suppliers Material Safety Data Sheets (MSDS). As such, the Operator is not responsible for inaccurate and/or incomplete information. Any questions regarding the content of the MSDS should be directed to the supplier who provided it. The Occupational Safety and Health Administrations (OSHA) regulations govern the criteria for the disclosure of this information. Please note that Federal Law protects "proprietary", "trade secret", and "confidential business information" and the criteria for how this information is reported on an MSDS is subject to 29 CFR 1910.1200(i) and Appendix D. Production Type: True Vertical Depth (TVD): Total Water Volume (gal)*: MSDS and Non-MSDS Ingredients are listed below the green line Well Name and Number: Longitude: Latitude: Long/Lat Projection: Indian/Federal: Fracture Date State: County: API Number: Operator Name: Hydraulic Fracturing Fluid Product Component Information DisclosureHydraulic Fracturing Fluid Composition:Job Start Date:12/4/2022Job End Date:12/20/2022State:AlaskaCounty:Harrison BayAPI Number:50-103-20830-10-00Operator Name:ConocoPhillips Company/Burlington ResourcesWell Name and Number:MT7-06ALatitude:70.17318900Longitude:-151.69102100Datum:NAD27Federal Well:NOIndian Well:NOTrue Vertical Depth:8,464Total Base Water Volume (gal):2,564,295Total Base Non Water Volume:128,215Trade NameSupplierPurposeIngredientsChemicalAbstractServiceNumber(CAS #)MaximumIngredientConcentrationin Additive (% by mass)**MaximumIngredientConcentrationin HF Fluid (% by mass)**CommentsSEAWATER (SG 8.52)HalliburtonBase FluidWater7732-18-5100.0000081.88097Density = 8.52IngredientsListed AboveListed AboveWater7732-18-5100.000000.20960 LoSurf-300DHalliburtonNon-ionicSurfactantListed BelowSP BREAKERHalliburtonBreakerListed BelowWG-36 GELLING AGENTHalliburtonGelling AgentListed BelowMO-67HalliburtonpH ControlListed BelowSand-CommonWhite-100 Mesh, SSA-2HalliburtonProppantListed BelowCeramicProppant - WanliWanliProppantListed BelowOPTIFLO-IIIDELAYEDRELEASEBREAKERHalliburtonBreakerListed BelowCL-28MCROSSLINKERHalliburtonCrosslinkerListed Below BE-6(TM)BactericideHalliburtonMicrobiocideListed BelowLVT-200Baker HughesAdditiveListed BelowCL-22 UCHalliburtonCrosslinkerListed BelowCorundum1302-74-565.0000010.71028Mullite1302-93-845.000007.41481Sodium chloride7647-14-55.000004.09467Distillates (petroleum), hydrotreated light64742-47-8100.000000.74614Guar gum9000-30-0100.000000.33677Crystalline silica, quartz14808-60-7100.000000.16608Borate saltsProprietary60.000000.14752Ethanol64-17-560.000000.04225Oxyalkylated nonyl phenolic resinProprietary30.000000.02112Heavy aromatic petroleum naphtha64742-94-530.000000.02112Ammonium persulfate7727-54-0100.000000.01874Sodium hydroxide1310-73-230.000000.01862Potassium chloride7447-40-75.000000.01229Inorganic mineral1317-65-35.000000.01229Oxyalkylated phenolic resinProprietary10.000000.00704Oxylated phenolic resinProprietary30.000000.00562Items above are Trade Names with the exception of Base Water . Items below are the individual ingredients. * Total Water Volume sources may include various types of water including fresh water, produced water, and recycled water ** Information is based on the maximum potential for concentration and thus the total may be over 100%*** If you are calculating a percentage of total ingredients do not add the water volume below the green line to the water volume above the green lineNote: For Field Development Products (products that begin with FDP), MSDS level only information has been provided.Ingredient information for chemicals subject to 29 CFR 1910.1200(i) and Appendix D are obtained from suppliers Material Safety Data Sheets (MSDS)Poly(oxy-1,2-ethanediyl),alpha-(4-nonylphenyl)-omega-hydroxy-,branched127087-87-05.000000.00352Naphthalene91-20-35.000000.00352Inorganic mineralProprietary1.000000.00246Gluteraldehyde111-30-81.000000.00246PolymerProprietary1.000000.00246Calcium magnesium carbonate16389-88-11.000000.002462-Bromo-2-nitro-1,3-propanediol52-51-7100.000000.001441,2,4 Trimethylbenzene95-63-61.000000.00070Methanesulfonic acid, 1-hydroxy-, sodium salt870-72-40.100000.00025Sodium bisulfate7681-38-10.100000.00025Magnesium nitrate10377-60-30.010000.000025-Chloro-2-methyl-3(2H)-Isothaiazolone26172-55-40.010000.000022-Methyl-4-isothiazolin-3-one2682-20-40.010000.00002Magensium chloride7786-30-30.010000.00002Sodium carboxymethyl cellulose9004-32-41.00000Acrylate polymerProprietary1.00000Sodium sulfate7757-82-60.10000Potassium formate590-29-430.00000Sodium persulfate7775-27-1100.00000Sodium glycolate2836-32-01.00000 T + 1 337.856-7201 1058 Baker Hughes Drive Broussard, LA 70518, USA Dec 02, 2022 AOGCC Attention: Natural Resources Technician 333 W. 7th Ave., Suite 100 Anchorage, Alaska 99501-3539 Subject:Final Log Distribution for ConocoPhillips Alaska, Inc. MT7-06A Greater Mooses Tooth API #: 50-103-20831-01 Permit No: 222-108 Rig: Doyon 25 The final deliverables were uploaded via https://copsftp.sharefile.com/ for the above well. Items delivered: MWD/LWD Digital Las Data, Graphic Images CGM/PDF and Survey Files. MT7-06A is located in a federal oil and gas unit. Only with respect to the MT7-06A Well Data, CPAI hereby waives its right to indefinite confidentiality, under 5 U.S.C. 552(b)(4) and (9). Nothing in this communication should be construed as a waiver of indefinite confidentiality on any other wells. Please note that for wells not on State land, a state agency should seek consent from the landowner prior to the release of well data by the state agency. See, e.g., AS 43.55.025(f)(2)(C)(i). Here, the landowner is the Bureau of Land Management (BLM) and/or Arctic Slope Regional Corporation (ASRC). Thank you. Signature of receiver & date received: Please return transmittal letter to: Garrett Brown Garrett.Brown@conocophillips.com Luis Arismendi Luis.arismendi@bakerhughes.com By Meredith Guhl at 1:33 pm, Dec 02, 2022 222-108 T37354 Meredith Guhl Digitally signed by Meredith Guhl Date: 2022.12.02 13:33:48 -09'00' 1a. Well Status:Oil SPLUG Other Abandoned Suspended 1b. Well Class: 20AAC 25.105 20AAC 25.110 Development Exploratory GINJ WINJ WDSPL No. of Completions: ___________________ Service Stratigraphic Test 2. Operator Name:6. Date Comp., Susp., or 14. Permit to Drill Number / Sundry: Aband.: 3. Address: 7. Date Spudded: 15. API Number: 4a. Location of Well (Governmental Section): 8. Date TD Reached: 16. Well Name and Number: Surface: 9. Ref Elevations: KB: 17. Field / Pool(s): GL: 100.9 BF: 3465' FSL, 3284' FWL S20 T9N R2E UM 10. Plug Back Depth MD/TVD: 18. Property Designation: 4b. Location of Well (State Base Plane Coordinates, NAD 27): 11. Total Depth MD/TVD: 19. DNR Approval Number: Surface: x- y- Zone- 4 TPI: x- y- Zone- 4 12. SSSV Depth MD/TVD: 20. Thickness of Permafrost MD/TVD: Total Depth: x- y- Zone- 4 5. Directional or Inclination Survey: Yes (attached) No 13. Water Depth, if Offshore: 21. Re-drill/Lateral Top Window MD/TVD: Submit electronic information per 20 AAC 25.050 N/A (ft MSL) 22. Logs Obtained: GR, RES, PWD, DIR, AZI, DEN, NEU, CALIPER, POROSITY, SONIC 23. BOTTOM 20" H-40 80' 13 3/8" L-80 3,052' 9.625" L-80 7,438' 7" L-80 8,295' 4.5" P-110 8,465 24. Open to production or injection? Yes No 25. 26. Was hydraulic fracturing used during completion? Yes No DEPTH INTERVAL (MD) AMOUNT AND KIND OF MATERIAL USED 27. Date First Production: Method of Operation (Flowing, gas lift, etc.): Hours Tested: Production for Gas-MSCF: Test Period Casing Press: Calculated Gas-MSCF: Oil Gravity - API (corr): Press. 24-Hour Rate Total Depth: STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION WELL COMPLETION OR RECOMPLETION REPORT AND LOG ConocoPhillips Alaska, Inc. WAG Gas 11/15/2022 222-108 12 1/4" 42" P.O. Box 100360, Anchorage, AK 99510-0360 5915791 11/6/2022 40' 50-103-20831-01-00 List all logs run and, pursuant to AS 31.05.030 and 20 AAC 25.071, submit all electronic data within 90 days of completion, TOP 284786 10/12/2022 43.5 80' 932535000, 932516000, 300840000 CASING GMTU MT7-06A968' FSL, 1859' FWL, S32 T10N R2E UM WT. PER FT. 289937 Top of Productive Interval: DEPTH SET (MD) 140.4 290904 TOP SETTING DEPTH MD 40' BOTTOM 26,634' MD/8,464'TVD GRADE 40' 3,425' 40' 16" 40' 10,177' HOLE SIZE ACID, FRACTURE, CEMENT SQUEEZE, ETC. If Yes, list each interval open (MD/TVD of Top and Bottom; Perforation Size and Number; Date Perfd): Lead: 73.2bbl 13ppg Class G Tail: 258.2bbl 15.8ppg Class G CEMENTING RECORD 12,104' MD SIZE AMOUNT PULLED 12.6 8,247 PACKER SET (MD/TVD) TUBING RECORD 6.5"12,097' Oil-Bbl: Date of Test: Oil-Bbl: Per 20 AAC 25.283 (i)(2) attach electronic information PRODUCTION TEST Choke Size:Water-Bbl: Flow Tubing Greater Mooses Tooth/ Rendevous N/A Liner 12,097' MD to 26,619' MD/ 8,247' TVD to 8,465' TVD Water-Bbl: 5910049 5897134 68 94 Sr Res EngSr Pet GeoSr Pet Eng Gas-Oil Ratio: 7,114' 8.5" x 9 7/8" 65bbl 15.8ppg Class G 364' FSL, 2019' FWL, S6 T09N R2E UM 26,619' 982'MD/981'TVD SETTING DEPTH TVD 40' AA081800, AA081781, AA081736 3,464' MD/ 3,078' TVD 4.5" 11,969' MD/8,208' TVD 12,097' MD/ 8,245' TVD 29 9,672' 12,275' Form 10-407 Revised 3/2020 Submit within 30 days of Completion, Suspension, or Abandonment By James Brooks at 8:20 am, Dec 14, 2022 Completed 11/15/2022 JSB RBDMS JSB 121622 GDSR-1/3/23 Conventional Core(s): Yes No Sidewall Cores: N/A 30. MD TVD Surface Surface 982 981 1662 1648 2028 1992 3348 3003 K-2 3880 3342 4227 3811 4536 4000 HRZ 10164 7430 Kalubik 10282 7503 Kapuruk C 10477 7617 LCU/Miluveach 10490 7624 Top of Productive Interval 12326 8307 (Alpine C): Formation at total depth 26634 8464 (TD): Alpine C 31. List of Attachments: Cement Report, Directional Survey, Well Schematic, Operations Summary 32. I hereby certify that the foregoing is true and correct to the best of my knowledge. Contact Name: Brad Gorham Contact Email:brad.gorham@conocophillips.com Authorized Contact Phone:907-265-6487 General: Item 1a: Item 1b: Item 4b: Item 9: Item 15: Item 19: Item 20: Item 22: Item 23: Item 24: Item 27: Item 28: Item 30: Item 31: K-3 If Yes, list formations and intervals cored (MD/TVD, From/To), and summarize lithology and presence of oil, gas or water (submit separate pages with this form, if needed). Submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results per 20 AAC 25.071. Yes No Well tested? Yes No 28. CORE DATA If yes, list intervals and formations tested, briefly summarizing test results. Attach separate pages to this form, if needed, and submit detailed test information, including reports, per 20 AAC 25.071. NAME Permafrost - Top Permafrost - Base 29. GEOLOGIC MARKERS (List all formations and markers encountered): FORMATION TESTS Review the reporting requirements of 20 AAC 25.071 and, pursuant to AS 31.05.030, submit all electronic data within 90 days of completion, suspension, or abandonment, whichever occurs first. Well Class - Service wells: Gas Injection, Water Injection, Water-Alternating-Gas Injection, Salt Water Disposal, Water Supply for Injection, Observation, or Other. Albian 97 C-10 INSTRUCTIONS Authorized Name: C-30 Authorized Title: Signature w/Date: Brad Gorham Drilling Engineer Pursuant to 20 AAC 25.070, attach to this form: well schematic diagram, summary of daily well operations, directional or inclination survey, and other tests as required including, but not limited to: core analysis, paleontological report, production or well test results. Report measured depth and true vertical thickness of permafrost. Provide MD and TVD for the top and base of permafrost in Box 29. Attached supplemental records should show the details of any multiple stage cementing and the location of the cementing tool. If this well is completed for separate production from more than one interval (multiple completion), so state in item 1, and in item 23 show the producing intervals for only the interval reported in item 26. (Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval). Provide a listing of intervals cored and the corresponding formations, and a brief description in this box. Pursuant to 20 AAC 25.071, submit detailed descriptions, core chips, photographs, and all subsequent laboratory analytical results, including, but not limited to: porosity, permeability, fluid saturation, fluid composition, fluid fluorescence, vitrinite reflectance, geochemical, or paleontology. Report the Division of Oil & Gas / Division of Mining Land and Water: Plan of Operations (LO/Region YY-123), Land Use Permit (LAS 12345), and/or Easement (ADL 123456) number. Albian 96 The Kelly Bushing, Ground Level, and Base Flange elevations in feet above Mean Sea Level. Use same as reference for depth measurements given in other spaces on this form and in any attachments. The API number reported to AOGCC must be 14 digits (ex: 50-029-20123-00-00). Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water Injection, Gas Injection, Shut-in, or Other (explain). Provide a listing of intervals tested and the corresponding formation, and a brief summary in this box. Submit detailed test and analytical laboratory information required by 20 AAC 25.071. This form and the required attachments provide a complete and concise record for each well drilled in Alaska. Submit a well schematic diagram with each 10-407 well completion report and 10-404 well sundry report when the downhole well design is changed. All laboratory analytical reports regarding samples or tests from a well must be submitted to the AOGCC, no matter when the analyses are conducted. Information to be attached includes, but is not limited to: summary of daily operations, wellbore schematic, directional or inclination survey, core analysis, paleontological report, production or well test results, per 20 AAC 25.070. Multiple completion is defined as a well producing from more than one pool with production from each pool completely segregated. Each segregated pool is a completion. TPI (Top of Producing Interval). Form 10-407 Revised 3/2020 Submit within 30 days of Completion, Suspension, or Abandonment Tubing / Liner Completion: 1) 4-½” X Landing Nipple (3.813" ID) 2) 4-½” x 1” KBG 4-5 GLM (3x) 3) HES Opsis Single Downhole Gauge 4) HES TNT Production Packer 5) 4-½” DB Landing Nipple (3.75" ID) 6) Liner Top Packer / Hanger w/ Tie Back sleeve 7) Frac Sleeves / Swell Packers 4-½” 12.6# P-110S Hyd563 Liner With 21 swell packers and 21x closeable frac sleeves Tubing 4-1/2" 12.6# L-80 Hyd563 X GLGL Production Packer 11,969' MD / 8,208' TVD ZXHD Liner Top Packer 12,097' MD / 8,245' TVD Downhole Gauge Logged Int1 TOC 5,038' MD / 4,135' TVD MT7-06A 4-String Southern Producer Final Schematic Actual Surveys, RKB = 139.5' AMSL 20" 94 ppf H-40 Insulated Conductor 80 feet, cemented to surface 16" Surface Hole Surface Casing 13-3/8" 68# L-80 Hyd563 Set at 3,425' MD / 3,052' TVD 12-¼” Intermediate 1 Hole Intermediate 1 Casing 9-5/8" 43.5# & 47# L-80 H563 Set @ 10,177' MD / 7,438' TVD Top HRZ 10,164' MD / 7,430' TVD Top Alpine D 12,191' MD / 8,273' TVD Top Alpine C 12,326' MD / 8,305' TVD 6-5/16” Production Hole TD at 26,634' MD / 8,461' TVD Logged Int2 TOC 10,557' MD / 7,660' TVD 8-½” X 9-7/8" Intermediate 2 Hole Intermediate 2 Liner 7" 29# L-80 HYD563 x 7" 29# TN-110SS TS-Blue Liner top at 9,631' MD / 7,087' TVD Shoe set @ 12,275' MD / 8,292' TVD MT7-06 Original Wellbore & Cement Plug Tubing / Liner Completion: 1) 4-½” X Landing Nipple (3.813" ID) 2) 4-½” x 1” GLM (2x) 3) HES Opsis Downhole Gauge 4) Production Packer 5) 4-½” DB Landing Nipple (3.75" ID) 6) Baker Frac Sleeve 8) Perf Joints 9) Northern Solutions Dissolving Shoe 20" 94 ppf H-40 Insulated Conductor 80 feet, cemented to surface 6-1/8” Production Hole TD at 22,382' MD / 8,229' TVD Tubing 4-1/2" 12.6# L-80 Hyd563 MT7-98wp05 X GLGL 3/29/2022 NMA Production Packer Downhole Gauge 16" Surface Hole Surface Casing 13-3/8" 68# L-80 Hyd563 Set at 3,394' MD / 3,052' TVD 8-½” X 9-7/8" Intermediate 2 Hole Intermediate 2 Liner 7" 26# L-80 HYD563 Liner top at +/- 8,890' MD / 7,352' TVD Shoe set @ +/- 10,557' MD / 8,311' TVD 12-¼” Intermediate 1 Hole Intermediate 1 Casing 9-5/8" 43.5# & 47# L-80 H563 Set @ +/- 9,039' MD / 7,462' TVD Top HRZ Prog. 8,964' MD 7403' TVD 4-String Northern Injector Proposed Schematic for PTD Top Alpine D Prog. 10,520' MD / 8,301' TVD Top Susitna Prog ~ +/- 7900' MD / 6,500' TVD Estimated Int1 TOC 500' MD above Susitna Estimated Int2 TOC +/- 9900' MD / 8050' TVD ~250' TVD above Alpine D Top Alpine C Prog. 10,713' MD / 8,347' TVD wp09, RKB = 139.5' AMSL 6-½” Production Hole 20" 94 ppf H-40 Insulated Conductor 80 feet, cemented to surface X GLGL GLGL 9/22/2021 CH 16" Surface Hole Surface Casing 13-3/8" 68# L-80 Hyd563 Set at 3,456' MD / 3,062' TVD 12-¼” Intermediate 1 Hole Intermediate 1 Casing 9-5/8" 43.5# L-80 TXP & 9-7/8" 62.8 Hyd523 Set at 8,681' MD / 7,465' TVD Top HRZ Prog. 8,581' MD / 7381' TVD Top Susitna Prog. 7,670' MD / 6,549' TVD Estimated Int1 TOC 500' MD above Susitna 4-½” 12.6# L-80 Hyd563 Liner w/ 4 swell packers and 4 closeable frac ports followed by perf joints to lateral TD 6-½” Production Hole TD at 21,822' MD / 8,248' TVD X GLGL GLGL 9/22/2021 CH 8-½” X 9-7/8" Intermediate 2 Hole Intermediate 2 Liner 7" 29# L-80 Hyd563 Liner top at +/- 8,581' MD / 7,380' TVD Shoe set at 10,105' MD / 8,291' TVD Top Alpine D Prog. 10,085' MD / 8,285' TVD Estimated Int2 TOC at 7" LTP +/- 100' inside Int1 casing Top Alpine C Prog. 10,197' MD / 8,314' TVD Page 1/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/22/2022 12:00 9/22/2022 15:00 3.00 MIRU, MOVE DMOB P Move pump complex to make room for coil unit. 0.0 0.0 9/22/2022 15:00 9/23/2022 00:00 9.00 MIRU, MOVE OTHR P Clean and clear rig floor, Work on pipe skate, change out pump liners from 5.5" to 6.5". Servicing plug valves, Inspect mud pit ISO valves, C/O butterfly valves in pits. 0.0 0.0 9/23/2022 00:00 9/23/2022 15:00 15.00 MIRU, MOVE OTHR P Continue rig PM's, cleanning and maintenance. Service valves on squeeze manifold Inspect mud pump and injection valves Organize rig floor cabinets Installl discharge skirt on centrifuge PM's on mud pits Inspect Demco valves on rig floor Check Koomy bottle pressure BW Maintinance on BOP Cellar Demco valve inspection Pipe skate maintiance 0.0 0.0 9/23/2022 15:00 9/23/2022 18:00 3.00 MIRU, MOVE OTHR P Disconnect pits interconnects, Secure energy track, Mud line/cement lines in derrick. Stow and pin C-Section. Weld on pipe skate. 0.0 0.0 9/23/2022 18:00 9/23/2022 21:00 3.00 MIRU, MOVE OTHR P Send cattle shoot to pipe shed, Skid rig floor to MOB position and L/D derrick. 0.0 0.0 9/23/2022 21:00 9/24/2022 00:00 3.00 MIRU, MOVE OTHR P Prep modules to move. Unpin Pipe shed from sub. 0.0 0.0 9/24/2022 00:00 9/24/2022 03:00 3.00 MIRU, MOVE OTHR P Pick up rig matts to prep for respotting. Unpin pip shed from sub. Prep to Move casing and pipe module. 0.0 0.0 9/24/2022 03:00 9/24/2022 06:00 3.00 MIRU, MOVE MOB P Stomp casing module away from pipe module. 0.0 0.0 9/24/2022 06:00 9/24/2022 08:30 2.50 MIRU, MOVE OTHR P Prep pad/dirt work for mat lay out. Coil tubing RDMO, Rig down hard line and prep pad for crane operations. 0.0 0.0 9/24/2022 08:30 9/24/2022 12:00 3.50 MIRU, MOVE OTHR P Continue with pad work. SIMOPS: Remove well house and jungle Gym. 0.0 0.0 9/24/2022 12:00 9/24/2022 15:00 3.00 MIRU, MOVE OTHR P Continue with pad work and Lay out mats. Stump out pipe module 5'. SIMOPS: Spot LRS at 1500hrs. 0.0 0.0 9/24/2022 15:00 9/24/2022 21:00 6.00 MIRU, MOVE OTHR P Level pad (shim mats as needed), Paint in pits, install splash skirt on centrifuge. SIMOPS: remove BOP studs to make ready for shipment. 0.0 0.0 9/24/2022 21:00 9/25/2022 00:00 3.00 MIRU, MOVE DMOB P Stump out pipe shed module. Stump out pit module and place on suspension. 0.0 0.0 9/25/2022 00:00 9/25/2022 04:30 4.50 MIRU, MOVE DMOB P Stomp out pipe shed module, Stump out Sub off MT7-99 well at 0230hrs. Continue stomp sub to install jeep. 0.0 0.0 9/25/2022 04:30 9/25/2022 09:30 5.00 MIRU, MOVE MOB P Install Jeep onto sub, Start to move sub onto MT7-06 well. SIMOPS: Stage pit, pump and motor modules to sub. 0.0 0.0 9/25/2022 09:30 9/25/2022 15:00 5.50 MIRU, MOVE MOB P Move pipe shed close to sub. Stomp, sqare up with sub and pin into position. 0.0 0.0 9/25/2022 15:00 9/25/2022 18:00 3.00 MIRU, MOVE MOB P Stomp motor and pump module into position. Hook up interconnects. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 2/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/25/2022 18:00 9/25/2022 21:00 3.00 MIRU, MOVE RURD P PJSM, raise derrick, Plug in electrical to sub, Swap to Gen power, Skid rig floor to drilling position, Continue hook up all interconnection, Spool on drill line onto drawworks, 0.0 0.0 9/25/2022 21:00 9/26/2022 00:00 3.00 MIRU, MOVE RURD P Lower cellar windwalls, Unpin block, Scope up derrick and R/D bridle lines. Raise cattle shute and work on rig acceptance checklist. Installing kelly hose onto top drive. Well pressures TBG: 150psi (fluid at surface) OA: 170psi (gas at surface) IA: 170psi (gas at surface) 0.0 0.0 9/26/2022 00:00 9/26/2022 01:00 1.00 MIRU, MOVE RURD P Complete R/U interconnects on pits. Complete and accept rig at 0100hrs 9- 26-22. Install all service lines onto tree. TBG: 150psi IA: 170psi OA: 170 psi 0.0 0.0 9/26/2022 01:00 9/26/2022 04:00 3.00 COMPZ1, WELCTL OTHR P Taking on 10.3ppg bromide to pits. Build 50bbls Hi-Vis LCM pill. SIMOPS: De-Iceing Mousehole, changing saver sub on Top drive and loading and process casing shed with 4" drill pipe. 0.0 0.0 9/26/2022 04:00 9/26/2022 05:30 1.50 COMPZ1, WELCTL KLWL P PJSM, Pressure test lines to 2,000psi, Circulate 10.3ppg down tbg and up IA.Trashing fluid to flow back tank. GPM: 147 TBG: 750psi IA: 468psi BBLS pumped: 98bbls Max weight out 10.1ppg Fluid with Gas, oil/diesel returns 0.0 0.0 9/26/2022 05:30 9/26/2022 06:00 0.50 COMPZ1, WELCTL KLWL P Circulate down tubing and up IA through communication area and up OA. Trashing fluid to flow back tank. GPM 147 TBG: 760psi IA: 470psi BBLS pumped: 96.5bbls Max weight out 10.1+ppg Fluid with Gas, oil/diesel returns 0.0 0.0 9/26/2022 06:00 9/26/2022 06:30 0.50 COMPZ1, WELCTL OWFF P Monitor well TBG: 75psi IA: 125psi OA: 125psi 0.0 0.0 9/26/2022 06:30 9/26/2022 07:30 1.00 COMPZ1, WELCTL KLWL P Circulate down tubing and up IA. Take returns to two empty pits. Attempt to save fluid. GPM 168 TBG: 720psi IA: 340psi BBLS pumped: 145bbls Max weight out 10.0 to 10.2ppg Fluid with Gas, oil/diesel returns 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 3/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/26/2022 07:30 9/26/2022 08:30 1.00 COMPZ1, WELCTL OWFF P Monitor well, shut in pressures TBG: 186psi IA: 255psi Bled back 4.7bbls TBG: 112psi IA: 184psi Fluid with Gas, oil/diesel returns 0.0 0.0 9/26/2022 08:30 9/26/2022 09:30 1.00 COMPZ1, WELCTL OWFF P Monitor well, shut in pressures TBG: 117psi IA: 191psi Bled down TBG/IA TBG: 56psi IA: 137psi Fluid with Gas, oil/diesel returns 0.0 0.0 9/26/2022 09:30 9/26/2022 13:30 4.00 COMPZ1, WELCTL OWFF P Monitor well SIMOPS: Load and process 4" drill pipe, Prep BOP equipment for N/U, Repair pipe skate, adjust shot pin on top drive. 0.0 0.0 9/26/2022 13:30 9/26/2022 15:00 1.50 COMPZ1, WELCTL KLWL P PJSM, bled OA pressure from 133psi to 0psi, bull head 123bbls 10.2ppg GPM: 70 PSI: 1060 0.0 0.0 9/26/2022 15:00 9/26/2022 16:00 1.00 COMPZ1, WELCTL OWFF P Monitor well, shut in pressures IA pressure dorpped From: 735psi to 271psi. 0.0 0.0 9/26/2022 16:00 9/26/2022 17:00 1.00 COMPZ1, WELCTL KLWL P Bled OA pressure from 271psi to 84psi, 5min built uo 23psi, continue bled back OA to 107psi to 52psi. 0.0 0.0 9/26/2022 17:00 9/27/2022 00:00 7.00 COMPZ1, WELCTL OWFF P Monitor well, shut in pressures while WO 10.3ppg fluid 1700hrs TBG: 20psi IA: 95psi OA: 59psi 2100hrs TBG: 20psi IA: 95psi OA: 54psi 2400hrs TBG: 15psi IA: 95psi OA: 50psi SIMOPS: Service TD, ST80, changed ball mill cam-loc's build tubing/casing L/D area. 0.0 0.0 9/27/2022 00:00 9/27/2022 01:00 1.00 COMPZ1, WELCTL OWFF P Monitor pressures while waithing on 10.3ppg fluid. 0100hrs TBG: 15psi IA: 94psi OA: 50psi 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 4/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/27/2022 01:00 9/27/2022 04:30 3.50 COMPZ1, WELCTL KLWL P Bull head 10.3ppg down OA, monitor tubing and IA pressure. Pump at 34gpm 800psi and stage up to 119gpm 1074psi OA, 984 IA, 900 TBG, pumped total 480bbls. Shut down pumps at 0420hrs. Pressure dropping TBG: 360psi IA: 440psi OA: 400psi 0.0 0.0 9/27/2022 04:30 9/27/2022 06:30 2.00 COMPZ1, WELCTL KLWL P Ciculate pump down tubing and up IA return to tiger tank at 210gpm tbg:1208psi IA: 663psi at 30bbls pumped clean 10.3ppg fluid returns. Send fluid to pits. Continue circulate at 252gpm 1274psi IA:396psi OA: 370 psi total 450bbls. 0.0 0.0 9/27/2022 06:30 9/27/2022 13:00 6.50 COMPZ1, WELCTL OWFF P Shut in well and monitor pressures. Waiting on more 10.3# fluid. Reconfigure service lines and gauges in cellar. TBG: 12psi IA: 18psi OA: 16psi 0.0 0.0 9/27/2022 13:00 9/27/2022 15:00 2.00 COMPZ1, WELCTL KLWL P Ciculate pump down tubing and up IA at 205gpm tbg: 865psi IA: 241psi OA: 303psi Final circulate at 230gpm 1062psi IA: 285psi OA: 360psi. Total 640bbls pumped 0.0 0.0 9/27/2022 15:00 9/27/2022 17:00 2.00 COMPZ1, WELCTL KLWL P Ciculate pump down tubing and up OA at 205gpm tbg: 886psi IA: 240psi OA: 302psi Final circulate at 231gpm 1043psi IA: 283psi OA: 334psi Total 480bbls pumped 0.0 0.0 9/27/2022 17:00 9/28/2022 00:00 7.00 COMPZ1, WELCTL OWFF P Monitor well. 1800hrs TBG: 14psi IA: 12psi OA: 3psi 2000hrs TBG: 5psi IA: 1psi OA: 0psi 2100hrs (IA and OA on slight vacuum) TBG: 0psi IA: 0psi OA: 0psi 2400hrs (IA and OA on slight vacuum) TBG: 0psi IA: 0psi OA: 0psi Fill IA and OA with 10.3ppg fluid 17bbls to fill 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 5/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/28/2022 00:00 9/28/2022 07:00 7.00 COMPZ1, WELCTL OWFF P Monitor well. 0200hrs (TBG, IA, OA on vacuum) Fill TBG, OA and IA with 10.3ppg fluid 14.3bbls. 0400hrs (TBG, IA, OA on vacuum) Fill TBG, OA and IA with 10.3ppg fluid 8.8bbls. 0600hrs (TBG, IA, OA on vacuum) Fill TBG, OA and IA with 10.3ppg fluid 9bbls 0.0 0.0 9/28/2022 07:00 9/28/2022 08:30 1.50 COMPZ1, WELCTL THGR P Install BPV and rolling test in direction of flow 390psi. 0.0 0.0 9/28/2022 08:30 9/28/2022 09:00 0.50 COMPZ1, WHDBOP NUND P PJSM, N/D tree 0.0 0.0 9/28/2022 09:00 9/28/2022 13:00 4.00 COMPZ1, WHDBOP NUND P N/U BOP's, install flow line, choke and kill lines, Joe's box with dresser sleeves, MPD equipment, 0.0 0.0 9/28/2022 13:00 9/28/2022 15:30 2.50 COMPZ1, WHDBOP RURD P Blose blind rams and shell test BOP's 250/5000psi 5min/10min. 0.0 0.0 9/28/2022 15:30 9/28/2022 16:30 1.00 COMPZ1, WHDBOP RURD P Install trip nipple and 90' mouse hole. 0.0 0.0 9/28/2022 16:30 9/28/2022 19:00 2.50 COMPZ1, WHDBOP BOPE P R/U and flood lines, purge air from system, Test annular with 4" test joint 250/3500psi 5min/10min. Perform Koomey draw down test ACC=3050psi Post function test =1600psi at 200psi 16sec and 97sec build up system. Closeing time ANN: 18sec UPR: 14sec, BS: 16sec, LPR: 14 sec, HCR choke and Kill 2sec. Test PVT GL system and flow alarms. Tested LEL and H2S alarms. Witnessed by AOGCC: Guy Cook and BLM: Quinn Sawyer 0.0 0.0 9/28/2022 19:00 9/28/2022 20:00 1.00 COMPZ1, WHDBOP RGRP T Leak observed on BOP stack/ riser connection. Retorque all BOP and riser bolts. 0.0 0.0 9/28/2022 20:00 9/28/2022 21:00 1.00 COMPZ1, WHDBOP RGRP T Attempt to retest #2, Trouble shoot slow leak, Grease Kill line HCR. 0.0 0.0 9/28/2022 21:00 9/28/2022 23:30 2.50 COMPZ1, WHDBOP RGRP T Attempt to retest #2, Trouble shoot slow leak. Observed leak on choke manifold valve #5. Observed on choke manifold a bolt hand tight on flow cross. Dicision made to check all choke manifold bolts. 0.0 0.0 9/28/2022 23:30 9/29/2022 00:00 0.50 COMPZ1, WHDBOP RGRP T Attempt to retest #2, Trouble shoot slow leak, Observed leak on choke line OTECO connection. Well on losses at ~9BPH 0.0 0.0 9/29/2022 00:00 9/29/2022 04:00 4.00 COMPZ1, WHDBOP RGRP T Change seal on choke line OTECO connection. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 6/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/29/2022 04:00 9/29/2022 18:00 14.00 COMPZ1, WHDBOP BOPE P BOPE Test All tests to 250psi/5min 5000psi/10min Annular 250psi/5min 3500psi/10min w/ exception of manual and super choke t/ 2000 psi. 4” Test jt: test annular/2 7/8" x 5 1/2" UPR/2 7/8" 5 1/2" LPR,Test choke valves 1-15. Manula operated and super choke. W/ 4.5" Test jt: test annular/2 7/8" x 5 1/2" UPR/2 7/8" 5 1/2" LPRChoke manuals and HCR valves. 4" kill line valve. Test 2x 4" FO safety valves. 4" dart valve. Test upper and lower IBOP. Blind/Shear rams. Koomey test preformed 9-28-22 at 18:00hrs Performed Koomey draw down, ACC = 3050 psi, Manifold = 1500 psi, ACC = 1650 psi after all functions on bottles,16 sec for 200 psi. Build w/ 2 electric pumps, 97 sec to build full system pressure w/ 2 electrical and 2 air pumps, closing times annular = 18 sec. UPR = 14 sec, Blind / Shears = 16 sec, LPR = 14 sec, choke HCR = 2 sec, Kill HCR = 2 sec. Test PVT gain/loss and flow out alarms. Test LEL and H2S alarms AOGCC Guy Cook witness test. BLM Quinn Sawyer witness test. 0.0 0.0 9/29/2022 18:00 9/29/2022 18:30 0.50 COMPZ1, WHDBOP BOPE P R/D test equipment, B/D surface equipment 0.0 0.0 9/29/2022 18:30 9/29/2022 19:00 0.50 COMPZ1, WHDBOP RURD P OWFF (0psi in IA, OA and TBG) avg 5bbl/hr losses. SIMOPS: R/U bail extensions and tubing tongs. 0.0 0.0 9/29/2022 19:00 9/29/2022 20:00 1.00 COMPZ1, WHDBOP OTHR P Pull BPV . 0.0 0.0 9/29/2022 20:00 9/29/2022 20:30 0.50 COMPZ1, WHDBOP OTHR P R/U bail extensions, M/U safety valve and landing joint. BOLD and pul tubing, Free with 188k P/U 130k S/O 109k. Continue pull hanger to rig floor from 10,081' MD to 10,053' MD 10,081.0 10,053.0 9/29/2022 20:30 9/29/2022 21:30 1.00 COMPZ1, RPCOMP CIRC P M/U safety valve and head pin, Displace down OA and up IA 75bbls 10.0ppg Vis brine. 10,053.0 10,053.0 9/29/2022 21:30 9/29/2022 22:30 1.00 COMPZ1, RPCOMP CIRC P Pump down tbg and up IA displace with 10.0ppg Vis Brine at 270gpm 398psi 10,053.0 10,053.0 9/29/2022 22:30 9/29/2022 23:00 0.50 COMPZ1, RPCOMP OWFF P OWFF, slow drop in IA. 10,053.0 10,053.0 9/29/2022 23:00 9/30/2022 00:00 1.00 COMPZ1, RPCOMP PUTB P POOH and L/D 4.5" 12.6ppf H563 tubing. from 10,053' MD to 9,808' MD. PU: 130k SO: 109k 10,053.0 9,808.0 9/30/2022 00:00 9/30/2022 06:00 6.00 COMPZ1, RPCOMP PUTB P POOH and L/D 4.5" 12.6ppf H563 tubing. from 9,809' MD to 2,100' MD. 9,808.0 2,100.0 9/30/2022 06:00 9/30/2022 08:00 2.00 COMPZ1, RPCOMP PUTB P POOH and L/D 4.5" 12.6ppf H563 tubing. from 2,100' MD to surface. 2,100.0 0.0 9/30/2022 08:00 9/30/2022 09:30 1.50 COMPZ1, RPCOMP CLEN P Clean and clear rig floor and install wear bushing. 0.0 0.0 9/30/2022 09:30 9/30/2022 11:00 1.50 COMPZ1, PLUG PULD P P/U and run 948' 3.5" EUE cement stinger. 0.0 948.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 7/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 9/30/2022 11:00 9/30/2022 18:00 7.00 COMPZ1, PLUG PULD P Continue RIH with 3.5" stnger P/U 4" drill pipe from 948' MD to 7,012' MD 948.0 7,012.0 9/30/2022 18:00 9/30/2022 21:30 3.50 COMPZ1, PLUG PULD P Continue RIH with 3.5" stnger P/U 4" drill pipe from 7,012' MD to 10,081' MD 7,012.0 10,081.0 9/30/2022 21:30 9/30/2022 22:00 0.50 COMPZ1, PLUG RURD P P/U Baker cement swivel and change 10' pump joint and safety valve on top from 3.5" IF to 4" XT39. 10,081.0 10,081.0 9/30/2022 22:00 9/30/2022 23:00 1.00 COMPZ1, PLUG CIRC P Circulate at 10,081' MD at 8bpm 940psi with 50rpm. 2100stks 10.0ppg in/out SIMOPS: Batch up 13.0ppg spacer and PJSM for cement operatons. PU: 148K SO: 123k 10,081.0 10,081.0 9/30/2022 23:00 10/1/2022 00:00 1.00 COMPZ1, PLUG CMNT P Pressure test lines to 5k, leak on union between pump and Ball Mill, tighten union and retest to 5k (good test) SLB, Tested lines to 5000 psi high, pump 15 bbls of 13.0 ppg Mud Push II @ 3.8 bbls/min, 337 psi, Batch cement (cement wet @ 23:05) Pump 33 bbls of Class G 15.8 ppg cement @ 2.3 bbls/min, ICP = 154 psi, FCP = 142 psi. Batch and pump 5 bbls 13.0 ppg Mud Push II at 3.4 bbls/min, 144 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 2.6 bbls/min, ICP = 134 psi, FCP= 136 psi. 0 losses during the job, shut down pumps at (86 bbls). CIP 00:19 Hrs 10/1/2022. 10,081.0 10,081.0 10/1/2022 00:00 10/1/2022 00:30 0.50 COMPZ1, PLUG CMNT P Continue displace cement at 122gpm (max feeding unit)with 50rpm 2k tq 136psi total 86bbls. Full returns 10,081.0 10,081.0 10/1/2022 00:30 10/1/2022 01:00 0.50 COMPZ1, PLUG RURD P Flow check (drill string static) R/D Baker cement swivel and blow down service lines. ROT: 136k 10,081.0 10,081.0 10/1/2022 01:00 10/1/2022 02:30 1.50 COMPZ1, PLUG TRIP P POOH from 10,081' MD to 9,102' MD at 15'/min. Drill pipe pulled dry. 10,081.0 9,102.0 10/1/2022 02:30 10/1/2022 03:00 0.50 COMPZ1, PLUG CIRC P Install nerf ball and circulate at 9,102' MD at 800gpm 2950psi 50rpm pumped 5978stks(~5bbls cement returns) 9,102.0 9,102.0 10/1/2022 03:00 10/1/2022 03:30 0.50 COMPZ1, PLUG OTHR P OWFF (static) Blow down top drive, install PS21's 9,102.0 9,102.0 10/1/2022 03:30 10/1/2022 07:15 3.75 COMPZ1, PLUG TRIP P POOH from 9,100' MD to 950' MD. 9,102.0 950.0 10/1/2022 07:15 10/1/2022 07:45 0.50 COMPZ1, PLUG OTHR P Pull PS21's and Install master bushing and 3.5" air slips. Change elevators ato 3.5". 950.0 950.0 10/1/2022 07:45 10/1/2022 09:00 1.25 COMPZ1, PLUG TRIP P POOH and rack back 3.5" EUE tubing, L/D mule shoe. 950.0 0.0 10/1/2022 09:00 10/1/2022 09:30 0.50 COMPZ1, PLUG CLEN P Clean and clear rig floor, Change to 4" handling equipment, R/D tubing tongs. 0.0 0.0 10/1/2022 09:30 10/1/2022 12:00 2.50 COMPZ1, PLUG TRIP P M/U 6.5" bit and TIH with 4" drill pipe to 3,222' MD. PU: 82k SO: 80k 0.0 3,222.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 8/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/1/2022 12:00 10/1/2022 15:00 3.00 COMPZ1, PLUG TRIP P Continue TIH with 4" drill pipe to 9,105' MD. Wash in hole and tag @ 9,202' MD with 15K PU: 140k SO: 120k GPM: 42 AOGCC Sean Sullivan witness tagging cement plug. BLM Quinn Sawyer waived witness on tagging cement and all other pumping and tagging cement plugs on MT7-06 08:25hrs 9-30-22 3,222.0 9,202.0 10/1/2022 15:00 10/1/2022 16:00 1.00 COMPZ1, PLUG CIRC P Circulate at 9,190' MD 2600stks GPM: 400 PSI: 1200 9,202.0 9,190.0 10/1/2022 16:00 10/1/2022 20:00 4.00 COMPZ1, PLUG TRIP P POOH from 9,190' MD to surface. 9,190.0 0.0 10/1/2022 20:00 10/1/2022 21:00 1.00 COMPZ1, PLUG BHAH P Remove 6.5" bit and float valve, M/U 6.75" bit. Clean and clear rig floor. 0.0 0.0 10/1/2022 21:00 10/1/2022 22:00 1.00 COMPZ1, PLUG TRIP P RIH with 6.75" bit to 2489' MD. 0.0 2,489.0 10/1/2022 22:00 10/1/2022 22:30 0.50 COMPZ1, PLUG OTHR P M/U Baker retrievamatic packer. 2,489.0 2,489.0 10/1/2022 22:30 10/2/2022 00:00 1.50 COMPZ1, PLUG TRIP P Continue RIH with 6.75" bit and Baker retrievamatic packer to 4984' MD, Packer depth 2500' MD. 2,489.0 4,984.0 10/2/2022 00:00 10/2/2022 02:00 2.00 COMPZ1, PLUG PRTS P R/U service lines and equipment, Set packer at 2,500' MD with 25k. Perge lines and test cement plug to 1,865psi (45min) As per AOGCC witness Sean Sullivan PU: 98k SO: 96k 4,984.0 4,984.0 10/2/2022 02:00 10/2/2022 02:30 0.50 COMPZ1, PLUG RURD P R/D and blow down surface equipment. 4,984.0 4,984.0 10/2/2022 02:30 10/2/2022 03:45 1.25 COMPZ1, PLUG TRIP P POOH from 4,984' MD to 2,489' MD. 4,984.0 2,489.0 10/2/2022 03:45 10/2/2022 04:15 0.50 COMPZ1, PLUG RURD P L/D Baker retrievamatic packer. 2,489.0 2,489.0 10/2/2022 04:15 10/2/2022 05:30 1.25 COMPZ1, PLUG TRIP P Continue POOH from 2,489' MD to surface. 2,489.0 0.0 10/2/2022 05:30 10/2/2022 06:00 0.50 COMPZ1, PLUG BHAH P Break and L/D bit, Bit sub and X/O. M/U Baker 4AA 7-5/8" 24-39# Cement retainer (PN: ACT 050-6317-001). 0.0 0.0 10/2/2022 06:00 10/2/2022 11:00 5.00 COMPZ1, PLUG TRIP P TIH with cement retainer at 40'/min from surface to 2,500' MD and 60'/min from 2,500' MD to 7,832' MD. 0.0 7,832.0 10/2/2022 11:00 10/2/2022 11:30 0.50 COMPZ1, PLUG OTHR P Set retainer at 7,832' MD. 7,832.0 7,832.0 10/2/2022 11:30 10/2/2022 14:30 3.00 COMPZ1, PLUG TRIP P POOH from 7,832' MD to surface, L/D and inspect Baker running tools. (all ok) 7,832.0 0.0 10/2/2022 14:30 10/2/2022 15:30 1.00 COMPZ1, PLUG CLEN P Clean and clear rig floor, PJSM (P/U guns) P/U Schlumberger 4.72" 135/45 phase 21spf 20' of shots total 420. Gun ser# 4.72-21-35 0.0 0.0 10/2/2022 15:30 10/2/2022 20:00 4.50 COMPZ1, PLUG TRIP P TIH with Schlumberger guns at 90'/min, Set on depth 7,770' MD to 7,790' MD. 0.0 7,790.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 9/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/2/2022 20:00 10/2/2022 21:00 1.00 COMPZ1, PLUG PERF P Drop Schlumberger 5/8" steel ball, Pump down at 1bpm 127psi, Ball landed at 228stks, Increase pressure to 2,700psi guns fired at 2018hrs, OA pressure 64psi before Quick respond to 67psi after and back down to 63psi. EST circulation at 2bpm 1300psi up IA, RIH to 7,828' MD tag and verify Retainer still on depth. OWFF: Static PU: 122k SO: 96k 7,790.0 7,790.0 10/2/2022 21:00 10/3/2022 00:00 3.00 COMPZ1, PLUG TRIP P POOH with perf guns from 7,790' MD to 2,002' MD. 7,790.0 2,002.0 10/3/2022 00:00 10/3/2022 00:45 0.75 COMPZ1, PLUG TRIP P POOH with perf guns from 2,002' MD to 500' MD. 2,002.0 500.0 10/3/2022 00:45 10/3/2022 01:15 0.50 COMPZ1, PLUG OWFF P OWFF, gun gass breaking out at surface, Circulate at 2bpm 1141psi. (well static) 500.0 500.0 10/3/2022 01:15 10/3/2022 02:00 0.75 COMPZ1, PLUG TRIP P Continue POOH from 500' MD. L/D Schlumberger guns (All shots fired) 500.0 0.0 10/3/2022 02:00 10/3/2022 03:00 1.00 COMPZ1, PLUG PULD P M/U 4" mule shoe and P/U 4" HWT drill pipe TIH to 275' MD. 0.0 275.0 10/3/2022 03:00 10/3/2022 03:30 0.50 COMPZ1, PLUG PULD P M/U Baker retrievamatic packer. 275.0 275.0 10/3/2022 03:30 10/3/2022 05:00 1.50 COMPZ1, PLUG TRIP P TIH with Backer retrievamatic packer from 275' MD to 2791' MD, Set packer at 2,500' MD with 25k. 275.0 2,791.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 10/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/3/2022 05:00 10/3/2022 08:00 3.00 COMPZ1, PLUG CIRC P Test return line to tiger tank to 1,500psi. 1st attempt Pump at 1bpm 1190psi up OA 59psi start 58psi end pumped 3.5bbls returned 2.3bbls 1min 1072psi 2min 1039psi 3min 995psi 4min 941psi 5min 860psi 2nd attempt Pump at 1bpm 1330psi up OA 56psi start 56psi end pumped 2.8bbls, 2bbls returned 1min 1100psi 2min 1066psi 3min 1046psi 4min 1028psi 5min 1014psi 6min 1001psi 7min 985psi 8min 969psi 9min 956psi 10min 945ps 15min 691psi Mud pump pulsation dampener relaxed 20min 653psi 25min 632psi 30min 619psi 3rd attempt Pump at 1/2bpm 1180psi up OA 56psi start 56psi end pumped 2.24bbls, 2bbls returned 1min 1180psi 2min 1073psi 3min 995psi 4min 970psi 5min 955psi 6min 949psi 7min 942psi 8min 937psi 9min 933psi 10min 930ps 15min 915psi 20min 902psi 25min 890psi 30min 880psi 35min 872psi 2,791.0 2,791.0 10/3/2022 08:00 10/3/2022 09:30 1.50 COMPZ1, PLUG TRIP P POOH from 2,791' MD, L/D Baker retrievamatic packer. (no visual wear) 2,791.0 0.0 10/3/2022 09:30 10/3/2022 14:00 4.50 COMPZ1, PLUG BHAH P M/U BHA and TIH to 7,765' MD. 0.0 7,765.0 10/3/2022 14:00 10/3/2022 18:00 4.00 COMPZ1, PLUG CIRC P Circulate at 7,761' MD 250gpm 995psi (2875stks) SIMOPS: Build and rack back 5" stands 7,765.0 7,765.0 10/3/2022 18:00 10/3/2022 20:30 2.50 COMPZ1, PLUG TRIP P POOH from 7,765' To 2,553' MD 7,765.0 2,553.0 10/3/2022 20:30 10/4/2022 00:00 3.50 COMPZ1, PLUG OWFF P OWFF, Drill pipe at 2,553' MD for safty while waiting on E-Line. SIMOPS: Build and rack back 5" stands, Total 34stds. Eline unit changing out spool and re- heading line. 2,553.0 2,553.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 11/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/4/2022 00:00 10/4/2022 00:30 0.50 COMPZ1, PLUG OWFF P OWFF, Drill pipe at 2,553' MD for safty while waiting on E-Line. SIMOPS: Build and rack back 5" stands, Total 37stds. Eline unit in route to location. 2,553.0 2,552.0 10/4/2022 00:30 10/4/2022 01:30 1.00 COMPZ1, PLUG TRIP P POOH from 2,553' MD to surface, L/D Bit. Wire line unit arrived on location at 1230hrs, Spotting unit and M/U tools in pipe shed for testing. 2,552.0 0.0 10/4/2022 01:30 10/4/2022 03:30 2.00 COMPZ1, PLUG RURD P Continue M/U tools in pipe shed and testing. Spotting tools and equipment on rig floor. 0.0 0.0 10/4/2022 03:30 10/4/2022 09:30 6.00 COMPZ1, PLUG QEVL P PJSM, P/U USIT tool string. RIH at 0445hrs. 3kft/hr to 1000', then 10kft/hr to to 7,750' MD, Log up to Surface. Tool length: 54.74' Max OD 7" Rope socket: 8K (electrical release) 0.39" line: 6984# Disp. 0.1478bbl/1000' 0.0 0.0 10/4/2022 09:30 10/4/2022 10:30 1.00 COMPZ1, PLUG RURD P Rig down E-Line and equipment 0.0 0.0 10/4/2022 10:30 10/4/2022 12:00 1.50 COMPZ1, PLUG TRIP P TIH with 3.5" cement string and 4" drill pipe to 1,226' MD 0.0 1,226.0 10/4/2022 12:00 10/4/2022 20:00 8.00 COMPZ1, PLUG PULD P OWFF , Build and rack back 5" drill pipe (total 96stds) 1,226.0 1,226.0 10/4/2022 20:00 10/5/2022 00:00 4.00 COMPZ1, PLUG WAIT T Waiting on approvals from State for path forward. SIMOPS: Cleaning and organizing rig 1,226.0 1,226.0 10/5/2022 00:00 10/5/2022 13:30 13.50 COMPZ1, PLUG WAIT T Waiting on approvals from State for path forward. SIMOPS: Cleaning and organizing rig 1,226.0 1,226.0 10/5/2022 13:30 10/5/2022 16:00 2.50 COMPZ1, PLUG TRIP P M/U Baker retrievamatic packer and TIH at 90'/min, Set packer at 2,572' MD, EOT at 4,002' MD. R/U service lines and equipment. 1,226.0 4,002.0 10/5/2022 16:00 10/5/2022 17:30 1.50 COMPZ1, PLUG PRTS P Pressure test formation (Perfs 7770' MD - 7790' MD Pump at 1/2bpm 1800psi 2.8bbls, 2.5bbls returned 1min 1800psi 2min 1780psi 3min 1760psi 4min 1730psi 5min 1710psi 6min 1700psi 7min 1660psi 8min 1610psi 9min 1590psi 10min 1550ps 15min 1400psi 20min 1300psi 25min 1220psi 30min 1180psi 4,002.0 4,002.0 10/5/2022 17:30 10/5/2022 18:00 0.50 COMPZ1, PLUG WAIT T Waiting on approvals from State for path forward. 4,002.0 4,002.0 10/5/2022 18:00 10/5/2022 19:30 1.50 COMPZ1, PLUG TRIP P Release test packer, Blow down top drive, POOH from 4,002' MD to 1,441' MD 4,002.0 1,441.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 12/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/5/2022 19:30 10/5/2022 23:00 3.50 COMPZ1, PLUG TRIP P TIH with 3.5" cement stinger from 1,441' MD to 7,807' MD. Stinger: 949.60' 1,441.0 7,807.0 10/5/2022 23:00 10/5/2022 23:30 0.50 COMPZ1, PLUG CIRC P Circulate BTMs up at 730gpm 2350psi 7,807.0 7,807.0 10/5/2022 23:30 10/6/2022 00:00 0.50 COMPZ1, PLUG RURD P P/U cement swivel, R/U survice lines and equipment. Circulate at 8bpm 801psi while crew change. 7,807.0 7,807.0 10/6/2022 00:00 10/6/2022 00:30 0.50 COMPZ1, PLUG CIRC P R/U cement swivel and service lines, Continue circulate at 333gpm at 800psi 7,807.0 7,807.0 10/6/2022 00:30 10/6/2022 01:15 0.75 COMPZ1, PLUG CMNT P Batch up 48bbls 11.5ppg Mud Push II spacer (for both plugs) SIMOPS: M/U cement swivel and circulate at 333gpm 800psi. 7,807.0 7,807.0 10/6/2022 01:15 10/6/2022 02:00 0.75 COMPZ1, PLUG CMNT P SLB, Tested lines to 3500 psi high, pump 12bbls of 11.5 ppg Mud Push II @ 4.8 bbls/min, 497 psi, Batch cement (cement wet @ 0054) Pump 37 bbls of Class G 15.8 ppg cement @ 4.8 bbls/min, ICP = 290 psi, FCP = 210 psi. Batch and pump 4 bbls 11.5 ppg Mud Push II at 4.7 bbls/min, 200 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 4.8 bbls/min, ICP = 134 psi, @ 2bpm FCP= 167 psi. 0 losses during the job, shut down pumps at (62 bbls). Rotating at 50rpm 2.6k torque, CIP 01:42 Hrs 10/6/2022. 7,807.0 7,807.0 10/6/2022 02:00 10/6/2022 03:00 1.00 COMPZ1, PLUG TRIP P R/D cement swivel and POOH to 7014' MD at 20'/min. 7,807.0 7,014.0 10/6/2022 03:00 10/6/2022 03:30 0.50 COMPZ1, PLUG CIRC P Install Nerf ball and Circulate 2- BTMs up at 730gpm 2350psi 5bbls cement returns. 7,014.0 7,014.0 10/6/2022 03:30 10/6/2022 03:45 0.25 COMPZ1, PLUG CIRC P Blow down top drive, R/U cement swivel and service lines, test lines to 3500psi. 7,014.0 7,014.0 10/6/2022 03:45 10/6/2022 04:30 0.75 COMPZ1, PLUG CMNT P SLB, Tested lines to 3000 psi high, pump 12bbls of 11.5 ppg Mud Push II @ 3.5 bbls/min, 300 psi, Batch cement (cement wet @ 0345) Pump 37 bbls of Class G 15.8 ppg cement @ 3.5 bbls/min, ICP = 138 psi, FCP = 150 psi. Batch and pump 4 bbls 11.5 ppg Mud Push II at 3.4 bbls/min, 157 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 54 bbls/min, ICP = 126 psi, FCP= 125 psi. 0 losses during the job, shut down pumps at (54 bbls). Rotating at 50rpm 2.6k torque, CIP 04:33 Hrs 10/6/2022. 7,014.0 7,014.0 10/6/2022 04:30 10/6/2022 06:00 1.50 COMPZ1, PLUG RURD P R/D cement swivel and POOH from 7014' MD to 6,066' MD at 20'/min. 7,014.0 6,066.0 10/6/2022 06:00 10/6/2022 07:00 1.00 COMPZ1, PLUG CIRC P Install Nerf ball and Circulate 2- BTMs up at 735gpm 1930psi 4.5bbls cement returns. Blow down top drive. 6,066.0 6,066.0 10/6/2022 07:00 10/6/2022 09:00 2.00 COMPZ1, PLUG TRIP P POOH from 6,066' MD to 950' MD. 6,066.0 950.0 10/6/2022 09:00 10/6/2022 10:30 1.50 COMPZ1, PLUG BHAH P OWFF, (Static) Change handling equipment and R/U tubing tongs. POOH and rack back 3.5" cement string. 950.0 0.0 10/6/2022 10:30 10/6/2022 11:00 0.50 COMPZ1, PLUG CLEN P Clean and clear rig floor, Change handling equipment and R/D tubing tongs. Jet stack and BOP function test (10:30hrs 10-6-22) 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 13/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/6/2022 11:00 10/6/2022 15:00 4.00 COMPZ1, PLUG OTHR P M/U 6-3/4" Bit and TIH to 5,977' MD. 0.0 5,977.0 10/6/2022 15:00 10/6/2022 17:00 2.00 COMPZ1, PLUG WASH P Wash in hole from 5,977' MD to 6,366' MD (tagged 15k) GPM: 42 PSI: 102 5,977.0 6,366.0 10/6/2022 17:00 10/6/2022 17:30 0.50 COMPZ1, PLUG CIRC P Circulate at 6,366' MD (Observed contaminated cement returns) GPM: 400 PSI: 2110 6,366.0 6,366.0 10/6/2022 17:30 10/6/2022 21:30 4.00 COMPZ1, PLUG CIRC T Circulate at 6,366' MD. Waiting on State Lou Laubenstein to witness tag cement. GPM: 400 PSI: 2110 6,366.0 6,366.0 10/6/2022 21:30 10/6/2022 21:45 0.25 COMPZ1, PLUG TRIP P Lou Laubenstein arrived at 2130 hrs. TIH and tag at 6,366' MD with 15k(90k) PU: 108k SO: 105k 6,366.0 6,366.0 10/6/2022 21:45 10/6/2022 23:00 1.25 COMPZ1, PLUG TRIP P Blow down top drive and POOH from 6,366' MD to 3,324' MD 6,366.0 3,324.0 10/6/2022 23:00 10/6/2022 23:30 0.50 COMPZ1, PLUG OTHR P M/U Baker retrievamatic packer. 3,324.0 3,324.0 10/6/2022 23:30 10/7/2022 00:00 0.50 COMPZ1, PLUG TRIP P TIH with Backer retrievamatic packer from 3,324' MD to 4,195' MD. 3,324.0 4,195.0 10/7/2022 00:00 10/7/2022 01:00 1.00 COMPZ1, PLUG TRIP P Continue TIH with test packer to 5,900' MD 4,195.0 5,900.0 10/7/2022 01:00 10/7/2022 02:00 1.00 COMPZ1, PLUG PRTS P P/U Baker swivel, Set Baker test packer at 2,568' (5900' MD bit depth) with 25k. R/U service lines and equipment. Test cement plug to 1500psi 30min (good test) pumped 1.2bbls returned 1bbls. AOGCC Lou Laubenstein witnessed test. 5,900.0 5,900.0 10/7/2022 02:00 10/7/2022 02:15 0.25 COMPZ1, PLUG RURD P R/D service lines and cement swivel, Blow down lines. 5,900.0 5,900.0 10/7/2022 02:15 10/7/2022 05:00 2.75 COMPZ1, PLUG TRIP P POOH from 5,900' MD, L/D Baker retrievamatic packer. (no visual damage) Continue POOH L/D bit. 5,900.0 0.0 10/7/2022 05:00 10/7/2022 05:30 0.50 COMPZ1, PLUG CLEN P Clean and clear rig floor (Rig Crew change) 0.0 0.0 10/7/2022 05:30 10/7/2022 09:00 3.50 COMPZ1, PLUG TRIP P M/U Baker CICR , TIH to 3,745' MD, Set CICR at 3,745' MD Set with 50k up/36k down. Release running tool. Size: 4AA / 7-5/8" 24-39# PN: ACT 050-6317-001 0.0 3,745.0 10/7/2022 09:00 10/7/2022 12:00 3.00 COMPZ1, PLUG OTHR P POOH from 3,745' MD to Srface L/D Baker running tool. 3,745.0 0.0 10/7/2022 12:00 10/7/2022 14:30 2.50 COMPZ1, PLUG TRIP P M/U Baker casing cutter with 3" knives, TIH to 3,730' MD. 0.0 3,730.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 14/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/7/2022 14:30 10/7/2022 18:00 3.50 COMPZ1, PLUG CPBO P Establish parameters, Cut 7-5/8" casing at 3,730' MD and 3,400' MD. PU: 85k SO: 87k ROT: 88 GPM: 175 PSI: 724 RPM: 60 TRQ: 3k on TRQ: 1.5 off 3,730.0 3,400.0 10/7/2022 18:00 10/7/2022 20:00 2.00 COMPZ1, PLUG TRIP P OWFF (Static) POOH from 3,400' MD to surface. 3,400.0 0.0 10/7/2022 20:00 10/7/2022 20:30 0.50 COMPZ1, PLUG OTHR P Pull and inspect casing cutter, Outer markings ~6-8" above cutters on tools. Removed 3" cutters with good markings showing full extension of knifes. Dress casing cutter with 2-1/4" knifes. 0.0 0.0 10/7/2022 20:30 10/7/2022 21:00 0.50 COMPZ1, PLUG CPBO P RIH to 75' MD to make final cut. Torque increased to 2.4k and pump pressure drop to 260psi. Indication knifes full extended. Minimum rotation after pressure drop to keep from gouging surface casing. ROT: 44k GPM 175 PSI: 560 RPM: 60 TRQ:1.7k 0.0 75.0 10/7/2022 21:00 10/7/2022 22:00 1.00 COMPZ1, PLUG TRIP P Pull and inspect casing cutter. Removed 2-1/4" cutters with good markings showing full extension of knifes. Clean and clear rig floor. 75.0 0.0 10/7/2022 22:00 10/7/2022 23:00 1.00 COMPZ1, PLUG OTHR P Pump out stack, M/U FMC retriving tool, RIH and pull wear ring. M/U retrieving tool and BO lock downs and pull pack off. 0.0 0.0 10/7/2022 23:00 10/8/2022 00:00 1.00 COMPZ1, PLUG BHAH P Remove PS21's and install master bushings, P/U and M/U Baker 6.676" Grapple/Spear assy and No Go. 0.0 0.0 10/8/2022 00:00 10/8/2022 01:00 1.00 COMPZ1, PLUG FISH P RIH to Attempt to spear 7-5/8" casing. NoGo landed onto casing slips, Pulled lockdown (visual inspect) NoGo sitting ontop of hanger slips. POOH and L/D spear. SIMOPS: R/D MPD Orbit valve and lines. 0.0 37.0 10/8/2022 01:00 10/8/2022 04:00 3.00 COMPZ1, PLUG NUND P N/D BOP's and Well head, Lift stack and head to expose slips. Casing stub ~3' below slips. BO studs on well head to make room to pull slips. Unable to unwedge slip segments (gouge segment to release slips). Note: Top of 7-5/8" casing stump has a worn slot in casing that let slips release. Casing widely expanded below slip area. Note: On upper completion, first joint of 4.5" tubing was bent just below hanger. Posible caused when slips released on 7-5/8" casing. 37.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 15/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/8/2022 04:00 10/8/2022 05:30 1.50 COMPZ1, PLUG NUND P Install studs onto well head, Change out rig gasket and N/U BOP's , Change UPR to 7-5/8" rams. 0.0 0.0 10/8/2022 05:30 10/8/2022 08:30 3.00 COMPZ1, PLUG BOPE P Test upper 7-5/8" rams and annular with 7-5/8" test joint 250/3500psi 5/10min, test MPD to 1250psi AOGCC Austin McLeod waived witness 10-7-22 at 15:37hrs. BLM Quinn Sawyer waived witness 10-7 -22 at 09:20 hrs. 0.0 0.0 10/8/2022 08:30 10/8/2022 09:30 1.00 COMPZ1, PLUG OTHR P Set wear ring ID:12-3/8" 0.0 0.0 10/8/2022 09:30 10/8/2022 14:30 5.00 COMPZ1, PLUG SLPC P PJSM, hang block, Slip and cut new drill line onto travel system (1800') Adjust drill line rollers, reset crown saver, calibrate Amphion and Pason. 0.0 0.0 10/8/2022 14:30 10/8/2022 15:00 0.50 COMPZ1, PLUG OTHR P Pump out BOP stack, Blow down kill line, M/U Baker graple assy. 0.0 0.0 10/8/2022 15:00 10/8/2022 17:00 2.00 COMPZ1, PLUG FISH P Attempt to engauge fish multiple time, Manage to engauge fish and brought to surface and L/D. Cut area seems to be a good cut and material good to latch fish. TOF to collar: 21.50' Collar to cut 13.42' 0.0 0.0 10/8/2022 17:00 10/8/2022 19:30 2.50 COMPZ1, PLUG FISH P RIH with Baker graple assy to 75' MD, engauge fish and pull to rig floor. Release from graple and L/D cut joint (36k to break connection using rig tongs), L/D Baker graple assy. R/U to pull 7-5/8" casing. PU: 121k 3,400.0 3,325.0 10/8/2022 19:30 10/9/2022 00:00 4.50 COMPZ1, PLUG PUTB P Continue Pull 7-5/8" 29.7ppf L-80 HYD 563 casing,from 3,325' MD to 1,883' MD. High torque on connections (36k- 39k to break connection using rig tongs. TOF to collar: 27.15' Multible centrilizer blades missing. 3,325.0 1,883.0 10/9/2022 00:00 10/9/2022 06:00 6.00 COMPZ1, PLUG PUTB P Continue Pull 7-5/8" 29.7ppf L-80 HYD 563 casing, from 1,883' MD to surface . High torque on connections (36k-60) to break connection using rig tongs. Multible centrilizer blades missing, 58 sections are left in hole. 1,883.0 0.0 10/9/2022 06:00 10/9/2022 06:30 0.50 COMPZ1, PLUG RURD P Rig down Casing equipment. Clean and clear rig floor. 0.0 0.0 10/9/2022 06:30 10/9/2022 08:00 1.50 COMPZ1, PLUG SLPC P Cut amd slip 24' Drill line, Calibrate Amphion and Pason, Service rig 0.0 0.0 10/9/2022 08:00 10/9/2022 09:00 1.00 COMPZ1, PLUG WAIT P Waiting on Baker Magnets 0.0 0.0 10/9/2022 09:00 10/9/2022 09:30 0.50 COMPZ1, PLUG OTHR P M/U string magnet and fish out centralizer blades from BOP stack. 0.0 0.0 10/9/2022 09:30 10/9/2022 10:00 0.50 COMPZ1, PLUG OTHR P R/U and pull wear ring and set test plug. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 16/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/9/2022 10:00 10/9/2022 12:30 2.50 COMPZ1, PLUG BOPE P Purge stack and test LPR and Annular to 250/3500psi 5/10min with 5" test joint, Test 2-safety valves and 1-IBOP to 250/3500psi 5/10min. 0.0 0.0 10/9/2022 12:30 10/9/2022 13:00 0.50 COMPZ1, PLUG OTHR P Pull test plug and install wear ring. 0.0 0.0 10/9/2022 13:00 10/9/2022 15:00 2.00 COMPZ1, PLUG OTHR P Remove 4" XT39 saver sub and install 5" NC50, Clean and inspect top drive. 0.0 0.0 10/9/2022 15:00 10/9/2022 17:00 2.00 COMPZ1, PLUG BHAH P P/U Baker cup and 6.676" grapple assy. TIH P/U 9 joints 5" HWT drill pipe to 319' MD 0.0 319.0 10/9/2022 17:00 10/9/2022 18:30 1.50 COMPZ1, PLUG TRIP P TIH from 319' MD to 3,332' MD 319.0 3,332.0 10/9/2022 18:30 10/9/2022 21:30 3.00 COMPZ1, PLUG FISH P M/U top drive and gather perematers, Tagged top of fish with bull nose with 20k, P/U turn string 180° , inner TOF at 3,400' to 3,407' MD, landed NoGo at 3,400' MD. Pull on fish to 300k, Decrease pump to 170gpm 70psi, 2000hrs cock jars and procede to jar staging up jaring from 180k and overpull to 220k to final 300k and overpull to 400k. String pressured up to 400psi and fish came free at 21:22hrs. PU: 104k SO: 104k 3,332.0 3,400.0 10/9/2022 21:30 10/10/2022 00:00 2.50 COMPZ1, PLUG TRIP P POOH with 7-5/8" fish from 3,400' MD to 319' MD. 3,400.0 319.0 10/10/2022 00:00 10/10/2022 01:00 1.00 COMPZ1, PLUG BHAH P POOH rack back 5" HWT drill pipe and L/D Baker fishing assy. from 319' MD to surface. 319.0 319.0 10/10/2022 01:00 10/10/2022 01:30 0.50 COMPZ1, PLUG RURD P R/U casing tongs and equipment. SIMOPS: Complete derrick inspection 319.0 319.0 10/10/2022 01:30 10/10/2022 02:30 1.00 COMPZ1, PLUG PULD P POOH L/D 7-5/8" casing from 319' MD to surface. Only one centralizer was ran on this section. 3 of 4 blades missing in hole for total 61 blades in hole. TOF cut joint 11.11' BOF cut joint 0.50' 319.0 0.0 10/10/2022 02:30 10/10/2022 03:00 0.50 COMPZ1, PLUG RURD P R/D 7-5/8" casing tongs and equipment 0.0 0.0 10/10/2022 03:00 10/10/2022 04:30 1.50 COMPZ1, PLUG PULD P Derrick management, L/D 4" HWT drill pipe. 0.0 0.0 10/10/2022 04:30 10/10/2022 08:00 3.50 COMPZ1, PLUG BHAH P M/U 9-7/8" bit and BHA #5. TIH to 3,400' MD PU: 108k SO: 108k 0.0 3,400.0 10/10/2022 08:00 10/10/2022 09:30 1.50 COMPZ1, PLUG WASH P Wash in hole from 3,400' MD to 3,726' MD PU: 115k SO: 115k ROT: 115k RPM: 45 TRQ: 3k GPM: 680 PSI: 980 3,400.0 3,726.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 17/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/10/2022 09:30 10/10/2022 11:30 2.00 COMPZ1, PLUG CIRC P Pump Hi Vis sweeps and circulate around. Pumped 11,722 stks PU: 115k SO: 115k ROT: 115k RPM: 45 TRQ: 3k GPM: 680 PSI: 840 3,726.0 3,726.0 10/10/2022 11:30 10/10/2022 12:00 0.50 COMPZ1, PLUG OWFF P Rack back stand, OWFF (Static) 3,726.0 3,700.0 10/10/2022 12:00 10/10/2022 15:00 3.00 COMPZ1, PLUG TRIP P POOH from 3,700' MD to 410' MD. 3,700.0 410.0 10/10/2022 15:00 10/10/2022 16:30 1.50 COMPZ1, PLUG BHAH P Continue POOH with BHA and clean magnets. Recovered 15gal metal. 410.0 0.0 10/10/2022 16:30 10/10/2022 17:00 0.50 COMPZ1, PLUG OTHR P Wash and function BOP stack. GPM: 700 PSI: 145 RPM: 40 0.0 0.0 10/10/2022 17:00 10/10/2022 18:00 1.00 COMPZ1, PLUG CLEN P Clean and clear rig floor. 0.0 0.0 10/10/2022 18:00 10/10/2022 22:00 4.00 COMPZ1, PLUG RURD P Rig up tubing tongs and equipment, TIH with 3.5" cement string, Change handling tools, continue TIH to 3,720' MD. 0.0 3,720.0 10/10/2022 22:00 10/10/2022 22:30 0.50 COMPZ1, PLUG RURD P P/U Baker cement swivel, R/U service lines. 3,720.0 3,720.0 10/10/2022 22:30 10/11/2022 00:00 1.50 COMPZ1, PLUG CIRC P Circulate at 3,720' MD, Schlumberger batch up 95bbls 16.8ppg cement. GPM: 333 PSI: 445 RPM: 30 TRQ: 1.5k SIMOPS: Batching cement 23:12hrs 3,720.0 3,720.0 10/11/2022 00:00 10/11/2022 01:00 1.00 COMPZ1, PLUG CIRC P Circulating while batching up 16.8ppg scement. 3,720.0 3,720.0 10/11/2022 01:00 10/11/2022 02:30 1.50 COMPZ1, PLUG CMNT P SLB, Tested lines to 2500 psi high, pump 45bbls of 13.5 ppg Mud Push II @ 3 bbls/min, 118 psi, Batch cement (cement wet @ 23:15hrs) Pump 87 bbls of Class G 16.8 ppg cement @ 4.2 bbls/min, ICP = 207 psi, FCP = 180 psi. Batch and pump 3.5 bbls 13.5 ppg Mud Push II at 1.8 bbls/min, 138 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 4.2 bbls/min, ICP = 166 psi, FCP= 235 psi. 0 losses during the job, shut down pumps at (22 bbls). Rotating at 30rpm 1.5k torque, CIP 02:35 Hrs 10/11/2022. 3,720.0 3,720.0 10/11/2022 02:30 10/11/2022 04:00 1.50 COMPZ1, PLUG TRIP P R/D cement swivel and POOH from 3,720' MD to 2,777' MD at 15'/min. (pipe pulling dry) 3,720.0 2,777.0 10/11/2022 04:00 10/11/2022 05:00 1.00 COMPZ1, PLUG CIRC P Install Nerf ball, Circulate at 2,777' MD at 756gpm 845psi. Circulate 2 S-S volumes. No cement returns to surface 2,777.0 2,777.0 10/11/2022 05:00 10/11/2022 05:45 0.75 COMPZ1, PLUG RURD P Rig down cement swivel and pumping equipment. Blow down top drive. 2,777.0 2,777.0 10/11/2022 05:45 10/11/2022 07:00 1.25 COMPZ1, PLUG TRIP P POOH from 2,777' MD to 945' MD. 2,777.0 945.0 10/11/2022 07:00 10/11/2022 09:00 2.00 COMPZ1, PLUG PULD P R/U Tubing tongs and equipment. L/D 3.5" cement string. 945.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 18/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/11/2022 09:00 10/11/2022 10:00 1.00 COMPZ1, PLUG CLEN P R/D tubing tongs and equipment, Clean and clear rig floor 0.0 0.0 10/11/2022 10:00 10/11/2022 11:30 1.50 SURFAC, WHDBOP OTHR P Change UPR to 2-7/8" X 5-1/2" VBR. 0.0 0.0 10/11/2022 11:30 10/11/2022 12:00 0.50 SURFAC, WHDBOP PRTS P Pull wear ring and set test plug, Install test equipment on top drive and safety valves 0.0 0.0 10/11/2022 12:00 10/11/2022 14:00 2.00 SURFAC, WHDBOP WAIT T Waiting on AOGCC to arrive for BOP test. 0.0 0.0 10/11/2022 14:00 10/11/2022 21:30 7.50 SURFAC, WHDBOP BOPE P BOPE Test All tests to 250psi/5min 3500psi/10min Annular 250psi/5min 3500psi/10min w/ exception of manual and super choke t/ 2000 psi. 4” Test jt: test annular 2 7/8" x 5 1/2" UPR 2 7/8" 5 1/2" LPR,Test choke valves 1-15. Manual operated and super choke. W/ 5" Test jt: test annular 2 7/8" x 5 1/2" UPR 2 7/8" 5 1/2" LPR Choke manual and HCR valves. 4" kill line valve. Test 2x 4" FO safety valves. 4" dart valve. Test 2x 5" FO safety valves. 5" dart valveTest upper and lower IBOP. Blind/Shear rams. Koomey test preformed 10-11-22 Performed Koomey draw down, ACC = 3050 psi, Manifold = 1500 psi, ACC = 1600 psi after all functions on bottles,15 sec for 200 psi. Build w/ 2 electric pumps, 97 sec to build full system pressure w/ 2 electrical and 2 air pumps, closing times annular = 24 sec. UPR = 14 sec, Blind / Shears = 22 sec, LPR = 15 sec, choke HCR = 2 sec, Kill HCR = 2 sec. Test PVT gain/loss and flow out alarms. Test LEL and H2S alarms AOGCC Kam StJohn witness test. BLM Allie Schoessler waived witness 10 -10-22 @ 09:25hrs. 0.0 0.0 10/11/2022 21:30 10/11/2022 22:30 1.00 SURFAC, WHDBOP OTHR P Pull test plug and install wear bushing. 0.0 0.0 10/11/2022 22:30 10/12/2022 00:00 1.50 SURFAC, DRILLOUT BHAH P Change out X/O subs on BHA and L/D. P/U Baker BHA #6. 0.0 0.0 10/12/2022 00:00 10/12/2022 02:00 2.00 SURFAC, DRILLOUT BHAH P Continue P/U Baker 12-1/4" BHA to 560' MD. 0.0 560.0 10/12/2022 02:00 10/12/2022 04:00 2.00 SURFAC, DRILLOUT TRIP P TIH from 560' MD to 2,629' MD. 560.0 2,629.0 10/12/2022 04:00 10/12/2022 04:30 0.50 SURFAC, DRILLOUT WASH P Break circulation at 2,629' MD. Surface test MWD tools. PU: 117k SO: 113k ROT: 115k GPM: 800 PSI: 1200 RPM 30 TRQ: 3.2k 2,629.0 2,629.0 10/12/2022 04:30 10/12/2022 05:30 1.00 SURFAC, DRILLOUT WASH P Wash in hole from 2,629' MD to 3,074'MD (tagged cement) with 10k GPM: 50 PSI: 82 2,629.0 3,074.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 19/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/12/2022 05:30 10/12/2022 07:00 1.50 SURFAC, DRILLOUT CIRC P Circulate BTM's up st 3,074' MD. GPM: 660 PSI: 953 3,074.0 3,074.0 10/12/2022 07:00 10/12/2022 08:30 1.50 SURFAC, DRILLOUT PRTS P Rack back 1 std. RU and test csg to 1700 psi f/ 30 minutes.Charted.Good test. 3,074.0 3,074.0 10/12/2022 08:30 10/12/2022 13:30 5.00 SURFAC, DRILLOUT DRLG P Drill out cement in casing f/ 3074' to 3435'. 12k WOB 725 GPM 1400 PSI 80 RPM 10k TQ on bttm 4.5k TQ off bttm 125k PU 112k SO 120k ROT 3,074.0 3,435.0 10/12/2022 13:30 10/12/2022 19:00 5.50 SURFAC, DRILLOUT DDRL P Time drill f/ 3435' to 3505'. Displace to 12.0ppg FW polymer mud while drilling ahead. 750 GPM 1326 PSI 3,435.0 3,505.0 10/12/2022 19:00 10/12/2022 20:00 1.00 SURFAC, DRILLOUT CIRC P CBU while BROOH to 3382'. RU to perform FIT. 3,505.0 3,382.0 10/12/2022 20:00 10/12/2022 21:00 1.00 SURFAC, DRILLOUT LOT P Perform LOT to 17.5ppg EMW. Charted. 2.4 bbls pumped 1.2 bbls returned, RD test equipment. Take parameters inside casing for baseline: 117k PU 110k SO 112k ROT 6k TQ Note: First test went to 1100psi. SD and pressure decreased as if a surface leak or a sensator problem.Bled off pressure. Checked equipment (no issues found) and performed a second test. 3,382.0 3,382.0 10/12/2022 21:00 10/13/2022 00:00 3.00 INTRM1, DRILL DDRL P Drill 3505'MD to 3700' MD/3243' TVD. 18k WOB 998 GPM 2180 PSI 150 RPM 10k TQ on bttm 6k TQ off bttm 12.5ppg ECD 117k PU 110k SO 112k ROT 6.5 bit hrs 79.4 jar hrs 3,382.0 3,700.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 20/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/13/2022 00:00 10/13/2022 06:00 6.00 INTRM1, DRILL DDRL P Drill 3700'MD to 4384' MD/ 3714' TVD.. 11k WOB 800 GPM 1750 PSI 150 RPM 11k TQ on bttm 6k TQ off bttm 12.6ppg ECD 138k PU 121k SO 122k ROT 10.8 bit hrs 84.9 jar hrs Note: Eddy pump went down. Slow pump rate and ROP while troubleshooting. Using Super sucker trucks to empty cutings pit. 3,700.0 4,384.0 10/13/2022 06:00 10/13/2022 08:00 2.00 INTRM1, DRILL DDRL P Drill 4384'MD to 4571' MD/ 3834' TVD.. 9k WOB 900 GPM 2145 PSI 150 RPM 10k TQ on bttm 6k TQ off bttm 12.7ppg ECD 138k PU 121k SO 122k ROT 10.8 bit hrs 84.9 jar hrs Note: Eddy pump back working. 4,384.0 4,571.0 10/13/2022 08:00 10/13/2022 08:30 0.50 INTRM1, DRILL SVRG P Observed bad O-ring at interconnect to mud pits. SD and blow down lines while servicing rig. 4,571.0 4,571.0 10/13/2022 08:30 10/13/2022 12:00 3.50 INTRM1, DRILL RGRP T Change out Oring. Line still leaking. SD and blow down line. Observed wash out at union. Replace union. While changing union decision made to BROOH to shoe using injection line to pump. 10 RPM 4-8k TQ 84 GPM 400 PSI 112k ROT 4,571.0 3,573.0 10/13/2022 12:00 10/13/2022 12:30 0.50 INTRM1, DRILL BKRM T Torqued up and stalled out @ 3573'. Immediate loss of returns. Work free. Bring flow rate to 2 bpm/ 285 psi w/ no returns. 3,573.0 3,573.0 10/13/2022 12:30 10/13/2022 16:00 3.50 INTRM1, DRILL REAM T Wash/ream back f/ 3573' to 4570'. No returns 42-630 GPM 125-1700 PSI 20-80 RPM 2-12k TQ 3,573.0 4,570.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 21/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/13/2022 16:00 10/13/2022 17:30 1.50 INTRM1, DRILL CIRC T Pump 90bbl of 35ppb LCM pill @ 4570'. No returns. Recipe: MIX 2 Medium-5ppb Walnut plug Fine-10ppb Walnut plug Med-10ppb Safe Carb 500- 10ppb 4,570.0 4,570.0 10/13/2022 17:30 10/13/2022 19:00 1.50 INTRM1, DRILL PMPO T Pump out of hole f/ 4570' to 3625'. Observed 20k O/P @ 3625'. No returns. 4,570.0 3,625.0 10/13/2022 19:00 10/13/2022 22:00 3.00 INTRM1, DRILL BKRM T Pump/BROOH f/ 3625' to 3565'. 20-30k OP. RPM 20-60. TQ 10-13k. 40-80GPM 250-400 PSI. No returns. 3,625.0 3,565.0 10/13/2022 22:00 10/14/2022 00:00 2.00 INTRM1, DRILL WASH T Wash/ream f/ 3565' t0 3800'. Regained partial returns @ 3789'. Lost returns again @ 3800'. 30-165 GPM 420-520 PSI 50 RPM 6k TQ 3,565.0 3,800.0 10/14/2022 00:00 10/14/2022 02:30 2.50 INTRM1, DRILL WASH T Work pipe to regain circulation. No success. Decision made to run to bottom and spot LCM pill. Waash/ream to bottom @ 4571'. (No fill). 3,800.0 4,571.0 10/14/2022 02:30 10/14/2022 03:30 1.00 INTRM1, DRILL CIRC T Pump 92bbls of 45 ppb LCM pill @ 3-4 bpm 450-500 psi.. No returns. Recipe: Mix 2 Medium-5ppb Walnut plug Fine- 10ppb Walnut plug Medium- 5ppb Walnut plug Coarse- 11ppb Safe Carb 500- 10ppb Safe Carb 750- 4ppb 4,571.0 4,571.0 10/14/2022 03:30 10/14/2022 05:30 2.00 INTRM1, DRILL PMPO T Pump out of hole @ 1/2 bpm f/ 4571' to 3750'. 4,571.0 3,750.0 10/14/2022 05:30 10/14/2022 09:00 3.50 INTRM1, DRILL BKRM T BROOH f/ 3750'- 3350'. Started seeing minimal returns @ 3645'. Stopped moving and contiued rotating. Staged pumps up as returns increased. Moved pipe 1-2ft every 5-10 minutes. Hole unloaded w/ clay and cuttings. Cleaned flowlines and shakers. Continued circulating and back reamed into shoe w/ no issues. 120-150 RPM 6k TQ 80-500 GPM 300-550 PSI. 3,800.0 3,350.0 10/14/2022 09:00 10/14/2022 10:00 1.00 INTRM1, DRILL CIRC T Circulate and condition mud. Full returns. 750 GPM 1050 PSI 3,350.0 3,350.0 10/14/2022 10:00 10/14/2022 13:00 3.00 INTRM1, DRILL BKRM T BROOH f/ 3350' to 2533'. Hole continued to unload. 1000 GPM 1740 PSI 40-100 RPM 4k TQ 3,350.0 2,533.0 10/14/2022 13:00 10/14/2022 15:00 2.00 INTRM1, DRILL TRIP T TIH f/ 2533' to 4419'. 2,533.0 4,419.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 22/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/14/2022 15:00 10/14/2022 16:00 1.00 INTRM1, DRILL WASH T Wash down f/ 4419' to 4571'. 800 GPM 1500 PSI 80 RPM 5k TQ 11.1ppg ECD 4,419.0 4,571.0 10/14/2022 16:00 10/15/2022 00:00 8.00 INTRM1, DRILL DDRL P Drill 4571'MD to 5460' MD/ 4406' TVD.. 9k WOB 1000 GPM 2300 PSI 150 RPM 10k TQ on bttm 7k TQ off bttm 11.2ppg ECD 150k PU 134k SO 145k ROT 17.8 bit hrs 90.7 jar hrs Note: Ball Mill went down with bad bearing at 17:30hrs, Slow ROP to accomodate cuttings. 4,571.0 5,460.0 10/15/2022 00:00 10/15/2022 06:00 6.00 INTRM1, DRILL DDRL P Drill 5460'MD to 6113' MD/ 4825' TVD. 12k WOB 1000 GPM 2430 PSI 170 RPM 10k TQ on bttm 5k TQ off bttm 11.6ppg ECD 158k PU 140k SO 147k ROT 22.4 bit hrs 95.3 jar hrs 5,460.0 6,113.0 10/15/2022 06:00 10/15/2022 12:00 6.00 INTRM1, DRILL DDRL P Drill 6113'MD to 6718' MD/ 5214' TVD. 15k WOB 1000 GPM 2690 PSI 170 RPM 12k TQ on bttm 6k TQ off bttm 11.7ppg ECD 165k PU 146k SO 153k ROT 26.7 bit hrs 99.6 jar hrs 6,113.0 6,718.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 23/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/15/2022 12:00 10/15/2022 18:00 6.00 INTRM1, DRILL DDRL P Drill 6718'MD to 7360' MD/ 5627' TVD. 19k WOB 1000 GPM 2840 PSI 170 RPM 15k TQ on bttm 12k TQ off bttm 11.7ppg ECD 182k PU 155k SO 168k ROT 31.2 bit hrs 104.1 jar hrs 6,718.0 7,360.0 10/15/2022 18:00 10/16/2022 00:00 6.00 INTRM1, DRILL DDRL P Drill 7360'MD to 8001' MD/ 6038' TVD. 19k WOB 1000 GPM 2960 PSI 170 RPM 15k TQ on bttm 12k TQ off bttm 11.7ppg ECD 195k PU 155k SO 172k ROT 35.6 bit hrs 108.5 jar hrs 7,360.0 8,001.0 10/16/2022 00:00 10/16/2022 00:30 0.50 INTRM1, DRILL SVRG P Service rig 8,001.0 8,001.0 10/16/2022 00:30 10/16/2022 06:00 5.50 INTRM1, DRILL DDRL P Drill 8001'MD to 8568' MD/ 6403' TVD. 20k WOB 1000 GPM 3375 PSI 170 RPM 19k TQ on bttm 12k TQ off bttm 12.4ppg ECD 210k PU 152k SO 182k ROT 39.7 bit hrs 112.6 jar hrs Note: Start weighting up @ 02:30hrs. 8200' 8,001.0 8,568.0 10/16/2022 06:00 10/16/2022 12:30 6.50 INTRM1, DRILL DDRL P Drill 8568'MD to 9136' MD/ 6748' TVD. 18k WOB 900 GPM 2890 PSI 170 RPM 20k TQ on bttm 14k TQ off bttm 12.8ppg ECD 240k PU 150k SO 176k ROT 44.3 bit hrs 117.2 jar hrs 8,568.0 9,136.0 10/16/2022 12:30 10/16/2022 13:30 1.00 INTRM1, DRILL CIRC P CBU. 900 GPM 3100 PSI 150 RPM 15k TQ 12.7ppg ECD 9,136.0 9,136.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 24/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/16/2022 13:30 10/16/2022 18:00 4.50 INTRM1, DRILL DDRL P Drill 9136'MD to 9525' MD/ 7019' TVD. 18k WOB 900 GPM 2890 PSI 150 RPM 20k TQ on bttm 14k TQ off bttm 12.8ppg ECD 240k PU 150k SO 176k ROT 48.2 bit hrs 121.1 jar hrs 9,136.0 9,525.0 10/16/2022 18:00 10/17/2022 00:00 6.00 INTRM1, DRILL DDRL P Drill 9525'MD to 9935' MD/ 7283' TVD. 23k WOB 950 GPM 3470 PSI 170 RPM 21k TQ on bttm 17k TQ off bttm 12.9ppg ECD 249k PU 157k SO 190k ROT 53.2 bit hrs 126.1 jar hrs Note: Performed 500bbl dump and dilute @ 9650' @ 20:00hrs 9,525.0 9,935.0 10/17/2022 00:00 10/17/2022 04:00 4.00 INTRM1, DRILL DDRL P Drill 9935'MD to 10226' MD/ 7468' TVD. Section TD. 23k WOB 950 GPM 3470 PSI 170 RPM 21k TQ on bttm 17k TQ off bttm 12.9ppg ECD 249k PU 157k SO 190k ROT 53.2 bit hrs 126.1 jar hrs 9,935.0 10,226.0 10/17/2022 04:00 10/17/2022 08:30 4.50 INTRM1, TRIPCAS BKRM P Circulate on bottom to clear HRZ. Take final survey.BROOH at 1 BU per std f/ 3 stds f/ 10226' to 9886'. 950 GPM 3630 PSI 150 RPM 20k TQ 10,226.0 9,886.0 10/17/2022 08:30 10/17/2022 09:00 0.50 INTRM1, TRIPCAS OWFF P Flow check. Static. 9,886.0 9,886.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 25/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/17/2022 09:00 10/17/2022 18:00 9.00 INTRM1, TRIPCAS BKRM P BROOH f/ 9886' to 7550'. 950 GPM 3340 PSI 140 RPM 16k TQ 12.9ppg ECD 9,886.0 7,550.0 10/17/2022 18:00 10/18/2022 00:00 6.00 INTRM1, TRIPCAS BKRM P BROOH f/ 7550' to 6559'. 1000 GPM 3200 PSI 140 RPM 16k TQ 12.9ppg ECD 7,550.0 6,559.0 10/18/2022 00:00 10/18/2022 01:30 1.50 INTRM1, TRIPCAS BKRM P BROOH f/ 6559' to 6250'. 950 GPM 3200 PSI 140 RPM 16k TQ 12.9ppg ECD 6,559.0 6,250.0 10/18/2022 01:30 10/18/2022 02:30 1.00 INTRM1, TRIPCAS CIRC P Observed ECDs staying @ 13.0ppg and increasing to 13.1ppg. Torque jumping. CBU and reciprocate DS. Observed increase of large cuttings at shakers. 6,250.0 6,250.0 10/18/2022 02:30 10/18/2022 06:00 3.50 INTRM1, TRIPCAS BKRM P BROOH f/ 6250' to 5540'. 950 GPM 3200 PSI 140 RPM 16k TQ 12.9ppg ECD 6,250.0 5,650.0 10/18/2022 06:00 10/18/2022 14:30 8.50 INTRM1, CASING BKRM P BROOH f/ 5540' to 3755'. 1000 GPM 2430 PSI 140 RPM 7k TQ 12.3ppg ECD 5,650.0 3,755.0 10/18/2022 14:30 10/18/2022 15:00 0.50 INTRM1, CASING BKRM P BROOH f/ 3755' to 3662' circulate 2 BU. 1000 GPM 2560 PSI 140 RPM 11k TQ 12.5ppg ECD 3,755.0 3,662.0 10/18/2022 15:00 10/18/2022 16:30 1.50 INTRM1, CASING BKRM P BROOH f/ 3662' to 3380'. No issues pulling into shoe. 1000 GPM 2520 PSI 140 RPM 8k TQ 12.4ppg ECD 3,662.0 3,380.0 10/18/2022 16:30 10/18/2022 18:00 1.50 INTRM1, CASING CIRC P Circulate 42bbl low vis and 30bbl Hi vis nut plug sweeps around. Observed large cuttings increase across shakers at BU. Circulate until shakers ceaned up.. 1000 GPM 2430 PSI 40 RPM 8k TQ 12.3ppg ECD 3,380.0 3,380.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 26/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/18/2022 18:00 10/18/2022 20:30 2.50 INTRM1, CASING TRIP P POOH on elevators. f/ 3380' to BHA @560'. 3,380.0 560.0 10/18/2022 20:30 10/18/2022 21:00 0.50 INTRM1, CASING OWFF P Flow check. Static. PJSM f/ BHA 560.0 560.0 10/18/2022 21:00 10/18/2022 23:30 2.50 INTRM1, CASING BHAH P F/ 560 to surface.Rack back HWDP and jars. LD BHA. 560.0 0.0 10/18/2022 23:30 10/19/2022 00:00 0.50 INTRM1, CASING CLEN P Clean and clear rig floor. SimOps: Prep to change out UPR 0.0 0.0 10/19/2022 00:00 10/19/2022 02:00 2.00 INTRM1, CASING BOPE P MU jetting tool and wash BOP and WH area. Drain stack LD jetting tool. Retrieve wear bushing. Install test plug and 9 5/8" test joint. SimOps: Swapping out UPR to 9 5/8" casing rams. 0.0 0.0 10/19/2022 02:00 10/19/2022 04:00 2.00 INTRM1, CASING BOPE P Test UPR and annular w/ 9 5/8" test joint. 250/3500psi 5/10 min ea. RD test equipment. Pull test plug and LD 9 5/8" test joint. SimOps: Stage csg running equipment. Ram test witnessed by Quinn Sawyer- BLM Waived by AOGCC- Adam Earl by email 0:31hrs 10/19/22 0.0 0.0 10/19/2022 04:00 10/19/2022 05:30 1.50 INTRM1, CASING RURD P RU 9 5/8" csg equipment.PJSM on running casing. 0.0 0.0 10/19/2022 05:30 10/19/2022 13:30 8.00 INTRM1, CASING PUTB P MU 9 5/8" 47# shoetrack. Threadlock connections through 4th pin. Fill shoetrack and check floats. Good. RIH w/ 9 5/8" 47# T95 H563 casing to 3350'. Filling pipe every 10 jts. 0.0 3,350.0 10/19/2022 13:30 10/19/2022 14:30 1.00 INTRM1, CASING CIRC P CBU. Stage pumps up to 6 BPM 6 BPM 200 PSI 159k PU 152k SO 157k ROT 20 RPM 6k TQ 3,350.0 3,350.0 10/19/2022 14:30 10/19/2022 20:00 5.50 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# T95 H563 and 43.50# L80 H563 casing f/ 3350' to 6150'. Filling pipe every 10jts. 47# MU TQ 15.8k 43.50# MU TQ 14.3k 3,350.0 6,150.0 10/19/2022 20:00 10/19/2022 21:00 1.00 INTRM1, CASING CIRC P CBU. Stage pumps up to 6 BPM 2BPM-214PSI 3BPM-241PSI 4BPM-273PSI 5BPM-306PSI 6 BPM-325 PSI 6,150.0 6,150.0 10/19/2022 21:00 10/20/2022 00:00 3.00 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# T95 H563 and 43.50# L80 H563 casing f/ 6150' to 7875'. Filling pipe every 10jts. 47# MU TQ 15.8k 43.50# MU TQ 14.3k 6,150.0 7,875.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 27/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/20/2022 00:00 10/20/2022 02:30 2.50 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# T95 H563 and 43.50# L80 H563 casing f/ 7875' to 9150'. Filling pipe every 10jts. 47# MU TQ 15.8k 43.50# MU TQ 14.3k 7,875.0 9,150.0 10/20/2022 02:30 10/20/2022 04:00 1.50 INTRM1, CASING CIRC P CBU. Stage pumps up to 6 BPM.Final circ pressure 560PSI 2BPM- 366PSI 3BPM- 418PSI 4BPM- 445PSI 5BPM- 543PSI 6BPM- 600PSI 9,150.0 9,150.0 10/20/2022 04:00 10/20/2022 05:30 1.50 INTRM1, CASING PUTB P RIH w/ 9 5/8" 47# T95 H563 and 43.50# L80 H563 casing f/ 9150' to 9765'. Filling pipe every 10jts. 47# MU TQ 15.8k 43.50# MU TQ 14.3k 9,150.0 9,765.0 10/20/2022 05:30 10/20/2022 08:30 3.00 INTRM1, CASING PUTB P Observed 10-20k drag. Circulate wash down f/ 9765' to 10175'. Full returns. PU 375k 1-2 BPM 400-460 PSI 9,765.0 10,175.0 10/20/2022 08:30 10/20/2022 10:30 2.00 INTRM1, CASING OTHR T MU hanger and Landing joint. Attempt to wash in hole. No success. Work pipe. 400k Up. 100k down. No progress. Circulate @ 50-330 GPM. 300-2000PSI. 10,175.0 10,177.0 10/20/2022 10:30 10/20/2022 14:30 4.00 INTRM1, CASING OTHR T LD landing joint and hanger. Continue working pipe. 400k UP. 49k down. Attempt w/ trapping 14.3 tq in string. Stage pumps to 420 GPM No success. No losses. Release TQ and pull up to 560k max. No progress. Decision made to perform cement job. 10,177.0 10,177.0 10/20/2022 14:30 10/20/2022 15:30 1.00 INTRM1, CASING PULD T LD joint # 238. MU pup jt. RU cement line to volant tool. 10,177.0 10,177.0 10/20/2022 15:30 10/20/2022 16:30 1.00 INTRM1, CEMENT CIRC P Circulate staging up to 6 BPM. 600 PSI. 10,177.0 10,177.0 10/20/2022 16:30 10/20/2022 21:00 4.50 INTRM1, CEMENT CMNT P Line up cement unit. flush w/ 3 bbls FW. Test lines to 3500psi. Good test. Mix and pump 60bbls 12.5ppg mud push II at 4 bpm. SD and drop bottom plug. Mix and pump 178bbls 13 ppg G lead cement at 4.5 bpm, Mix and pump 115bbls 15.8 ppg G Tail cement at 4.5 bpm. SD and drop top plug. Pump 20 bbls FW w/ cement. Swap over to rig pumps and Displace cement at 6bpm250-1000psi.At 700bbls slow rate to 3bpm 900psi. Plug bumped @ 6145 stks (calculated stks 6208). Pressure up to 1500psi. Check floats. Good. Cement in place @ 20:55hrs 10/20/22 10,177.0 10,177.0 10/20/2022 21:00 10/20/2022 22:30 1.50 INTRM1, CEMENT PRTS P Test casing to 3500psi f/ 30 minutes. Charted. Good test. 9bbls pumped. 9bbls returned 10,177.0 10,177.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 28/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/20/2022 22:30 10/21/2022 00:00 1.50 INTRM1, CEMENT WOC T WOC as per dispensation to achieve 100psi compressive strength. RD cement lines. Cleaning pits and prep for OBM. Stage equipment for setting E- slips. C/O liners in mud pumps. Cleaning pits and shakers.Perform inspections and PMs. Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 10,177.0 10/21/2022 00:00 10/21/2022 13:30 13.50 INTRM1, CEMENT WOC T WOC as per dispensation to achieve 100psi compressive strength. (11hrs/20min per lab). Lead surface sample not set until 13:30hrs. PJSM w/ all involved in setting Eslips. Discuss dispensation and all hazards. SimOps- Cleaning pits. Swap liners in mud pumps to 5 1/2". Clean rig floor. Stage BHA equipment to rig floor. Monitor well on TT. Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 10,177.0 10/21/2022 13:30 10/21/2022 14:30 1.00 INTRM1, CEMENT WWSP T Back out Volant tool and vacumn mud out of casing jt and pump out BOPE. Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 10,177.0 10/21/2022 14:30 10/21/2022 15:00 0.50 INTRM1, CEMENT OWFF T Flow check well at wellhead. Slight loss observed, Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 10,177.0 10/21/2022 15:00 10/21/2022 16:00 1.00 INTRM1, CEMENT NUND T ND between casing spool and tbg spool. PU stack and prep to set E-slips and cut csg.. Continous monitoring of well bore as per dispensation. Top filling as needed. Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 10,177.0 10/21/2022 16:00 10/21/2022 18:30 2.50 INTRM1, CEMENT NUND T Set 9 5/8" E-slips as per FMC w/ 347k. Make rough cut on casing. LD pup joint and cut joint (35.15') of casing Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 10,177.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 29/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/21/2022 18:30 10/21/2022 22:30 4.00 INTRM1, CEMENT NUND T Dress stump.Set 9 5/8" packoff. Torque up casing spool. Test packoff to 3048 psi f/ 10 min. Good test. Witnessed by COP DSV. SimOps: RD csg equipment. CO UPR to 4 1/2" x 7" VBR. Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 10,177.0 0.0 10/21/2022 22:30 10/22/2022 00:00 1.50 INTRM1, WHDBOP NUND T Install test plug. NU MPD and test. 250/1250psi Note: Operating under Approved Alaska MT7 INT1 Emergency Slips Dispensation 0.0 0.0 10/22/2022 00:00 10/22/2022 02:00 2.00 INTRM1, WHDBOP BOPE P Test UPR and annular w/ 5" and 7" test joints. 250/3500psi 5/10min each. AOGCC waived witness -Adam Earl email 08:28hrs 10/19/22 0.0 0.0 10/22/2022 02:00 10/22/2022 02:30 0.50 INTRM1, WHDBOP RURD P RD test equipment. Retrieve test plug. Install wear bushing. 0.0 0.0 10/22/2022 02:30 10/22/2022 04:30 2.00 INTRM1, DRILLOUT SLPC P Cut/Slip drill line 0.0 0.0 10/22/2022 04:30 10/22/2022 07:30 3.00 INTRM1, DRILLOUT BHAH P PJSM. MU and RIH w/ BHA #7 to 546'. 60k PU 60k SO 0.0 546.0 10/22/2022 07:30 10/22/2022 15:00 7.50 INTRM1, DRILLOUT TRIP P RIH w/ BHA #7 f/ 546' to 9775'. Shallow test MWD @ 2335'. SimOps: Attempt to perform Annular freeze protect. Reached max psi. SD. Pressure decreasing slowly. Wait 2.5hrs and pump again. Pump 1.7bbls to max pressure.SD. 546.0 9,775.0 10/22/2022 15:00 10/22/2022 16:30 1.50 INTRM1, DRILLOUT WASH P Wash down f/ 9775' to 10085'. (Tag plugs @ 10085' w/ 42GPM/525PSI). 620 GPM 2950 PSI 9,775.0 10,085.0 10/22/2022 16:30 10/22/2022 18:30 2.00 INTRM1, DRILLOUT CIRC P Displace to 11.5ppg Versaclean OBM. 250-330 GPM 840-1285 PSI 50 RPM 11k-20k TQ. (decreased as OBM came up annulus). SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 8.4. 10,085.0 10,085.0 10/22/2022 18:30 10/22/2022 22:00 3.50 INTRM1, DRILLOUT CLEN P SD. Clean pits/shakers. Wait on truck to transfer OBM from upright tank to pits. SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 9.94. 10,085.0 10,085.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 30/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/22/2022 22:00 10/23/2022 00:00 2.00 INTRM1, DRILLOUT DRLG P Drillout plugs/FC f/ 10085' MD to 10887' 420 GPM 2025PSI 80 RPM 10.5k TQ 12.2ppg ECD 10,085.0 10,087.0 10/23/2022 00:00 10/23/2022 01:30 1.50 INTRM1, DRILLOUT DRLG P Drill out FC/shoetrack and FS to 10177'. 5-12k WOB 100 RPM 12k TQ 600 GPM 3300 PSi 10,087.0 10,177.0 10/23/2022 01:30 10/23/2022 03:00 1.50 INTRM1, DRILLOUT WASH P Wash/ream rathole f/ 10177' to 10226' 10,177.0 10,226.0 10/23/2022 03:00 10/23/2022 03:30 0.50 INTRM1, DRILLOUT BKRM P BROOH to shoe. At 10190' stalled out and packed off. Slow rate and work pipe. Continue BROOH slowly to shoe. Torque and pressure spikes until in shoe. 500 GPM 2600 PSI 100 RPM 10-12k TQ 12.6-12.9ppg ECD 10,226.0 10,150.0 10/23/2022 03:30 10/23/2022 04:30 1.00 INTRM1, DRILLOUT CIRC P CBU f/ 10050' 600 GPM 3400 PSI 60 RPM 11k TQ 12.6ppg ECD 183k ROT 10,150.0 10,150.0 10/23/2022 04:30 10/23/2022 05:00 0.50 INTRM1, DRILLOUT WASH P Wash/Ream in hole to 10205'. BROOH to shoe. Wash/Ream to 10226'. BROOH to shoe. 500 GPM 2470 PSI 100 RPM 13k TQ. 10,150.0 10,226.0 10/23/2022 05:00 10/23/2022 05:30 0.50 INTRM1, DRILLOUT DDRL P Drill 20' new formation 10226' MD to 10246' MD. 500 GPM 2470 PSi 120 RPM 14k TQ 12.40ppg ECD 10,226.0 10,246.0 10/23/2022 05:30 10/23/2022 06:30 1.00 INTRM1, DRILLOUT BKRM P BROOH to shoe f/ FIT. 10,246.0 10,150.0 10/23/2022 06:30 10/23/2022 07:30 1.00 INTRM1, DRILLOUT FIT P RU test equipment. Perform FIT to 14.0ppg EMW. RD test equipment. 10,150.0 10,150.0 10/23/2022 07:30 10/23/2022 08:30 1.00 INTRM1, DRILLOUT MPDA P Retrieve trip nipple and install MPD bearing assembly. 10,150.0 10,150.0 10/23/2022 08:30 10/23/2022 09:00 0.50 INTRM1, DRILLOUT WASH P Wash/ream to 10246'. 600 GPM 3255 PSI 60 RPM 11k TQ 12.4ppg ECD 10,150.0 10,246.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 31/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/23/2022 09:00 10/23/2022 10:00 1.00 INTRM2, DRILL DDRL P Drill 8 1/2" interm 2 section f/ 10246' MD to 10327' MD 11k WOB 600 GPM 3490 PSI 120 RPM 14k TQ on bttm 13k TQ off bttm 12.4ppg ECD .5 Bit hrs 130.1 Jar hrs 10,246.0 10,327.0 10/23/2022 10:00 10/23/2022 11:30 1.50 INTRM2, DRILL CIRC P Record parameters and drop 1.25" activation ball for reamer. Pump down @ 250GPM/1000 PSI.Slow to 100GPM/649 PSI. Observed shear @ 1384 PSI. check parameters and perform ledge test (good). Parameters Before: 660 GPM 3900 PSI 30 RPM 9.6k TQ 4974 TurbineRPM After: 660 GPM 3590 PSI 30 RPM 10k TQ 4404 TurbineRPM 10,327.0 10,327.0 10/23/2022 11:30 10/23/2022 17:30 6.00 INTRM2, DRILL DDRL P Drill 8 1/2" x 9 7/8" interm 2 section f/ 10327' MD to 10816' MD. 11k WOB 600 GPM 3490 PSI 120 RPM 14k TQ on bttm 13k TQ off bttm 12.4ppg ECD Bit hrs Jar hrs SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 15.43. 10,327.0 10,816.0 10/23/2022 17:30 10/23/2022 22:30 5.00 INTRM2, DRILL DDRL P Drill 8 1/2" x 9 7/8" interm 2 section f/ 10816' MD to 10953' MD/ 7850' TVD. Control drill @ 30 ft/hr due to Eddy pump plugged off. 11k WOB 600 GPM 3490 PSI 120 RPM 14k TQ on bttm 13k TQ off bttm 12.4ppg ECD Bit hrs Jar hrs 10,816.0 10,953.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 32/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/23/2022 22:30 10/24/2022 00:00 1.50 INTRM2, DRILL DDRL P Drill 8 1/2" x 9 7/8" interm 2 section f/ 10953' MD to 11116' MD/ 7907' TVD. 25k WOB 650 GPM 3425 PSI 160 RPM 20k TQ on bttm 16k TQ off bttm 1213.0ppg ECD 11.0Bit hrs 140.6Jar hrs 10,953.0 11,116.0 10/24/2022 00:00 10/24/2022 06:00 6.00 INTRM2, DRILL DDRL P Drill 8 1/2" x 9 7/8" interm 2 section f/ 11116' MD to 11701' MD/8124' TVD . 23k WOB 650 GPM 3461 PSI 160 RPM 22k TQ on bttm 14k TQ off bttm 13.0ppg ECD 640 PSI MPD back pressure on connections. 15.1Bit hrs 144.7 Jar hrs 248k PU 136k SO 180k ROT SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 16.80. 11,116.0 11,701.0 10/24/2022 06:00 10/24/2022 12:00 6.00 INTRM2, DRILL DDRL P Drill 8 1/2" x 9 7/8" interm 2 section f/ 11701' MD to 12224' MD/8282' TVD . 23k WOB 650 GPM 3461 PSI 160 RPM 22k TQ on bttm 14k TQ off bttm 13.0ppg ECD 640 PSI MPD back pressure on connections. 15.1Bit hrs 144.7 Jar hrs 248k PU 136k SO 180k ROT SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 16.80. 11,701.0 12,224.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 33/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/24/2022 12:00 10/24/2022 14:00 2.00 INTRM2, DRILL DDRL P Drill 8 1/2" x 9 7/8" interm 2 section f/ 12224' MD to 12294' MD/8299' TVD . Section TD. 8k WOB 650 GPM 3515 PSI 160 RPM 20k TQ on bttm 15k TQ off bttm 13.0ppg ECD 640 PSI MPD back pressure on connections. 21.2Bit hrs 150.8 Jar hrs 248k PU 136k SO 180k ROT SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 16.80. 12,224.0 12,294.0 10/24/2022 14:00 10/24/2022 15:00 1.00 INTRM2, TRIPCAS CIRC P Circulate and take final survey, Take parameters for closing underreamer. Drop 1.625" closing ball and pump down. Close undereamer. Parameters confirm closed. Wash down and tag bottom. BROOH to 12230' 12,294.0 12,230.0 10/24/2022 15:00 10/24/2022 17:00 2.00 INTRM2, TRIPCAS BKRM P BROOH f/ 12230' to 12038' CBU @ 1 BU per STD x 3. 650 GPM 3700 PSI 125 RPM 14k TQ 13.0ppg ECD 12,230.0 12,038.0 10/24/2022 17:00 10/25/2022 00:00 7.00 INTRM2, TRIPCAS BKRM P BROOH f/ 12038' to 10436'. 650 GPM 3475 PSI 125 RPM 13k TQ 13.0ppg ECD 12,038.0 10,436.0 10/25/2022 00:00 10/25/2022 01:00 1.00 INTRM2, TRIPCAS BKRM P BROOH f/ 10436' to 10190'. 650 GPM 3475 PSI 125 RPM 13k TQ 13.0ppg ECD 10,436.0 10,190.0 10/25/2022 01:00 10/25/2022 02:00 1.00 INTRM2, TRIPCAS BKRM P 200psi pressure spike @ 10190' (3450Ppsi to 3650psi). Go down and slow rate. Observed losses Pull imto shoe @ 500GPM w/ no issue. Losses @ 60-70bbls/hr. 10,190.0 10,156.0 10/25/2022 02:00 10/25/2022 02:30 0.50 INTRM2, TRIPCAS CIRC P Vary rates and back off MPD pressure. and attempt to circulate losses @ 50- 60bbls/hr. Pump 42bbls of 40ppb LCM pill. 10,156.0 10,156.0 10/25/2022 02:30 10/25/2022 03:30 1.00 INTRM2, TRIPCAS SMPD P SOOH to 9688' staging up MPD pressure. Losses decreasing to 5- 10bbl/hr. 10,156.0 9,688.0 10/25/2022 03:30 10/25/2022 05:30 2.00 INTRM2, TRIPCAS CIRC P Stage up rates and MPD pressure to 600 GPM watching for losses. Holding 13.0ppg ECD w/ MPD. No losses. 9,688.0 9,600.0 10/25/2022 05:30 10/25/2022 09:00 3.50 INTRM2, TRIPCAS SMPD P SOOH f/ 9600' to 7500' as per MPD stripping schedule. 9,600.0 7,500.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 34/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/25/2022 09:00 10/25/2022 12:00 3.00 INTRM2, TRIPCAS CIRC P Displace f/ 7500' to surface with 13.2ppg OBM as per rollover schedule. minimal losses. 7,500.0 7,500.0 10/25/2022 12:00 10/25/2022 12:30 0.50 INTRM2, TRIPCAS OWFF P Flow check. slight losses observed. 7,500.0 7,500.0 10/25/2022 12:30 10/25/2022 19:30 7.00 INTRM2, TRIPCAS SMPD P SOOH f/ 7500' to BHA at 675' per MPD stripping schedule. 7,500.0 675.0 10/25/2022 19:30 10/25/2022 20:00 0.50 INTRM2, TRIPCAS OWFF P Flow check.Static 675.0 675.0 10/25/2022 20:00 10/25/2022 21:30 1.50 INTRM2, TRIPCAS MPDA P PJSM. Retrieve MPD bearing assembly. Install trip nipple. 675.0 675.0 10/25/2022 21:30 10/25/2022 22:00 0.50 INTRM2, TRIPCAS CLEN P Clean/clear rig floor. PJSM f/ BHA 675.0 550.0 10/25/2022 22:00 10/26/2022 00:00 2.00 INTRM2, TRIPCAS BHAH P LD Interm 2 BHA 550 to 75'. SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 30.14. 550.0 75.0 10/26/2022 00:00 10/26/2022 01:00 1.00 INTRM2, TRIPCAS BHAH P LD Interm 2 BHA. 75.0 0.0 10/26/2022 01:00 10/26/2022 02:00 1.00 INTRM2, CASING CLEN P Clean/Clear rig floor. PU cement head and MU 5' pup joint. 0.0 0.0 10/26/2022 02:00 10/26/2022 03:30 1.50 INTRM2, CASING RURD P RU to run 7" liner. PJSM 0.0 0.0 10/26/2022 03:30 10/26/2022 05:00 1.50 INTRM2, CASING PUTB P MU 7" shoetrack and check floats. Threadlock all connections. Good MU TQ- 7" 29# TN110 TS Blue-11640 ft/lbs 0.0 90.0 10/26/2022 05:00 10/26/2022 11:00 6.00 INTRM2, CASING PUTB P RIH w/ 7" liner f/ 90' to 2576' PU 95k SO 97k 90.0 2,576.0 10/26/2022 11:00 10/26/2022 12:00 1.00 INTRM2, CASING PUTB P MU liner hanger and fill w/ Zan Plex D. Co handling equipment. RIH w/ 1 std of 5" DP to 2791'. 2,576.0 2,791.0 10/26/2022 12:00 10/26/2022 12:30 0.50 INTRM2, CASING MPDA P Retrieve trip nipple and install MPD bearing assembly. 2,791.0 2,791.0 10/26/2022 12:30 10/26/2022 13:00 0.50 INTRM2, CASING RGRP T Reboot Pason computers. 2,791.0 2,791.0 10/26/2022 13:00 10/26/2022 14:30 1.50 INTRM2, CASING CIRC P Displace to surface w/ 11.5ppg OBM per Beyond schedule. Blow down TD and stage up pump for MPD. 2,791.0 2,791.0 10/26/2022 14:30 10/26/2022 23:00 8.50 INTRM2, CASING SMPD P SIH f/ 2791' to 10130' per MPD stripping schedule. SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 36.0 bbls. 2,791.0 10,130.0 10/26/2022 23:00 10/27/2022 00:00 1.00 INTRM2, CASING CIRC P Displace f/ shoe to surface w/ 11.5ppg OBM per Beyond schedule. 205k PU 10 RPM 10.5-12k TQ. Erratic TQ stopped rotating. 10,130.0 10,130.0 10/27/2022 00:00 10/27/2022 01:30 1.50 INTRM2, CASING CIRC P Displace f/ shoe to surface w/ 11.5ppg OBM per Beyond schedule. After 1.5 BU getting 11.7ppg out consistently. 220 GPM 685 PSI 10,130.0 10,130.0 10/27/2022 01:30 10/27/2022 02:00 0.50 INTRM2, CASING SMPD P SIH f/ 10130' to 10315' per MPD stripping schedule. 10,130.0 10,315.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 35/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/27/2022 02:00 10/27/2022 05:00 3.00 INTRM2, CASING REAM T Set down 20k @ 10315'. Atttempt to work through tight spot. Vary RPM 5- 20/Flow rate 0-4 BPM. Weight 10-70k. No progress 10,315.0 10,315.0 10/27/2022 05:00 10/27/2022 05:30 0.50 INTRM2, CASING SMPD T SOOH to insinside shoe. No issues coming into shoe. 10,315.0 10,141.0 10/27/2022 05:30 10/27/2022 07:30 2.00 INTRM2, CASING CIRC T CBU f/ 10141'. 200 GPM 720 PSI 10 RPM 12k TQ 210k PU 145k SO 175k ROT 10,141.0 10,141.0 10/27/2022 07:30 10/27/2022 08:00 0.50 INTRM2, CASING SMPD T SIH f/ 10141' to 10315'. 10,141.0 10,315.0 10/27/2022 08:00 10/27/2022 10:00 2.00 INTRM2, CASING REAM T Work tight spot @ 10315'. Varying flow rate/RPM/weights. No overpull or pressure spikes. No losses. Start slowly making progress until through tight spot @ 10325'. 0-20 RPM 12-14k TQ 5-50k weight down 10,315.0 10,320.0 10/27/2022 10:00 10/27/2022 12:30 2.50 INTRM2, CASING SMPD P SIH w/ 7" liner on DP f/ 10325' to 12278'. 135k SO 600PSI MPD staic 520 MPD dynamic 10,320.0 12,278.0 10/27/2022 12:30 10/27/2022 15:00 2.50 INTRM2, CEMENT CIRC P MU cement head/swivel. CBU staging pumps to 250 GPM 920 PSI. PJSM f/ cement job while circulating. 12,278.0 12,278.0 10/27/2022 15:00 10/27/2022 17:00 2.00 INTRM2, CEMENT CMNT P Pump 5 bbls FW w/ cement unit. Test lines to 5000psi. Pump 70bbls KCL w/ rig. SD and drop bottom dart. Mix and pump 81 bbls of 15.8 ppg cement. Drop top dart. Pump 20bbls FW w/ cement unit. Swap over to rig and displace @ 5- 6 bpm. Plug down and cement in place. @ 17:00hrs 10/27/22. FCP 400psi/ 960psi Held f/ 5 minutes and check floats. Floats held. 1.39bbls returned. No Loss to formation TOL at 9673' MD/ Shoe at 12275' MD. 12,275.0 12,275.0 10/27/2022 17:00 10/27/2022 18:00 1.00 INTRM2, CEMENT PACK P Set liner hanger and packer as per Baker. 12,275.0 12,275.0 10/27/2022 18:00 10/27/2022 20:00 2.00 INTRM2, CEMENT PRTS P Attempt to pressure test liner top packer. Pressure up to 3500psi at 1/2 bpm. Held for 4minutes and observed a 1000psi decrease. Bled off to 0 psi. Check all surface equipment/ no leaks found. Discuss with office and decision made to attempt a second test. Pressure up to 2600psi on same trajectory as first test then levelled off. SD and monitor. Observed slow leak off. Bled off pressure to 1175psi. Monior f/ 15 minutes pressure fell to 1115psi. Bled off pressure. 12,275.0 12,275.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 36/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/27/2022 20:00 10/27/2022 21:30 1.50 INTRM2, CEMENT CIRC P Pressure up to 500 psi down DS and pull out of liner top. Observed pressure fall off. CBU. Observed 18-20bbls KCL at BU. 336 GPM 950 PSI 15 RPM 8k TQ 12,275.0 12,275.0 10/27/2022 21:30 10/28/2022 00:00 2.50 INTRM2, CEMENT PULD P LD cement head and swivel. Install nerf ball in DS. Circulate DP clean. Pump slug and prep to POOH. SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 39.4bbls. 12,275.0 12,275.0 10/28/2022 00:00 10/28/2022 01:00 1.00 INTRM2, CEMENT MPDA P Flow check. Static. Retrieve MPD bearing assembly. Install trip nipple. 9,673.0 9,673.0 10/28/2022 01:00 10/28/2022 01:30 0.50 INTRM2, CEMENT SVRG P Service rig. Drop 2.85"hollow drift down DP 9,673.0 9,673.0 10/28/2022 01:30 10/28/2022 04:00 2.50 INTRM2, CEMENT PULD P POOH LD 5" DP f/ derrick management f/ 9600' to 7500' 9,673.0 7,500.0 10/28/2022 04:00 10/28/2022 07:30 3.50 INTRM2, CEMENT TRIP P POOH to running tool. 7,500.0 0.0 10/28/2022 07:30 10/28/2022 08:00 0.50 INTRM2, CEMENT PULD P LD running tool. 0.0 0.0 10/28/2022 08:00 10/28/2022 09:30 1.50 INTRM2, WHDBOP WWWH P Retrieve wear bushing. MU jetting tool andwash stack/BOPE. Install test plug f/ BOPE test. 0.0 0.0 10/28/2022 09:30 10/28/2022 11:00 1.50 INTRM2, WHDBOP BOPE P CO UPR to 2 7/8" x 5 1/2" VBR. Change out choke manifold valve #1. 0.0 0.0 10/28/2022 11:00 10/28/2022 12:00 1.00 INTRM2, WHDBOP BOPE P RU to test BOPE. 0.0 0.0 10/28/2022 12:00 10/28/2022 17:30 5.50 INTRM2, WHDBOP BOPE P BOPE Test All tests to 250psi/5min 3500psi/10min Annular 250psi/5min 3500psi/10min w/ exception of manual and super choke t/ 2000 psi. 5” Test jt: test annular/2 7/8" x 5 1/2" UPR/2 7/8" 5 1/2" LPR, W/ 4" Test jt: test annular/2 7/8" x 5 1/2" UPR/2 7/8" 5 1/2" LPR,Test choke valves 1-15. Manula operated and super choke. Choke manuals and HCR valves. 4" kill line valve. Test 2x 4" FO safety valves. 4" dart valve. 2x 5" FO safety valves. 5" dart valve. Test upper and lower IBOP. Blind/Shear rams. Performed Koomey draw down, ACC = 3000 psi, Manifold = 1400 psi, ACC = 1600 psi after all functions on bottles,35 sec for 200 psi. Build w/ 2 electric pumps, 188 sec to build full system pressure w/ 2 electrical and 2 air pumps, closing times annular = 23 sec. UPR = 18 sec, Blind / Shears = 16 sec, LPR = 16 sec, choke HCR = 2 sec, Kill HCR = 2 sec. Test PVT gain/loss and flow out alarms. Test LEL and H2S alarms AOGCC waived witness per Austin McLeod email 10/25/22 17:53hrs BLM notified- No response 0.0 0.0 10/28/2022 17:30 10/28/2022 19:00 1.50 INTRM2, WHDBOP BOPE P RD testing equipment. Retrieve test plug. and install 8.75" wear bushing. 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 37/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/28/2022 19:00 10/28/2022 20:30 1.50 INTRM2, CEMENT PRTS P RU and attempt casing test. Pressure up to 2200psi @ 1/2 bpm. Observed pressure level out and SD. Momitor for 15 minutes. Pressure decreased to 1500psi. Bled off. 12.4 bbls pumped/7.2bbl returned. 0.0 0.0 10/28/2022 20:30 10/29/2022 00:00 3.50 INTRM2, CEMENT WAIT T Waiting on 7" liner tieback equipment. Equipment arrived @ 23:00hrs. Offload equipmet to pipe shed. SimOps: Cut slip drill line. PU miscellanous BHA and rack back SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 43.47bbls. 0.0 0.0 10/29/2022 00:00 10/29/2022 01:00 1.00 INTRM2, CEMENT PULD T Prep hanger and seal assembly. PU and MU seal assembly and hanger. 0.0 39.0 10/29/2022 01:00 10/29/2022 08:00 7.00 INTRM2, CEMENT TRIP T RIH w/ 7" tieback hanger and seal assembly 39' to 9611'. Mud running over top of DP due to tight tolerances. MU TD to each std. 39.0 6,700.0 10/29/2022 08:00 10/29/2022 09:30 1.50 INTRM2, CEMENT PACK T MU Top Drive and break circ 3BPM, 290psi SPP. Confirm pipe full. Pumps off PUW 210k, SOW 155k, Rot Wt 175k 10k TQ. Wash down 1 BPM, 120psi SPP w/ 5' stick. Tag liner top on depth 9672'. SPP increase 600psi, Shut down pump, hold press 2 min. Slack off 9' and tag liner top w/ NO GO and set 10k down. P/U and break over string 220k. Press up on DP in LOT mode to set slips and packer element to 2240psi SPP. Observe HL decrease f/ 218k t/ 125k. Shut down pumps and bleed off press. (string hydraulic lifting). Discuss with town and decision made to drop ball. 9,611.0 9,611.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 38/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/29/2022 09:30 10/29/2022 12:00 2.50 INTRM2, CEMENT PRTS T P/U and observe string break over 215k. Unsting f/ PBR. Break connection and drop 1.5" phenolic ball. Pump down 4 BPM 390psi, Slow pumps 2 BPM, 200psi. Ball land 500stks early. Press up to 637psi SPP. Bleed off SPP. RU hose from test pump to SP manifold. Slack off and tag liner top with NO GO on depth. P/U and break over string 220k. Press up on DP in LOT mode to set slips and packer element to 2700psi SPP and hold 5 min. Slack off and confirm slips set. 1' above fully located. Set down 20k. Continue press up to 3300psi and hold 5 min to set packer. Press up w/ test pump and shear out ball seat 4826psi. Allow press to stabilize 2980psi and bleed off press. P/U 5' to expose dog sub and set down 15k. Establish rotation 20rpm and set 100k down to set packer. Repeat. PU to neutral weight. Break out Top Drive. Confirm space out and flush lines. Close UPR's and line up down Kill line. Press test LTP 3500psi 10 min. 8 bbl pumped / returned. New TOL depth: 9631' 611.0 9,611.0 10/29/2022 12:00 10/29/2022 12:30 0.50 INTRM2, CEMENT PRTS T RD and blow down lines. Rack back one std. 9,611.0 9,605.0 10/29/2022 12:30 10/29/2022 13:30 1.00 INTRM2, CEMENT PRTS T RU and test casing to 3500 psi. Good test. Chart test and witnessed by COP DSV. Bled off pressure. 10.5bbls returned. RD test equipment. 9,605.0 9,605.0 10/29/2022 13:30 10/29/2022 19:30 6.00 INTRM2, CEMENT TRIP T POOH f/ 9605' to running tool 9,605.0 39.0 10/29/2022 19:30 10/29/2022 20:30 1.00 INTRM2, CEMENT PULD T LD running tool. Pack off good. Dog sub sheared. All good. 39.0 0.0 10/29/2022 20:30 10/29/2022 22:00 1.50 INTRM2, CEMENT CLEN T Clean/clear rig floor. PJSM f/ BHA. 0.0 0.0 10/29/2022 22:00 10/30/2022 00:00 2.00 INTRM2, DRILLOUT BHAH P PU BHA #8 and RIH 131'. Note: Sonic tool came on @ 24:00hrs 10/29/22 SImOps: Continue to attempt freeze protect. Cumulative bbls pumped 46.8bbls. 0.0 131.0 10/30/2022 00:00 10/30/2022 00:45 0.75 INTRM2, DRILLOUT BHAH P PU BHA #8 and RIH f/ 131' to 236'. 131.0 236.0 10/30/2022 00:45 10/30/2022 01:45 1.00 INTRM2, DRILLOUT TRIP P RIH w/ BHA #8 f/ 236' to 2600'. 236.0 2,600.0 10/30/2022 01:45 10/30/2022 02:15 0.50 INTRM2, DRILLOUT CIRC P Fill pipe and perform shallow test. All good. 2,600.0 2,600.0 10/30/2022 02:15 10/30/2022 12:00 9.75 INTRM2, DRILLOUT TRIP P RIH f/ 2600' to 3425'. Slow down to 1800 fph for logging. Continue RIH @ 1800 fph to 9713'. 2,600.0 9,713.0 10/30/2022 12:00 10/30/2022 14:00 2.00 INTRM2, DRILLOUT PULD P RIH picking up singles f/ pipeshed f/ 11142' to 12027'. Tag cement @12027'. 9,713.0 12,027.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 39/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/30/2022 14:00 10/30/2022 16:30 2.50 INTRM2, DRILLOUT WASH P Wash/ream f/ 12027' to 12188'. Tag plugs/LC. 40 RPM 8-9k TQ 210GPM 2280 PSI 180k PU 117k SO 149k ROT 12,027.0 12,188.0 10/30/2022 16:30 10/30/2022 20:30 4.00 INTRM2, DRILLOUT DRLG P Drillout plugs/LC/shoetrack/FC to 5' above FS @ 12270'. 50 RPM 10-15k WOB 9-12k TQ on bttm 7k TQ off bttm 12.2ppg ECD 180k PU 117k SO 149k ROT. Note: Started pumping displacement after drilling through FC. 12,188.0 12,270.0 10/30/2022 20:30 10/30/2022 23:30 3.00 INTRM2, DRILLOUT CIRC P Displace to 8.8ppg FloPro. Note: 35bbls interface. 12,270.0 12,270.0 10/30/2022 23:30 10/31/2022 00:00 0.50 INTRM2, DRILLOUT CLEN P Take slow pump rates. SD. Clean pits/Shakers/Joes box. 12,270.0 12,270.0 10/31/2022 00:00 10/31/2022 02:00 2.00 INTRM2, DRILLOUT CLEN P Clean shakers/pits/Joes box. 12,270.0 1,270.0 10/31/2022 02:00 10/31/2022 03:30 1.50 INTRM2, DRILLOUT MPDA P Retrieve trip nipple and install MPD bearing assembly. 1,270.0 12,270.0 10/31/2022 03:30 10/31/2022 05:00 1.50 INTRM2, DRILLOUT WASH P Drillout shoetrack and FS. Clean out RH. Drill 20' new formation to 12314' MD. 12,270.0 12,314.0 10/31/2022 05:00 10/31/2022 06:00 1.00 INTRM2, DRILLOUT CIRC P Circulate and BROOH back into shoe. Circulate and condition mud f/ FIT. 12,314.0 12,270.0 10/31/2022 06:00 10/31/2022 07:00 1.00 INTRM2, DRILLOUT FIT P RU and perform LOT to 12.0ppg EMW. RD test equipment. 12,270.0 12,270.0 10/31/2022 07:00 10/31/2022 07:30 0.50 PROD1, DRILL WASH P Wash/Ream back to bottom @ 12314' MD. 50 RPM 4-9k TQ 260 GPM 1360 PSI 12,270.0 12,314.0 10/31/2022 07:30 10/31/2022 12:00 4.50 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 12314' MD to 12684' MD 8,382' TVD 17k WOB 300 GPM 1863 PSI on bttm 130 RPM 9k TQ on bttm 8.8ppg Current MW 9.5ppg ECD 152k PU 153k SO 150k ROT 0psi MPD on connection 4.4 bit hrs. 12,314.0 12,684.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 40/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 10/31/2022 12:00 10/31/2022 18:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 12684' MD to 13438' MD 8,431' TVD 18k WOB 325 GPM 2260 PSI on bttm 130 RPM 9.5k TQ on bttm 6.5k TQ off bttm 8.8ppg Current MW 9.8ppg ECD 171k PU 146k SO 152k ROT 0psi MPD on connection 8.7 bit hrs. 12,684.0 13,438.0 10/31/2022 18:00 11/1/2022 00:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 13438' MD to 14190' MD 8,436' TVD 16k WOB 325 GPM 2440 PSI on bttm 130 RPM 10k TQ on bttm 7k TQ off bttm 8.8ppg Current MW 9.9ppg ECD 178k PU 134k SO 150k ROT 0psi MPD on connection 13.2bit hrs. 13,438.0 14,190.0 11/1/2022 00:00 11/1/2022 06:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 14190' MD to 14967' MD/ 8453' TVD 16k WOB 325 GPM 2440 PSI on bttm 130 RPM 10k TQ on bttm 7k TQ off bttm 8.8ppg Current MW 9.9ppg ECD 178k PU 134k SO 150k ROT 0psi MPD on connection 17.7bit hrs. 14,190.0 14,967.0 11/1/2022 06:00 11/1/2022 12:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 14967' MD to 15729' MD/ 8451' TVD 17k WOB 325 GPM 2600 PSI on bttm 130 RPM 11k TQ on bttm 7k TQ off bttm 8.9ppg Current MW 10.1ppg ECD 176k PU 128k SO 147k ROT 22 bit hrs 0psi MPD on connection 14,967.0 15,729.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 41/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/1/2022 12:00 11/1/2022 18:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 15729' MD to 16539' MD/ 8449' TVD 14k WOB 300 GPM 2450 PSI on bttm 130 RPM 11k TQ on bttm 7.5k TQ off bttm 8.9ppg Current MW 9.9ppg ECD 180k PU 127k SO 154k ROT 26.8 bit hrs 0psi MPD on connection Note: Observed losses @ 15964'. Initial 80-100bbls/hr and decreased to 40- 60bbls/hr 15,729.0 16,539.0 11/1/2022 18:00 11/2/2022 00:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 16539' MD to 17298' MD/ 8460' TVD 15k WOB 300 GPM 2420 PSI on bttm 130 RPM 11.5k TQ on bttm 8k TQ off bttm 8.9ppg Current MW 10.0ppg ECD 181k PU 127k SO 148k ROT 31.1 bit hrs 0psi MPD on connection Note: Losses still at 50-60bbls/hr. 16,539.0 17,298.0 11/2/2022 00:00 11/2/2022 06:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 17298' MD to 18056' MD/ 8468' TVD 14k WOB 275 GPM 2192 PSI on bttm 130 RPM 11k TQ on bttm 4k TQ off bttm 8.9ppg Current MW 9.9ppg ECD 184k PU 125k SO 154k ROT 35.4 bit hrs 0psi MPD on connection Note: Losses 50-60bbls/hr. 17,298.0 18,056.0 11/2/2022 06:00 11/2/2022 07:00 1.00 PROD1, DRILL MPDA P Flow check. Retrieve 4" MPD bearing assembly and install 5" MPD bearing assembly 18,056.0 18,056.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 42/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/2/2022 07:00 11/2/2022 12:00 5.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 18056' MD to 18625' MD/ 8481' TVD 10k WOB 275 GPM 2245 PSI on bttm 130 RPM 12k TQ on bttm 4k TQ off bttm 8.9ppg Current MW 10.0ppg ECD 187k PU 126k SO 154k ROT 39.1 bit hrs 75psi MPD on connection Note: Losses 50-60bbls/hr. Start adding background LCM. Losses decreasing. 18,056.0 18,625.0 11/2/2022 12:00 11/2/2022 18:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 18625' MD to 19378' MD/ 8485' TVD 11k WOB 275 GPM 2370 PSI on bttm 130 RPM 12.5k TQ on bttm 8.5k TQ off bttm 8.9ppg Current MW 10.1ppg ECD 187k PU 126k SO 154k ROT 43.3 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Start adding background LCM. Losses decreasing. 18,625.0 19,378.0 11/2/2022 18:00 11/3/2022 00:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 19378' MD to 20198' MD/ 8477' TVD 11k WOB 275GPM 2358 PSI on bttm 130 RPM 13k TQ on bttm 8.5k TQ off bttm 8.9ppg Current MW 10.2ppg ECD 193k PU 131k SO 161k ROT 47.8 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Start adding background LCM. Losses decreasing. 19,378.0 20,198.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 43/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/3/2022 00:00 11/3/2022 02:00 2.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 20198' MD to 20463' MD/ 8477' TVD 11k WOB 275GPM 2358 PSI on bttm 130 RPM 13k TQ on bttm 8.5k TQ off bttm 8.9ppg Current MW 10.2ppg ECD 193k PU 131k SO 161k ROT 47.8 bit hrs 0psi MPD on connection Note: Losses 30-40bbls/hr. Start adding background LCM. 20,198.0 20,463.0 11/3/2022 02:00 11/3/2022 02:30 0.50 PROD1, DRILL CIRC T Computers froze up on MWD. SD and reboot. 20,463.0 20,463.0 11/3/2022 02:30 11/3/2022 06:00 3.50 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 20463' MD to 20897' MD/ 8477' TVD 14k WOB 275GPM 2500 PSI on bttm 130 RPM 15k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.4ppg ECD 205k PU 131k SO 165k ROT 51.9 bit hrs 0psi MPD on connection Note: Losses 30-40bbls/hr. Adding background LCM. 20,463.0 20,897.0 11/3/2022 06:00 11/3/2022 12:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 20897' MD to 21729' MD/ 8476' TVD 22k WOB 275 GPM 2603 PSI on bttm 130 RPM 16k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.4ppg ECD 205k PU 131k SO 165k ROT 56.5 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Adding background LCM. 20,897.0 21,729.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 44/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/3/2022 12:00 11/3/2022 18:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 21729' MD to 22510' MD/ 8473' TVD 18.5k WOB 275 GPM 2740 PSI on bttm 130 RPM 18.5k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.5ppg ECD 213k PU 125k SO 167k ROT 60.9 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Adding background LCM. 21,729.0 22,510.0 11/3/2022 18:00 11/4/2022 00:00 6.00 PROD1, DRILL DDRL P Driil 6 1/8" x 6 5/16" production hole F/ 22510' MD to 23240' MD/ 8485' TVD 18.5k WOB 275 GPM 2740 PSI on bttm 130 RPM 18.5k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.5ppg ECD 213k PU 125k SO 167k ROT 60.9 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Adding background LCM. 22,510.0 23,240.0 11/4/2022 00:00 11/4/2022 06:00 6.00 PROD1, DRILL DDRL P Drill 6 1/8" x 6 5/16" production hole F/ 23240' MD to 23992' MD. 12k WOB 275 GPM 2800 PSI on bttm 130 RPM 17k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.6 ppg ECD 225k PU 117k SO 174k ROT 70.2 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Adding background LCM. 23,240.0 23,992.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 45/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/4/2022 06:00 11/4/2022 12:00 6.00 PROD1, DRILL DDRL P Drill 6 1/8" x 6 5/16" production hole F/ 23992' MD to 24678' MD. 18.5k WOB 275 GPM 2740 PSI on bttm 130 RPM 18.5k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.8 ppg ECD 213k PU 125k SO 167k ROT 60.9 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. Adding background LCM. 23,992.0 24,678.0 11/4/2022 12:00 11/4/2022 18:00 6.00 PROD1, DRILL DDRL P Drill 6 1/8" x 6 5/16" production hole F/ 24678' MD to 25415' MD. 18.5k WOB 275 GPM 2740 PSI on bttm 130 RPM 18.5k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.8ppg ECD 213k PU 125k SO 167k ROT 78.7 bit hrs 75psi MPD on connection Note: Losses 30-40bbls/hr. 24,678.0 25,415.0 11/4/2022 18:00 11/5/2022 00:00 6.00 PROD1, DRILL DDRL P Drill 6 1/8" x 6 5/16" production hole F/ 25415' MD to 26068' MD. 18.5k WOB 275 GPM 3003 PSI on bttm 130 RPM 17k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 10.9ppg ECD 232k PU 126k SO 182k ROT 82.9 bit hrs 60psi MPD on connection Note: Losses 30-40bbls/hr. 25,415.0 26,068.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 46/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/5/2022 00:00 11/5/2022 04:30 4.50 PROD1, DRILL DDRL P Drill 6 1/8" x 6 5/16" production hole F/ 26068' MD to 26634' MD. 18.5k WOB 275 GPM 3009 PSI on bttm 130 RPM 20k TQ on bttm 9k TQ off bttm 8.9ppg Current MW 11 ppg ECD 245k PU 100k SO 167k ROT 84.5 bit hrs 70psi MPD on connection Note: Losses 30-40bbls/hr. 26,068.0 26,634.0 11/5/2022 04:30 11/5/2022 09:00 4.50 PROD1, TRIPCAS CIRC P TD hole section at 26634' MD obtain final surveys and begin hole clean up cycle. Rotate and reciprocate pipe while circulating at 275 GPM. Circulate 2 x BU. ECD 10.8. 26,634.0 26,634.0 11/5/2022 09:00 11/5/2022 10:00 1.00 PROD1, TRIPCAS OWFF P Blow down top drive and perform fingerprinting operation as per procedure. initial PSI 111, final PSI 102 , rack back stand. 26,634.0 26,634.0 11/5/2022 10:00 11/5/2022 11:30 1.50 PROD1, TRIPCAS CIRC P Circulate while rotate and reciprocate from 26540' to 26450' 275 to 325 GPM 2790 - 3450 PSI 130 RPM 13k TQ 8.9ppg Current MW 10.6 - 10.8 ppg ECD 175k ROT Max gas observed 3750 units Note: Losses 30-40bbls/hr. 26,634.0 26,450.0 11/5/2022 11:30 11/5/2022 12:00 0.50 PROD1, TRIPCAS CIRC P Shut down pumps and close MPD chokes observe 120 PSI build up, divert flow to gas buster and circulate at 2 BPM 26,450.0 26,540.0 11/5/2022 12:00 11/5/2022 18:00 6.00 PROD1, TRIPCAS CIRC P Circulate while rotate and reciprocate from 26540' to 26351' 325 GPM 3400 PSI 130 RPM 14k TQ 8.9ppg Current MW 10.7 - ppg ECD 170k RTW Max gas observed 1500 units Note: Losses 30-40bbls/hr. 26,540.0 26,351.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 47/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/5/2022 18:00 11/5/2022 19:00 1.00 PROD1, TRIPCAS REAM P Ream from 26351' to 26630'. 275 GPM 2475 PSI 130 RPM 12k TQ 8.9ppg Current MW 10.7 - ppg ECD 170k RTW Max gas observed 1500 units Note: Losses 30-40bbls/hr. 26,351.0 26,630.0 11/5/2022 19:00 11/6/2022 00:00 5.00 PROD1, TRIPCAS CIRC P Displace well from 8.8 ppg FloPro to 9.4 ppg VisBrine 275 GPM 1900 PSI 75 RPM 14k TQ 8.9ppg Current MW, new MW 9.4 ppg vis brine 10 - ppg ECD 179k RTW Max gas observed 7000 units Note: Losses 30-40bbls/hr. 26,630.0 26,630.0 11/6/2022 00:00 11/6/2022 01:00 1.00 PROD1, TRIPCAS CIRC P Displace well from 8.8 ppg FloPro to 9.4 ppg VisBrine 250 GPM 1600 PSI 75 RPM 15k TQ MW 9.4 ppg VB 10.1 - ppg ECD 182k RTW Max gas observed 600 units Note: Losses 30-40bbls/hr. total strokes pumped 16260. 26,630.0 26,634.0 11/6/2022 01:00 11/6/2022 02:00 1.00 PROD1, TRIPCAS OWFF P Fingerprint well and flow check first choke cycle build up to 12 psi in 5 minutes 3 bbl bled back Second cycle build up to 5 psi in five minute 2 bbl bled back Third cycle zero psi build zero bbl's bled back. Well static. 26,634.0 26,537.0 11/6/2022 02:00 11/6/2022 03:00 1.00 PROD1, TRIPCAS SMPD P Obtain SCR's, final PUW and SOW, Line up pump #1 on backside and pump at 2 BPM. Set up MPD for SOOH. Depth 26537' PUW 242K SOW 105K Daylight savings time this Block includes 1 extra hour for 2 hours total. Begin SOOH from 26537' to 25137' Utilize MPD to offset swap. SBP 90 psi adjust pulling speed to 20 FPM minimize losses 26,537.0 25,137.0 11/6/2022 03:00 11/6/2022 10:00 7.00 PROD1, TRIPCAS SMPD P Continue stripping put of hole utilizing MPD to offset swab. from 25137' to 18153' start at 8 fpm and increase to 25 fpm. SBP 80 psi PUW 185 K losing 1 to 1.5 bbl per stand 25,137.0 18,153.0 11/6/2022 10:00 11/6/2022 10:30 0.50 PROD1, TRIPCAS OWFF P Flow check well prior to RCD bearing swap to 4" Well on vac. 18,153.0 18,153.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 48/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/6/2022 10:30 11/6/2022 11:30 1.00 PROD1, TRIPCAS MPDA P Remove 5" RCD bearing and install 4" RCD bearing. 18,153.0 18,060.0 11/6/2022 11:30 11/6/2022 16:30 5.00 PROD1, TRIPCAS SMPD P Continue SOOH laying down 4" singles from 18,060' to 15813' SBP 80 psi PUW 197 K losing 1 to 1.5 bbl per stand 18,060.0 15,813.0 11/6/2022 16:30 11/6/2022 19:00 2.50 PROD1, TRIPCAS CIRC T Make up XO and CBU due to increased FF while stripping. rotate and reciprocate from 15813' to 15716' 225 - 300 GPM 1200 - 1865 PSI 80 RPM 8k TQ MW 9.4 ppg VB 9.8 - ppg ECD 182k RTW Max gas observed 4000 units Note: Losses 30-40bbls/hr. total strokes pumped 10400. 15,813.0 15,813.0 11/6/2022 19:00 11/6/2022 22:30 3.50 PROD1, TRIPCAS SMPD P Continue SOOH laying down 4" singles from 15813' to 14422' SBP 80 psi PUW 197 K losing 1.5 to 2 bbl per stand 15,813.0 14,422.0 11/6/2022 22:30 11/7/2022 00:00 1.50 PROD1, TRIPCAS CIRC T Make up XO and CBU due to increased FF while stripping. rotate and reciprocate from 14422' to 14426' 300 GPM 1810 PSI 80 RPM 8k TQ MW 9.4 ppg VB 9.8 - ppg ECD 146k RTW Max gas observed 3200 units Note: Losses 30-40bbls/hr. 14,422.0 14,426.0 11/7/2022 00:00 11/7/2022 01:00 1.00 PROD1, TRIPCAS CIRC T Make up XO and CBU due to increased FF while stripping. rotate and reciprocate from 14426' to 14426' 300 GPM 1810 PSI 80 RPM 8k TQ MW 9.4 ppg VB 9.8 - ppg ECD 146k RTW Max gas observed 3200 units Note: Losses 30-40bbls/hr. Gas to surface at 7760 strokes 14,426.0 14,426.0 11/7/2022 01:00 11/7/2022 03:00 2.00 PROD1, TRIPCAS SMPD P Continue SOOH laying down 4" singles from 14426' to 13514' SBP 80 psi PUW 187 K losing 1.5 to 2 bbl per stand 14,426.0 13,514.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 49/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/7/2022 03:00 11/7/2022 05:00 2.00 PROD1, TRIPCAS CIRC T Make up XO and CBU due to increased FF while stripping. rotate and reciprocate from 13514' to 13428' 300 GPM 1633 PSI 80 RPM 8k TQ MW 9.4 ppg VB 9.8 - ppg ECD 147k RTW Max gas observed 4000 units Note: Losses 30-40bbls/hr. Gas to surface at 7700 strokes 13,514.0 13,428.0 11/7/2022 05:00 11/7/2022 06:30 1.50 PROD1, TRIPCAS SMPD P Continue SOOH laying down 4" singles from 13428' to 12270' SBP 70 psi PUW 174 K losing 1.5 to 2 bbl per stand 13,428.0 12,270.0 11/7/2022 06:30 11/7/2022 09:00 2.50 PROD1, TRIPCAS CIRC T Make up XO and CBU. rotate and reciprocate from 12270' to 12190' 325 GPM 1900 PSI 80 RPM 8k TQ MW 9.4 ppg VB 9.7 - ppg ECD 127k RTW Max gas observed 730 units Note: Losses 30-40bbls/hr. Gas to surface at 7340 strokes 12,270.0 12,190.0 11/7/2022 09:00 11/7/2022 09:30 0.50 PROD1, TRIPCAS MPDA T Blow down top drive and install 5" RCD bearing o pup and store on rig floor. 12,190.0 12,270.0 11/7/2022 09:30 11/7/2022 15:30 6.00 PROD1, TRIPCAS SMPD T Strip in hole with singles from pipe shed from 12270' to 16348' SOW 124K utilize MPD to hold 9.5 ESD 40 psi in slips 20 psi out of slips. 12,270.0 16,348.0 11/7/2022 15:30 11/7/2022 18:00 2.50 PROD1, TRIPCAS CIRC T Make up XO and CBU rotate and reciprocate from 16348' to 16260' 325 GPM 2250 PSI 80 RPM 8k TQ MW 9.4 ppg VB 9.7 - ppg ECD 143k RTW Max gas observed 6500 units Note: Losses 30-40bbls/hr. Gas to surface at 7543 strokes 16,348.0 16,260.0 11/7/2022 18:00 11/7/2022 19:00 1.00 PROD1, TRIPCAS SMPD T Strip in hole with singles from pipe shed from 16260' to 17102' SOW 124K utilize MPD to hold 9.5 ESD 40 psi in slips 20 psi out of slips. 16,260.0 17,102.0 11/7/2022 19:00 11/7/2022 20:30 1.50 PROD1, TRIPCAS MPDA T Flow chewck well and remove 4" RCD bearing and install 5" RCD bearing. 17,102.0 17,102.0 11/7/2022 20:30 11/7/2022 23:00 2.50 PROD1, TRIPCAS SMPD T Strip in hole with stands from 17102' to 19916' SOW 127K utilize MPD to hold 9.5 ESD 40 psi in slips 20 psi out of slips. 17,102.0 19,916.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 50/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/7/2022 23:00 11/8/2022 00:00 1.00 PROD1, TRIPCAS CIRC T Circulate bottoms up at 19912' While rotate and reciprocate pipe. 325 GPM 2250 PSI 80 RPM 6k TQ MW 9.4 ppg VB 9.7 - ppg ECD 160k RTW Max gas observed 6500 units Note: Losses 30-40bbls/hr. 19,912.0 19,912.0 11/8/2022 00:00 11/8/2022 01:00 1.00 PROD1, TRIPCAS CIRC T Circulate bottoms up at 19912' While rotate and reciprocate pipe. 325 GPM 2500 PSI 80 RPM 6k TQ MW 9.4 ppg VB 10 - ppg ECD Max gas observed 6500 units Note: Losses 30-40bbls/hr. Gas to surface at 7250 strokes Diverted flow to MGS due to high LEL 19,912.0 19,916.0 11/8/2022 01:00 11/8/2022 02:00 1.00 PROD1, TRIPCAS SMPD T Blow down top drive and resume Strip in hole with singles from pipe shed from 19916' to 20957' SOW 126K utilize MPD to hold 9.5 ESD 40 psi in slips 20 psi out of slips. Losing approx 18 BPH 19,916.0 20,957.0 11/8/2022 02:00 11/8/2022 04:00 2.00 PROD1, TRIPCAS CIRC T Circulate bottoms up While rotate and reciprocate pipe from 20957' to 20870' 325 GPM 2525 PSI 80 RPM 6k TQ MW 9.4 ppg VB 9.7 - ppg ECD 160k RTW Max gas observed 4000 units Note: Losses 30-40bbls/hr. Gas to surface at 7800 strokes 20,957.0 20,870.0 11/8/2022 04:00 11/8/2022 05:30 1.50 PROD1, TRIPCAS SMPD T Blow down top drive and resume Strip in hole with singles from pipe shed from 20870'' to 22840' SOW 121K utilize MPD to hold 9.5 ESD 40 psi in slips 20 psi out of slips. Losing approx 18 BPH 20,870.0 22,840.0 11/8/2022 05:30 11/8/2022 07:00 1.50 PROD1, TRIPCAS CIRC T Circulate bottoms up While rotate and reciprocate pipe from 22840' to 22750' 325 GPM 2550 PSI 80 RPM 12k TQ MW 9.4 ppg VB 10.4 - ppg ECD 160k RTW Max gas observed 3150 units Note: Losses 30-40bbls/hr. Gas to surface at 7150 strokes 22,840.0 22,750.0 11/8/2022 07:00 11/8/2022 10:00 3.00 PROD1, TRIPCAS SMPD T Blow down top drive and resume Strip in hole with singles from pipe shed from 22750' to 26600' SOW 125K utilize MPD to hold 9.5 ESD 40 psi in slips 20 psi out of slips. Losing approx 18 BPH 22,750.0 26,600.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 51/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/8/2022 10:00 11/8/2022 19:00 9.00 PROD1, TRIPCAS CIRC T Circulate to weight up to 9.8 ppg VisBrine rotate and reciprocatre from 26600' to 26530'. 325 GPM 2650 PSI 80 RPM 10.4 ECD Max gas observed 6200 units Gas increase at 6900 strokes. 26,600.0 26,530.0 11/8/2022 19:00 11/8/2022 19:30 0.50 PROD1, TRIPCAS OWFF T Perform Dynamic flow check unable to hold 10.5 ppg ESD ( full losses) lower to 10.1 PPG and record losses for 30 minutes. 45 bbls lost 26,530.0 26,530.0 11/8/2022 19:30 11/9/2022 00:00 4.50 PROD1, TRIPCAS SMPD T SOOH utilizing MPD to hold 10.1 EQV SBP on slips 120 SBP pulling 180 at 8 FPM from 26530' to 26062' 79 BBL loss over 5 stands. Increase pulling speed to 17 FPM from 26062' to 25595' continue holding 10.1 ESD. 45 bbl loss over 5 stands. Increase pulling speed to 25 FPM from 25595' to 25117' Continue holding 10.1 ESD 48 bbl loss over 5 stands. Continue pulling at 25 FPM, averaging 45 bbl's loss every 5 stands. Midnight depth 23175' 26,530.0 23,175.0 11/9/2022 00:00 11/9/2022 05:30 5.50 PROD1, TRIPCAS SMPD T SOOH from 23,175' MD to 17,005' MD 33'/min 260psi off slips 140psi on slips. MPD holding 10.0ppg PU: 185k SO: 120k 23,175.0 17,005.0 11/9/2022 05:30 11/9/2022 06:30 1.00 PROD1, TRIPCAS MPDA T PJSM, Remove 5" and install 4" Bearing. 17,005.0 17,005.0 11/9/2022 06:30 11/9/2022 09:00 2.50 PROD1, TRIPCAS CIRC T Circulate from 17,005' MD to 16,925' MD PU: 185k SO: 120k ROT: 145k GPM: 325 PSI: 2,600 RPM: 50 TRQ: 8k ECD: 10.3ppg Gas: 40 units 17,005.0 16,925.0 11/9/2022 09:00 11/9/2022 12:00 3.00 PROD1, TRIPCAS SMPD T SOOH from 16,925' MD to 13,706' MD 33'-42'/min 200psi off slips 140psi on slips. MPD holding 10.0ppg PU: 185k @ 13,650' MD 16,925.0 13,706.0 11/9/2022 12:00 11/9/2022 14:00 2.00 PROD1, TRIPCAS SMPD T SOOH from 13,706' MD to 12,179' MD 33'-42'/min 200psi off slips 140psi on slips. MPD holding 10.0ppg PU: 185k @ 12,200' MD 40 BPH losses 13,706.0 12,179.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 52/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/9/2022 14:00 11/9/2022 15:30 1.50 PROD1, TRIPCAS SLPC P Circulate and cut and slip 157' Drill line. Calibrate Amphion and Pason. SIMOPS: Circulate GPM: 275 PSI: 1200 12,179.0 12,179.0 11/9/2022 15:30 11/9/2022 20:30 5.00 PROD1, TRIPCAS SMPD P SOOH from 12,179' MD to 9,523' MD 50'/min 140psi off slips 140psi on slips. MPD holding 10.0ppg Dropped 2.125" hallow drift with 110' tail. at 9,523' MD. PU: 185k @ 12,200' MD 12,179.0 9,523.0 11/9/2022 20:30 11/10/2022 00:00 3.50 PROD1, TRIPCAS SMPD P SOOH from 9,523' MD to 4,591' MD 50'/min 140psi off slips 140psi on slips. MPD holding 10.0ppg, L/D 4" drill pipe PU: 99k @ 5,000' MD 40 BPH losses 9,523.0 4,591.0 11/10/2022 00:00 11/10/2022 06:30 6.50 PROD1, TRIPCAS SMPD P SOOH from 4,591' MD to 236' MD 50'/min 140psi off slips 140psi on slips. MPD holding 10.0ppg, L/D 4" drill pipe 35 BPH losses 4,591.0 260.0 11/10/2022 06:30 11/10/2022 08:00 1.50 PROD1, TRIPCAS MPDA P PJSM, Remove 4" RCD and install trip nipple. Weekly Function test BOP's Obtain 20BPH static losses. 260.0 260.0 11/10/2022 08:00 11/10/2022 10:30 2.50 PROD1, TRIPCAS BHAH P L/D Baker 6-1/8" BHA #8 260.0 0.0 11/10/2022 10:30 11/10/2022 11:00 0.50 PROD1, TRIPCAS CLEN P Clean and clear rig floor. 0.0 0.0 11/10/2022 11:00 11/10/2022 13:00 2.00 PROD1, TRIPCAS RURD P R/U safety valve and X/O, M/U side entry assy, R/U Doyon tongs and equipment. 0.0 0.0 11/10/2022 13:00 11/10/2022 18:00 5.00 COMPZ2, CASING PUTB P Make up 4-1/2" Citadel shoe, continue P/U and run 4-1/2" 12.6ppf P-110S H563 liner, Swell packers and Baker frac sleeves to 3,788' MD PU: 60k 0.0 3,788.0 11/10/2022 18:00 11/10/2022 23:30 5.50 COMPZ2, CASING PUTB P Continue P/U and run 4-1/2" 12.6ppf P- 110S H563 liner, Swell packers and Baker frac sleeves from 3,788' MD to 10,070' MD. PU: 74k 3,788.0 10,070.0 11/10/2022 23:30 11/11/2022 00:00 0.50 COMPZ2, CASING RGRP T Casing tongs lost hydralic pressure. Trouble shoot same. 20bph static losses 10,070.0 10,070.0 11/11/2022 00:00 11/11/2022 00:15 0.25 COMPZ2, CASING RGRP T Casing tongs lost hydralic pressure. Trouble shoot same.Wash out valve on tongs 20bph static losses 10,070.0 10,070.0 11/11/2022 00:15 11/11/2022 03:30 3.25 COMPZ2, CASING PUTB P Continue P/U and run 4-1/2" 12.6ppf P- 110S H563 liner, Swell packers and Baker frac sleeves from 10,070' MD to 12,270' MD. PU: 74k 10,070.0 12,270.0 11/11/2022 03:30 11/11/2022 04:00 0.50 COMPZ2, CASING OTHR P Pull PS-21 and install master bushings. 12,270.0 12,270.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 53/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/11/2022 04:00 11/11/2022 05:30 1.50 COMPZ2, CASING OTHR T Trouble shoot Pason monitoring system. 12,270.0 12,270.0 11/11/2022 05:30 11/11/2022 08:00 2.50 COMPZ2, CASING PUTB P Continue P/U and run 4-1/2" 12.6ppf P- 110S H563 liner, Swell packers and Baker frac sleeves from 12,270' MD to 14,490' MD. PU: 84k SO: 75k 12,270.0 14,490.0 11/11/2022 08:00 11/11/2022 08:30 0.50 COMPZ2, CASING PULD P P/U Baker Flex-Lock liner hanger and HRDE ZXHD liner top packer. Fill with Zan Plex PU: 90k SO: 78k ROT: 81k RPM: 10/20 TRQ: 3k 14,490.0 14,530.0 11/11/2022 08:30 11/11/2022 10:30 2.00 COMPZ2, CASING RUNL P RIN with 4-1/2" liner with 4" drill pipe top filling string. from 14,530' MD to 16,990' MD. 14,530.0 16,990.0 11/11/2022 10:30 11/11/2022 11:00 0.50 COMPZ2, CASING MPDA P Remove trip nipple and install 5" RCD 16,990.0 16,990.0 11/11/2022 11:00 11/11/2022 12:00 1.00 COMPZ2, CASING RUNL P RIN with 4-1/2" liner with 5" drill pipe top filling string. from 16,990' MD to 17,840' MD. 16,990.0 17,840.0 11/11/2022 12:00 11/11/2022 19:00 7.00 COMPZ2, CASING RUNL P Continue RIN with 4-1/2" liner with 5" drill pipe top filling string. from 17,840' MD to 26,634' MD. Tagged BTM at 26,634' MD. P/U and set on depthe at 26,624' MD. PU: 218k SO: 129k 17,840.0 26,624.0 11/11/2022 19:00 11/11/2022 19:30 0.50 COMPZ2, CASING RURD P M/U side entry/ Vent assy and hoses. 26,624.0 26,624.0 11/11/2022 19:30 11/12/2022 00:00 4.50 COMPZ2, CASING CIRC P Pump and fill pipe, Continue pump at 1/2bpm and pressure up to 1200psi. Flotation sub didn't shear, Bled off and and pressure up to 1200psi. Didn't shear, continue pressure up and sheared at 1,378psi, Open upper safety valve for air vent, Continue pumping at 6bpm filling liner with 9.8ppg. (210bbls) Close upper safety valve and continue circulating throug shoe at 5bpm 1322psi. Circulate string volume 420bbls, shut down pump, flow out was continued at 60gpm and slowing down slowly, Continue pumping at 5bpm 1305psi. Max gas 865units 26,624.0 26,624.0 11/12/2022 00:00 11/12/2022 00:30 0.50 COMPZ2, CASING CIRC P Continue circulate at 200gpm 1,320psi Max gas 3200 units 26,619.0 26,619.0 11/12/2022 00:30 11/12/2022 01:00 0.50 COMPZ2, CASING RURD P R/D side entry/ Vent assy and hoses. 26,619.0 26,619.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 54/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/12/2022 01:00 11/12/2022 03:00 2.00 COMPZ2, CASING OTHR P Drop 1'' setting ball, pump ball down @ 168 gpm, Ball on seat at 1913 strokes. Once ball on seat pressure up t/ 2,500 psi, verify hanger was set, Pressure up t/ 4,520 psi release HRDE tool blow ball seat. P/U string 212k expose dog sub, S/O rotating at 10rpm, witness shear @ 50k S/O to 130k. Verified w/ Baker rep that packer was set. Liner top: 12,097.81' MD Shoe: 26,619' MD 26,619.0 26,619.0 11/12/2022 03:00 11/12/2022 03:30 0.50 COMPZ2, CASING PRTS P Pressure test liner top packer to 3,500psi 30min, Pumped and returned 9bbls. 26,619.0 26,619.0 11/12/2022 03:30 11/12/2022 06:30 3.00 COMPZ2, WELLPR CIRC P Circulate and displace with 9.4ppg CI fluid at 325gpm 620psi. Pumped 12,970stks. SIMOPS: R/U Halliburton TEC spool and equipment on rig floor. 12,055.0 12,055.0 11/12/2022 06:30 11/12/2022 08:00 1.50 COMPZ2, WELLPR MPDA P Remove 5" RCD and install trip nipple, Install PS-21's. SIMOPS: OWFF (10bph losses) 12,055.0 12,055.0 11/12/2022 08:00 11/12/2022 12:00 4.00 COMPZ2, WELLPR PULD P POOH L/D 5" drill pipe from 12,055' MD to 8,521' MD. 12,055.0 8,521.0 11/12/2022 12:00 11/12/2022 18:00 6.00 COMPZ2, WELLPR PULD P Continue POOH L/D 5" drill pipe from 8,521' MD to 3,512' MD. 11BPH losses PU: 90k 8,521.0 3,512.0 11/12/2022 18:00 11/12/2022 18:30 0.50 COMPZ2, WELLPR SVRG P Service ST-80 3,512.0 3,512.0 11/12/2022 18:30 11/12/2022 19:15 0.75 COMPZ2, WELLPR PULD P Continue POOH L/D 5" drill pipe from 3,521' MD to 3,420' MD. 11BPH losses PU: 80k 3,512.0 3,420.0 11/12/2022 19:15 11/12/2022 20:00 0.75 COMPZ2, WELLPR RGRP T Change out hose on PS-21 slips. 3,420.0 3,420.0 11/12/2022 20:00 11/12/2022 21:00 1.00 COMPZ2, WELLPR PULD P Continue POOH L/D 5" drill pipe from 3,420' MD to 2,607' MD. 11BPH losses PU: 77k 3,420.0 2,607.0 11/12/2022 21:00 11/12/2022 21:30 0.50 COMPZ2, WELLPR RURD P Change out handling equipment from 5" to 4". 2,607.0 2,607.0 11/12/2022 21:30 11/13/2022 00:00 2.50 COMPZ2, WELLPR RURD P Continue POOH L/D 4" drill pipe from 2,607' MD to 743' MD. 11BPH losses 2,607.0 743.0 11/13/2022 00:00 11/13/2022 00:30 0.50 COMPZ2, WELLPR PULD P Continue POOH L/D 4" drill pipe from 743' MD to 579' MD. Tight connection, break with rig tongs. 11BPH losses 743.0 579.0 11/13/2022 00:30 11/13/2022 01:00 0.50 COMPZ2, WELLPR SVRG P Service Pipe Skate. 579.0 579.0 11/13/2022 01:00 11/13/2022 02:30 1.50 COMPZ2, WELLPR PULD P Continue POOH L/D 4" drill pipe from 579' MD. Lay down Baker running tools.Tight connection, break with rig tongs.11BPH losses 579.0 0.0 11/13/2022 02:30 11/13/2022 04:30 2.00 COMPZ2, WELLPR TRIP P TIH with 4" drill pipe to 2,838' MD. (Leaking O-Ring on ST-80) 0.0 2,838.0 11/13/2022 04:30 11/13/2022 05:00 0.50 COMPZ2, WELLPR TRIP P Continue TIH with Manual tongs from 2,838' MD to 4,065' MD. 2,838.0 4,065.0 11/13/2022 05:00 11/13/2022 06:30 1.50 COMPZ2, WELLPR TRIP P Continue TIH with ST-80 from 4,065' MD to 7,390' MD. 11-12BPH losses SIMOPS: Setting mats on MT7-96 well. 4,065.0 7,390.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 55/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/13/2022 06:30 11/13/2022 11:30 5.00 COMPZ2, WELLPR PULD P POOH L/D 4" drill pipe doubles in pipe shed from 7,390' MD to 1,138' MD. 7,390.0 1,138.0 11/13/2022 11:30 11/13/2022 12:30 1.00 COMPZ2, WELLPR PULD P POOH from L/D 4" drill pipe singles from 1,138' MD to surface. 1,138.0 0.0 11/13/2022 12:30 11/13/2022 14:00 1.50 COMPZ2, WELLPR WWWH P Retrieve wear bushing and wash stack 500gpm 88psi. 0.0 0.0 11/13/2022 14:00 11/13/2022 15:30 1.50 COMPZ2, RPCOMP RURD P R/U 4.5" equipment to run upper completion, Remove PS-21's, Install master bushings & cavin air slips, Rig tec wire clamp tools, Hang tec wire sheave in derrick. 0.0 0.0 11/13/2022 15:30 11/13/2022 16:30 1.00 COMPZ2, RPCOMP RCST P RIH w/ Baker index shoe, mechanical locator, 3.75" landing nipple, Halliburton production packer (SN 4727161-04) & Halliburton Opsis Mandrel w/ Down hole gauge (S/N ALQ22138-01) to 325' MD. 0.0 325.0 11/13/2022 16:30 11/13/2022 18:00 1.50 COMPZ2, RPCOMP OTHR T TEC line not unspooling correct. Remove TEC line from gauge and untangle line, Install and retest to 10k (good test) 325.0 325.0 11/13/2022 18:00 11/13/2022 19:00 1.00 COMPZ2, RPCOMP RCST P RIH w/ upper completion from 325' to 1,465' MD. Running TEC line and installing Cannon clamps every joint. Checking control line every 1000' MD. 325.0 1,465.0 11/13/2022 19:00 11/13/2022 19:30 0.50 COMPZ2, RPCOMP OTHR T Change out torque gauge hose on power tongs 1,465.0 1,465.0 11/13/2022 19:30 11/14/2022 00:00 4.50 COMPZ2, RPCOMP RCST P Continue RIH w/ upper completion from 1,465' MD to 4,515' MD. Running TEC line and installing Cannon clamps every joint. Checking control line every 1000' MD. 14 bph losses 1,465.0 4,515.0 11/14/2022 00:00 11/14/2022 08:30 8.50 COMPZ2, RPCOMP RCST P Continue RIH w/ upper completion from 4,515' MD to 12052' MD. Running TEC line and installing Cannon clamps every joint. Checking control line every 1000' MD. SO: 114k 13 bph losses 4,515.0 12,052.0 11/14/2022 08:30 11/14/2022 09:30 1.00 COMPZ2, RPCOMP RCST P Fully locate on joint #297 Didn't observe shear at 12,097' slack of to 95K 19K down at 12106' MD (8.23' to No/Go) confirmed NO GO. Calculate space out for 1 - 9.81' pup joints. L/D joint #297, #296 and #295, install 9.81' pup and rerun joint #295. Total 296 full clamps, 9 half clamps 12,052.0 12,097.0 11/14/2022 09:30 11/14/2022 12:00 2.50 COMPZ2, RPCOMP HOSO P Make up FMC hanger and landing joint, P/U bail extensions, install safety valve, headpin and circulating hose. HES terminate TEC through hanger, FMC test to 5k (good test CPAI witness) Drain stack and land hanger with 118k 2.5' from fully locating, RILD and drop 1- 5/16" ball and rod. 12,097.0 12,097.0 11/14/2022 12:00 11/14/2022 13:00 1.00 COMPZ2, RPCOMP PRTS P Fill stack with fresh water, Purge out air and test top of hanger to 3000psi (good test) 12,097.0 12,097.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 56/56 MT7-06 Report Printed: 12/1/2022 Operations Summary (with Timelog Depths) Job: DRILLING ORIGINAL Time Log Start Time End Time Dur (hr) Phase Activity Code Time P-T-X Operation Start Depth (ftKB) End Depth (ftKB) 11/14/2022 13:00 11/14/2022 14:30 1.50 COMPZ2, RPCOMP OTHR P Set HES TNT packer and test tubing with 4200 PSI for 30 minutes charted. Bleed tubing pressure down to 3000 PSI and hold,Pressure test IA to 4200 PSI for 30 m minutes charted. bleed tubing to 0psi and witness SOV shear at 1650psi. 12,097.0 12,097.0 11/14/2022 14:30 11/14/2022 15:00 0.50 COMPZ2, RPCOMP OWFF P OWFF, slight U-Tub observed. L/D landing joint 12,097.0 12,097.0 11/14/2022 15:00 11/14/2022 15:30 0.50 COMPZ2, WHDBOP CLEN P Clean and clear rig floor and R/D HES equipment. 12,097.0 12,097.0 11/14/2022 15:30 11/14/2022 17:00 1.50 COMPZ2, WHDBOP PRTS P Install HP BPV and test to 3000 PSI for 10 minutes charted pump down IA and return in direction of floow up tbg. Blow down injection line. SIMOPS: R/D MPD lines on BOP deck. 12,097.0 12,097.0 11/14/2022 17:00 11/15/2022 00:00 7.00 COMPZ2, WHDBOP NUND P Pull master bushings, clean Joe's box and pull trip nipple. R/D MPD piping and related equipment Bleed accumulator and N/D BOP stack and risers. SIMOPS: Change out wash pipe and saver sub to 4" XT39 12,097.0 12,097.0 11/15/2022 00:00 11/15/2022 03:30 3.50 COMPZ2, WHDBOP NUND P Complete control line termination at WH. NU adapter flange and 10k frac tree. Install wing valve. 0.0 0.0 11/15/2022 03:30 11/15/2022 04:00 0.50 COMPZ2, WHDBOP PRTS P Test Adapter to 5,000psi 10min. Witness by CPAI 0.0 0.0 11/15/2022 04:00 11/15/2022 04:30 0.50 COMPZ2, WHDBOP PRTS P Fill tree w/ diesel, R/U Schlumberger hard line. 0.0 0.0 11/15/2022 04:30 11/15/2022 09:00 4.50 COMPZ2, WHDBOP RURD P Spot trucks, R/U high pressure lines from schlumberger to frac tree. Test tree to 10k Good test (CPAI witness) R/D service line. 0.0 0.0 11/15/2022 09:00 11/15/2022 09:30 0.50 DEMOB, MOVE OTHR P Remove BPV 0.0 0.0 11/15/2022 09:30 11/15/2022 12:00 2.50 DEMOB, MOVE CIRC P R/U service lines and freeze protect well, Test lines to 3,000psi, Pump 85bbls down ID take returns up TBG. R/U schlumberger equipment. U-Tub IA/TBG 0psi on TBG 0psi on IA Shut in and secure well SIMOPS: Scope down derrick Off MT7-06 well at 1200hrs 11-15-22 0.0 0.0 Rig: DOYON 25 RIG RELEASE DATE 11/15/2022 Page 1/1 MT7-06 Report Printed: 12/1/2022 Cement Cement Details Description Cement Plug Cementing Start Date 9/30/2022 22:34 Cementing End Date 10/1/2022 00:19 Wellbore Name MT7-06 Comment SLB pump 3 bbls of fresh H2O. Tested lines to 5000 psi high, pump 15 bbls of 13.0 ppg Mud Push II @ 3.8 bbls/min, 337 psi, Batch cement (cement wet @ 23:05) Pump 33 bbls of Class G 15.8 ppg cement @ 2.3 bbls/min, ICP = 154 psi, FCP = 142 psi. Batch and pump 5 bbls 13.0 ppg Mud Push II at 3.4 bbls/min, 144 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 2.6 bbls/min, ICP = 134 psi, FCP= 136 psi. 0 losses during the job, shut down pumps at (86 bbls). CIP 00:19 Hrs 10/1/2022. Cement Stages Stage # 1 Description Cement Plug Objective Top Depth (ftKB) 9,202.0 Bottom Depth (ftKB) 10,081.0 Full Return? Yes Vol Cement … 5.0 Top Plug? No Btm Plug? No Q Pump Init (bbl/m… 3 Q Pump Final (bbl/… 2 Q Pump Avg (bbl/… 3 P Pump Final (psi) 136.0 P Plug Bump (psi) Recip? No Stroke (ft) Rotated? Yes Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment SLB pump 3 bbls of fresh H2O. Tested lines to 5000 psi high, pump 15 bbls of 13.0 ppg Mud Push II @ 3.8 bbls/min, 337 psi, Batch cement (cement wet @ 23:05) Pump 33 bbls of Class G 15.8 ppg cement @ 2.3 bbls/min, ICP = 154 psi, FCP = 142 psi. Batch and pump 5 bbls 13.0 ppg Mud Push II at 3.4 bbls/min, 144 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 2.6 bbls/min, ICP = 134 psi, FCP= 136 psi. 0 losses during the job, shut down pumps at (86 bbls). CIP 00:19 Hrs 10/1/2022. Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 9,202.0 Est Btm (ftKB) 10,081.0 Amount (sacks) 217 Class G Volume Pumped (bbl) 33.0 Yield (ft³/sack) 1.17 Mix H20 Ratio (gal/sack) 4.90 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Cement Plug Page 1/1 MT7-06 Report Printed: 12/1/2022 Cement Cement Details Description Cement Plug Cementing Start Date 10/6/2022 01:15 Cementing End Date 10/6/2022 02:00 Wellbore Name MT7-06 Comment SLB, Tested lines to 3500 psi high, pump 12bbls of 11.5 ppg Mud Push II @ 4.8 bbls/min, 497 psi, Batch cement (cement wet @ 0053) Pump 37 bbls of Class G 15.8 ppg cement @ 4.8 bbls/min, ICP = 290 psi, FCP = 210 psi. Batch and pump 4 bbls 11.5 ppg Mud Push II at 4.7 bbls/min, 200 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 4.8 bbls/min, ICP = 134 psi, @ 2bpm FCP= 167 psi. 0 losses during the job, shut down pumps at (62 bbls). CIP 01:40 Hrs 10/6/2022. Cement Stages Stage # 1 Description Cement Plug Objective Top Depth (ftKB) 7,014.0 Bottom Depth (ftKB) 7,807.0 Full Return? Yes Vol Cement …Top Plug? No Btm Plug? No Q Pump Init (bbl/m… 5 Q Pump Final (bbl/… 2 Q Pump Avg (bbl/… 4 P Pump Final (psi) 167.0 P Plug Bump (psi) Recip? No Stroke (ft) Rotated? Yes Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment SLB, Tested lines to 3500 psi high, pump 12bbls of 11.5 ppg Mud Push II @ 4.8 bbls/min, 497 psi, Batch cement (cement wet @ 0053) Pump 37 bbls of Class G 15.8 ppg cement @ 4.8 bbls/min, ICP = 290 psi, FCP = 210 psi. Batch and pump 4 bbls 11.5 ppg Mud Push II at 4.7 bbls/min, 200 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 4.8 bbls/min, ICP = 134 psi, @ 2bpm FCP= 167 psi. 0 losses during the job, shut down pumps at (62 bbls). CIP 01:42 Hrs 10/6/2022. Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 7,014.0 Est Btm (ftKB) 7,807.0 Amount (sacks) 177 Class G Volume Pumped (bbl) 37.0 Yield (ft³/sack) 1.16 Mix H20 Ratio (gal/sack) 4.90 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Cement Plug Page 1/1 MT7-06 Report Printed: 12/1/2022 Cement Cement Details Description Cement Plug Cementing Start Date 10/6/2022 03:45 Cementing End Date 10/6/2022 04:30 Wellbore Name MT7-06 Comment SLB, Tested lines to 3000 psi high, pump 12bbls of 11.5 ppg Mud Push II @ 3.5 bbls/min, 300 psi, Batch cement (cement wet @ 0345) Pump 37 bbls of Class G 15.8 ppg cement @ 3.5 bbls/min, ICP = 138 psi, FCP = 150 psi. Batch and pump 4 bbls 11.5 ppg Mud Push II at 3.4 bbls/min, 157 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 5.4 bbls/min, ICP = 126 psi, FCP= 125 psi. 0 losses during the job, shut down pumps at (54 bbls). Rotating at 50rpm 2.6k torque, CIP 04:33 Hrs 10/6/2022. Cement Stages Stage # 1 Description Cement Plug Objective Top Depth (ftKB) 6,211.0 Bottom Depth (ftKB) 7,014.0 Full Return? Yes Vol Cement … 4.5 Top Plug? No Btm Plug? No Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 2 Q Pump Avg (bbl/… 5 P Pump Final (psi) 125.0 P Plug Bump (psi) Recip? No Stroke (ft) Rotated? Yes Pipe RPM (rpm) Tagged Depth (ftKB) 6,366.0 Tag Method Drill Bit Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment SLB, Tested lines to 3000 psi high, pump 12bbls of 11.5 ppg Mud Push II @ 3.5 bbls/min, 300 psi, Batch cement (cement wet @ 0345) Pump 37 bbls of Class G 15.8 ppg cement @ 3.5 bbls/min, ICP = 138 psi, FCP = 150 psi. Batch and pump 4 bbls 11.5 ppg Mud Push II at 3.4 bbls/min, 157 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 54 bbls/min, ICP = 126 psi, FCP= 125 psi. 0 losses during the job, shut down pumps at (54 bbls). Rotating at 50rpm 2.6k torque, CIP 04:33 Hrs 10/6/2022. Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 6,211.0 Est Btm (ftKB) 7,014.0 Amount (sacks) 177 Class G Volume Pumped (bbl) 37.0 Yield (ft³/sack) 1.16 Mix H20 Ratio (gal/sack) 4.90 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Cement Plug Page 1/1 MT7-06 Report Printed: 12/1/2022 Cement Cement Details Description Cement Plug Cementing Start Date 10/11/2022 00:56 Cementing End Date 10/11/2022 01:58 Wellbore Name MT7-06 Comment SLB, Tested lines to 2500 psi high, pump 45bbls of 13.5 ppg Mud Push II @ 3 bbls/min, 118 psi, Batch cement (cement wet @ 23:15hrs) Pump 87 bbls of Class G 16.8 ppg cement @ 4.2 bbls/min, ICP = 207 psi, FCP = 180 psi. Batch and pump 3.5 bbls 13.5 ppg Mud Push II at 1.8 bbls/min, 138 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 4.2 bbls/min, ICP = 166 psi, FCP= 235 psi. 0 losses during the job, shut down pumps at (22 bbls). Rotating at 30rpm 1.5k torque, CIP 02:35 Hrs 10/11/2022. Cement Stages Stage # 1 Description Cement Plug Objective Top Depth (ftKB) 3,074.0 Bottom Depth (ftKB) 3,730.0 Full Return? Yes Vol Cement …Top Plug? No Btm Plug? No Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 3 Q Pump Avg (bbl/… 3 P Pump Final (psi) 150.0 P Plug Bump (psi) Recip? No Stroke (ft) Rotated? Yes Pipe RPM (rpm) Tagged Depth (ftKB) 3,074.0 Tag Method Pipe/String Depth Plug Drilled Out To (ftKB) 3,485.0 Drill Out Diameter (in) 12 1/4 Comment SLB, Tested lines to 2500 psi high, pump 45bbls of 13.5 ppg Mud Push II @ 3 bbls/min, 118 psi, Batch cement (cement wet @ 23:15hrs) Pump 87 bbls of Class G 16.8 ppg cement @ 4.2 bbls/min, ICP = 207 psi, FCP = 180 psi. Batch and pump 3.5 bbls 13.5 ppg Mud Push II at 1.8 bbls/min, 138 psi, pump. Displace w/ 10.0 ppg Vis Brine @ 4.2 bbls/min, ICP = 166 psi, FCP= 235 psi. 0 losses during the job, shut down pumps at (22 bbls). Rotating at 30rpm 1.5k torque, CIP 02:35 Hrs 10/11/2022. Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 2,959.0 Est Btm (ftKB) 3,730.0 Amount (sacks) 177 Class G Volume Pumped (bbl) 87.0 Yield (ft³/sack) 1.03 Mix H20 Ratio (gal/sack) 3.88 Free Water (%) Density (lb/gal) 16.80 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Cement Plug Page 1/1 MT7-06 Report Printed: 12/1/2022 Cement Cement Details Description Intermediate String 1 Cement Cementing Start Date 10/20/2022 16:30 Cementing End Date 10/20/2022 21:00 Wellbore Name MT7-06A Comment Line up cement unit. flush w/ 3 bbls FW. Test lines to 3500psi. Good test. Mix and pump 60bbls 12.5ppg mud push II at 4 bpm. SD and drop bottom plug. Mix and pump 178bbls 13 ppg G lead cement at 4.5 bpm, Mix and pump 115bbls 15.8 ppg G Tail cement at 4.5 bpm. SD and drop top plug. Pump 20 bbls FW w/ cement. Swap over to rig pumps and Displace cement at 6bpm250-1000psi.At 700bbls slow rate to 3bpm 900psi. Plug bumped @ 6145 stks (calculated stks 6208). Pressure up to 1500psi. Check floats. Good. Cement in place @ 20:55hrs 10/20/22 Cement Stages Stage # 1 Description Intermediate String 1 Cement Objective Top Depth (ftKB) 5,038.0 Bottom Depth (ftKB) 10,177.0 Full Return? No Vol Cement …Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 5 Q Pump Avg (bbl/…P Pump Final (psi) 900.0 P Plug Bump (psi) 1,500.0 Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Cement Fluids & Additives Fluid Fluid Type Lead Cement Fluid Description Estimated Top (ftKB) 6,504.0 Est Btm (ftKB) 8,726.0 Amount (sacks) 217 Class G Volume Pumped (bbl) 73.2 Yield (ft³/sack) 1.91 Mix H20 Ratio (gal/sack) 10.27 Free Water (%) Density (lb/gal) 13.00 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 8,726.0 Est Btm (ftKB) 10,177.0 Amount (sacks) 729 Class G Volume Pumped (bbl) 258.2 Yield (ft³/sack) 1.17 Mix H20 Ratio (gal/sack) 5.08 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 1 Cement Page 1/1 MT7-06 Report Printed: 12/1/2022 Cement Cement Details Description Intermediate String 2 Cement Cementing Start Date 10/27/2022 15:00 Cementing End Date 9/9/2022 16:45 Wellbore Name MT7-06A Comment Pump 5 bbls FW w/ cement unit. Test lines to 5000psi. Pump 70bbls KCL w/ rig. SD and drop bottom dart. Mix and pump 81 bbls of 15.8 ppg cement. Drop top dart. Pump 20bbls FW w/ cement unit. Swap over to rig and displace @ 5-6 bpm. Plug down and cement in place. @ 17:00hrs 10/27/22. FCP 400psi/ 960psi Held f/ 5 minutes and check floats. Floats held. 1.39bbls returned. No Loss to formation TOL at 9673' MD/ Shoe at 12275' MD. Cement Stages Stage # 1 Description Intermediate String 2 Cement Objective CMT 7" Liner T/10,507' Top Depth (ftKB) 10,557.0 Bottom Depth (ftKB) 12,275.0 Full Return? Yes Vol Cement …Top Plug? Yes Btm Plug? Yes Q Pump Init (bbl/m… 4 Q Pump Final (bbl/… 2 Q Pump Avg (bbl/… 3 P Pump Final (psi) 400.0 P Plug Bump (psi) 960.0 Recip? No Stroke (ft) Rotated? No Pipe RPM (rpm) Tagged Depth (ftKB) Tag Method Depth Plug Drilled Out To (ftKB) Drill Out Diameter (in) Comment Pump 5 bbls FW w/ cement unit. Test lines to 5000psi. Pump 70bbls KCL w/ rig. SD and drop bottom dart. Mix and pump 81 bbls of 15.8 ppg cement. Drop top dart. Pump 20bbls FW w/ cement unit. Swap over to rig and displace @ 5-6 bpm. Plug down and cement in place. @ 17:00hrs 10/27/22. FCP 400psi/ 960psi Held f/ 5 minutes and check floats. Floats held. 1.39bbls returned. No Loss to formation TOL at 9673' MD/ Shoe at 12275' MD. Cement Fluids & Additives Fluid Fluid Type Tail Cement Fluid Description Estimated Top (ftKB) 9,380.0 Est Btm (ftKB) 10,028.0 Amount (sacks) 215 Class G Volume Pumped (bbl) 65.0 Yield (ft³/sack) 1.16 Mix H20 Ratio (gal/sack) 5.03 Free Water (%) Density (lb/gal) 15.80 Plastic Viscosity (cP) Thickening Time (hr) CmprStr 1 (psi) Additives Additive Type Concentration Conc Unit label Intermediate String 2 Cement ! " #! $%& 50-103-20831-01 ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" # ( #( ' # , ( #(0 (1 +.2 $ - (1 +330- 4 / 40 / 5!) 6 0 7 $ 0 77 $ $ $ )+! ( )#! ( -# +( +( .-/% ./% 0 # !) ( !"4 !" !1 !*!! !*!! ,41(,4 1!*") 81419"* " (!!*1! #!- #( !*!! !:(!;9*)8! (,(:)(; *"8 # 123 4 ! + 1 3 # # + 123 !" ! # #+ &!( 1<(<! ()*98 8!*9 , 4((* # (* ( ! ( + !" (*! 06 * # ( 41 * 3 1 3 ./% 1 3 123 .-/% 1 3 5 (94)9,*!! ( ,*))!*!!!*!!91*,! 4 1 3 +# # 1 3 1 3 # (<<! = 7 7 11*1, (1 *1, !> !"+ !"&(-8<,<!((!?)1 @AB@@ 3 @AB@ 7@ $ (1 *1, 94)9,*!! (> !"+ !"&(-8<,<!((!?,9 @AB@@ 3 @AB@ 7@ $ 94)")*( (!4( 1*)( !"> (> + !"-(!<(9<!(!?9! @AB@@ 3 @AB@ 7@ $ (!4*,( (4",*1( !"> > + !"-(!<)<!8?!9 @AB@@ 3 @AB@ 7@ $ (4991*! "4"9)*!! !"> 9> + !"-((<(<!"?)?, 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # 91*,! !*!! !*!! 91*,! !*!! !*!! (!!*1! ,41(,4 1!*") 81419"* " !*!! !*!! 0.BA. 11*1, !* 8 !9*8! 11*1, !*98 !*( )!*), ,41(,4 1!* 81419"*,1 (*1 !*9" = +(- (1 *1, (*, (!*1 (1 *19 *(! (*(!, *,9 ,41(,4 88*, 81419,*"! !* *!( = +(- 99,*!1 (*! (1)* , 99,*!9 )*8) *9,(1)*"9 ,41(,4 8,*8 81419)*8 !*), )*") @AB@@+- ),*8, !*,1 ,"*9! ),* 1 ,* 9 9*!(8,*91 ,41(,4 8)*11 814199*,1 !*11 ,*)8 @AB@@+- ,!*"9 (*9 99"*( ,!*," )*8, 9*1998!*(" ,41(,4 8,*1! 81419* ! (*) )*, @AB@@+- "(,*)1 *" 9)1*,( "(,*9" (* )* ") )*1" ,41(,4 81*!, 81419(*1, (*)) (*9) @AB@@+- !1*() 9*19 991*() !8*8, 9*98 "*9!,"8*), ,41(,4 1)*! 81419!*," (*,9 9*8 @AB@@+- 8!(*, ,*(9 99,*88 8!!*" (!*!1 1*(!""!* ,41(,48!!*18 8141 *1) (*99 (!* 8 @AB@@+- 81,*"! "*89 99(*11 81)*,( (8*1! (9*)" ,)*(( ,41(,48!1*1! 81419*89 (*8, (1*1( @AB@@+- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # 11!*9! 8*,8 9"*9! 188*9, 1* , !*!98) *1, ,41(,48!*19 8141( *, *!( 9(*) @AB@@+- (4!8)*81 1*9, 9(!*)( (4!8(*8! )!*"! 1* 11)(*)! ,41(,489*!, 8141!8*(( * 9 )*8) @AB@@+- (4( 1*( (!*,( 18*1 (4( )* ( )1*") )9*!(4!9)*9( ,41(,48)(*)" 81481)*1, *,9 ,*1 @AB@@+- (4 9*88 (!* , 88*"( (4" * ,"*,, ,1*(8(4( *9 ,41(,48)8*8( 8148 1*(8 (*1! "(*!8 @AB@@+- (49" *"" 1*8" 8*( (49"!*!) "!*)8 ,*)(4(1*") ,41(,48,9*(1 8148"9*!" *( ""*8 @AB@@+- (4)"*) (!*", " * 9 (4),9*9) "(*8 1*((49(*1) ,41(,48,)*), 8148)"*9! *( "8*)( @AB@@+- (4,, *1 (*8( "!*,) (4,)"*(8 ,1*! (((*99(4)!,* 8 ,41(,48,*1( 8148 *( * , " *8" @AB@@+- (4",*(8 (,*(, ,*)1 (4"98* ,9* ) (99*,)(4)1 *8 ,41(,48)8*! 8148!)* 9*! ")*(8 @AB@@+- (4 ),*"" ( *"! )8*18 (4 *1, ),*!! (,8*91(4,8 *,, ,41(,48)!*!( 814 1*"1 *89 , *)) @AB@@+- (48)(*9 (1*8! )9*11 (48(8*," 9* ! (8"*),(4" 8*(" ,41(,488*,! 814 ,(*9! *8) ) *)( @AB@@+- (419)*"( *(9 9 *9! (41!,*"8 ("*8 (,*),(4 ",*8 ,41(,48(*81 814 (*8" 9*,8 99*9) @AB@@+- 4!1*9 )*!) 99*! (411* 9 )*1! ),*88(48,*99 ,41(,4 1*, 814"1!*8, *") ()*", @AB@@+- 4(*1, "*!) 9*", 4! *"9 8*8 *,9(419 *9 ,41(,4 "1*,) 814",8*," *(, "*"8 @AB@@+- 4( *19 8*)" 99*(8 4("*! ,,*!9 9(*4!(*" ,41(,4 ))*9! 814"9*(, *," 9!*!, @AB@@+- 49(*,! 9!*1) 99*)( 4))*( 89*!9 9)1* 84(!9*8( ,41(,4 ( *9, 814,8)*8 *"9 ,)*18 @AB@@+- 4)!"*9 99*, 9*8, 499*,) ((9*!8 981*894(89*() ,41(,4"88*)9 814,)9*1" *8 8(* , @AB@@+- 4)11*11 9"*(! 9(*9! 4)!!*) (),*18 )9*!4"!*! ,41(,4","* 814,!!*88 *8" (((*(1 @AB@@+- 4,1*1, 98*)1 9(*! 4) )*9 (8(*8 ) ,*1!4999*1 ,41(,4"*") 814),"*!) *,8 ()*1! @AB@@+- 4"8 * 91*11 9!*9, 4,) *8! (1* ,*94)! *)! ,41(,4,8,*1" 814)!8*,1 (*", ( *!8 @AB@@+- 4 8(*( )(*1! 8*!1 4"(8*9 ,1*) ,"8*"4) *1 ,41(,4,) *9! 8149"(*! *,1 (9*) @AB@@+- 48 "*(1 ))* *,8 4"8 *)1 9!9*!( "("*1)4,) *!1 ,41(,4,!)*88 8149((*"8 *11 ,9*!) @AB@@+- 41"1*! )"*) 8*)1 4 ,*, 9) *)) """*9,4"(*( ,41(,4)"(*8, 814"(*!" *!( 19*)! @AB@@+- 94!"*1" )8*) 8*99 48(,*1 919*8 (8*!!4" ,*, ,41(,4)( *)" 814!8*(, *!8 99)*11 @AB@@+- 94(, *( )8* 9 8*1 48 8* ))!*) !* 94 9 *8 ,41(,49 (*11 814(,)*(, !*99 9 *"( @AB@@+- 94,*! )1*(, 8*89 41)!*"( )8 *"! 8)*9 48!!*( ,41(,49"*() 814!11* !*" )!*," @AB@@+- 949)"*8 )1*88 8*1 94!!*(" ,9,*!! 8 8* !48"(* " ,41(,48!* 814!)9*,1 !* 8 )"9*)1 @AB@@+- 949,1*" )1*1! 8*19 94!(!*)9 ,)(*), 88"*(48 !*!9 ,41(,4 )*!9 814!9"*!! !*8 )"1*9) @AB@@+- 94)9,*!! )1*19 8*8 94!,8*1) , 1*9" 11*,941(8*,) ,41(,49 *9) 88411(*,, !*( ,!9*"8 @AB@@+- 94)")*( )8*( 1*"! 94! 8*!1 ,19* 1)"*419 *"1 ,41(,49*)! 8841 )*) "*,9 ,("* ( @AB@@+9- 94,!!*,8 )"*1, 1*"( 94(!*", "((*(, 1""*""41"*, ,41(,4!"*,1 8841,9*," 9* ,9*) @AB@@+9- 94,9(* ) *!9 *1 94(9*,8 ",*1, 189*,94189*(8 ,41(,4(1* 88419"*8 )*!) ,),*8 @AB@@+9- 94"*!8 ))*9( "*"1 94(8 *!9 ""1*18 (4!9(*894!)"*"9 ,41(,4()1*,8 88488 *99 9*(, ,8,*1 @AB@@+9- 94 ( *"" ),*)( "* , 94,)* 8 ("*! (4!8!*9"94(()*98 ,41(,4(!)* , 88489"*11 (*(, "8*(! @AB@@+9- 948(*!, ))*") "*8 949(*,! "(*1 (4(1*!94(8(*(! ,41(,4!"!*)! 884 8 *!8 !*8 ""1*8( @AB@@+9- 941!"*9 ))*1 "* 8 94988* ( 8! *!8 (4( *((94)8*9( ,41(,4!("*,1 884 9 * , !*9 ((*!! @AB@@+9- 94111*" ),*)) ,*11 94),)*1! 8,*, (4)*8(949()*,! ,41()41 *)1 884"88*8 (*9 ,*, @AB@@+9- )4!19*8 ) *! )*1! 94,!*! 1!!*, (4 9* 949 1*" ,41()41"*(9 884"91*!, (*8 1"*, @AB@@+9- )4(88*)! )8*(8 )*)( 94,89*8) 1)1*1) (49*9"94))9*)) ,41()48 *89 884,88*"( (*8 8)(*8 @AB@@+9- )48*8, )8* )*"( 94")"*)1 (4!!!*9) (49 (*1(94,!"*!1 ,41()488*8 884,9 *"8 !*,1 888*(8 @AB@@+9- )49 *)) )1*), "*"! 94 !8*)) (4!,!*9) (4)*1894,"8*!) ,41()4 8!*" 884)8,*) (* 199*1" @AB@@+9- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # )4) *(( )1*,, *81 94 "1*19 (4!11*( (4) ,*8)94"1*,9 ,41()4 9*88 884)9(*!, (*!) 1 8*)8 @AB@@+9- )4,""* )1*,1 1* 1 9489(*1 (4()"*"! (4,9!*!,94"1!*81 ,41()4"8 *!( 8849 ,*,) (*,9 (4!(*)( @AB@@+9- )4""(*, )1*,, 9!*8 9481*,1 (4(1*8 (4,8,*!94 ,*(1 ,41()4")*9) 8849(1*(9 !*)! (4!"9*(( @AB@@+9- )4 ,)* 9 )1*)) 9!*), 941,9*9( (498*(" (4"91*1)948(*1( ,41()4,18*,) 884"9*(" !*(8 (4(!9*1, @AB@@+9- )48)1*)1 ,!*) 9!*, )4!()*) (48)* (4"1,*89948 )*! ,41()4,,)*!" 884!"*! !*8, (4(),*) @AB@@+9- )41))*!) ,!*( 1*8( )4! )*1) (499!* 9 (4 ,(*")9419)*,) ,41()4,!1*( 884()8*1, !*" (4(8 *9, @AB@@+9- ,4!9 *"1 ,!*) 1*,1 )4(9)*88 (49 * (48!"*,(9411)*)8 ,41()4)")*( 884!1*8! !*! (41*98 @AB@@+9- ,4(9*8 ,!*) 1*!1 )4(1,*9 (4))*") (48"(*" )4!,)*1 ,41()4)(8*9! 884!9"*9, !*)( (4 *9 @AB@@+9- ,4"* ( ,!*( 8*"8 )4,,*8( (4) *9, (41("*99)4((,*)( ,41()49 *(9 8 418!*91 !*9) (49(,*), @AB@@+9- ,49(*!, ,!* 8*91 )49("*(8 (4,!*9" (41 !*"")4( ,* 8 ,41()49,*", 8 41)* , !*" (49,8*18 @AB@@+9- ,4)(,*"( )1*8, 8*,) )49 "*88 (4,"8*)9 4!)*19)49"*)8 ,41()4 1*(! 8 48"1*( !*)" (4)!*,1 @AB@@+9- ,4,!1* " )1*88 1*"! )4)9 *, (4"(,*,1 4! 1*9()41 *( ,41()499*)8 8 48(9*,! !*8" (4)),*8 @AB@@+9- ,4"!)*! )1*89 1*8" )4)18*9) (4""*( 4(9)*1)49, *1) ,41()4(88*), 8 4 , *" !* (4)8 *9) @AB@@+9- ,4"18*!( )1*8 9!*11 )4,,8*1, (4 ! *19 4(81*" )4)(8*,, ,41()4())*) 8 4 !!*") !*1 (4,8*," @AB@@+9- ,4 1*99 ,!*!9 9!*") )4"(1*") (4 ,9*,, 4),*"9)4) 1*) ,41()4(!!*(1 8 4")9*)9 !*99 (4,"1*,1 @AB@@+9- ,488 *! ,!*!) 9!*)( )4"8!*)" (4 11*"1 49!(*",)4,)!*!" ,41()4!,,*"9 8 4,8"*(, !*(1 (4"((*(9 @AB@@+9- ,418(*(1 ,!*! 9!*9 )4 )!*1, (48),* 9 49, *9)4"!!*,, ,41()4!((*(, 8 4,1*9 !*!8 (4",*"( @AB@@+9- "4! )*)! ,!*!, 9!*9( )48!!*8 (481(*9, 4)(*()4""!*) ,41(941" *!8 8 4) 9*(! !*!9 (4"19* @AB@@+9- "4(" *"8 ,!*! 9!*(( )48"!* ( (419 *( 4)" *(")4 !*9( ,41(941*8" 8 4)("*1! !*( (4 9)*18 @AB@@+9- "4"* , ,!*! 1* 8 )41(* 9 (418)*!9 4,*1")4 8(*99 ,41(948 *,( 8 49,1*8 !* (4 *9( @AB@@+9- "49, *,! ,!*!, 9!*)! )418*," 4!9!*") 4, 8*"1)48)*(" ,41(9489*) 8 49!*89 !*,! (48(1*9) @AB@@+9- "4),*98 ,!*! 9!*(! ,4!)9*,! 4! *() 4"9)*"!)41!9*(! ,41(94 8 *,) 8 4),*", !*) (48"(*, @AB@@+9- "4,)"*" ,!*!9 1*8 ,4(!)*!8 4(9*"! 4"81*19)41"9*"8 ,41(94 )*") 8 4(81*!, !*(1 (41!9*( @AB@@+9- "4")* 9 ,!*!! 1*8, ,4(",*8! 4( (*!, 4 )"*!,4!,*)! ,41(94"1"* 8 4(9(*)1 !*!) (41)"*!! @AB@@+9- "4 9"*!, ,!*!" 9!*9( ,4,* , 4("*1) 48!(*!,,4!8,*9, ,41(94",*) 8 4! ,*91 !*98 (418 *91 @AB@@+9- "489!*," ,!*! 9!* ,48"*) 4"9*) 48,"*8!,4()"*! ,41(94"! *"1 8 4!(8*98 !*!9 4!1*(( @AB@@+9- "41,*( ,!*!9 9!*( ,49) *! 49!1*" 41(*,",4!"*8! ,41(94,"*89 8"41"(*9, !*!1 4! !*1" @AB@@+9- 4!(8*11 ,!*!8 1* 9 ,4)! *)( 49,,*19 41" *"!,4" *!( ,41(94,(8*( 8"41!,*!, !*9" 4((* ( @AB@@+9- 4((9*"( )1*18 1*8" ,4)"8*(1 4)!* ) 94!*18,49 * 1 ,41(94) *8 8"48)8*91 !*(, 4(,)*1 @AB@@+9- 4!8*!! ,!*!) 9!* ! ,4,8*8, 4))8*1, 94! 8*"(,4988*), ,41(94)8* 8"4 1(*,( !*"8 4(1"*"( @AB@@+9- 49!(*1, ,!*!! 9(*!" ,4,81* 4)1)*98 94(9)*)",4))8*8 ,41(9498)*9 8"4 9)*) !*9! 49 *)" @AB@@+9- 491 *!( ,!*!( 9!*"1 ,4",!*9( 4,)!*99 94(1!*1,,4,!1*1( ,41(949)!*!! 8"4" "*"8 !*9! 4 8* 8 @AB@@+9- 4)1!*", ,!*! 9!*9) ,4 (!*)1 4,8,*1, 94)"*99,4, !*!1 ,41(941,*19 8"4"!*!" !*1 49(1*8, @AB@@+9- 4,8)* ! )1*11 9!*9 ,4 !*19 4"9(*1 949!(*8(,4"9!*,9 ,41(94,(*, 8"4,"9*99 !*!) 49"(* @AB@@+9- 4" 1*!8 ,!*!) 9!*! ,489(*,8 4" 8*(9 949, *)),4"1(*(8 ,41(94!"*88 8"4,!"*)) !*(, 4)!*1( @AB@@+9- 4 *8) ,!*! 1*)9 ,481(*8( 4 )*,! 94)(*99,4 ,(*)( ,41(94("*!" 8"4),!*8 !*"9 4)))* @AB@@+9- 48" *"" ,!*!) 1* ,41,* 4 (*89 94)" *)",48(*9 ,41(94(("* 8"4919*8" !*(9 4)8 *,8 @AB@@+9- 41"*9( )1*1 8*18 "4!(9*," 48(1*1 94,*1,48 9*(" ,41(94! !*9" 8"499 * ) !*, 4,9!*,9 @AB@@+9- 84!,"*1( )1*8 8*,1 "4! )*,! 48""*1" 94, "* ,419)*(! ,41(94!)* 8"48*!( !*9, 4, 9* @AB@@+9- 84(,(*8( )1*89 8*"1 "4(9,* 41()*8 94"9(*(,,411,*9 ,41(41 *8) 8"4"*8 !*!8 4"( *(" @AB@@+9- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # 84)"*( )1*8 1*9! "4(1"*" 41"*! 94"8,*,8"4!,"* ,41(419*!) 8"4( !*,, !*)1 4""!*!( @AB@@+9- 849)!*)( )1*8 1*99 "4, *)! 94!!1*( 94 )!*(,"4(( *!! ,41(488"*"" 8"4(()* ! !*! 4 !*), @AB@@+9- 84)9)*( ,!*!( 1*") "49( * 94!,,* 94 1)*"1"4( *9 ,41(48)(*,1 8"4!,8*81 !*9 4 ))*, @AB@@+9- 84,1*!! ,!*!8 1*1( "49 8*" 94(!*"" 948,!*(1"498* ,41(4 1"*( 8"4!!*(( !*9 4 8"*1" @AB@@+9- 84"9*8 )1*11 9!*( "4)91*"( 94()1*9) 941!,*1)"411*( ,41(4 ,(*(! 8,41),*!1 !*" 481*!" @AB@@+9- 84 (8*9! ,!*!, 9!*( "4,!!*8 94(1,*" 941"(*,"49,1*88 ,41(4 !"*9) 8,4888*, !*! 48 !*8 @AB@@+9- 848(*1) )1*1" 9(*88 "4,"(*(( 94)(* )4!( *81"4)!* ( ,41(4""*9 8,489!*") (*91 41((*8! @AB@@+9- 841! *(, )1*18 9(*8 "4"(* ! 948,*8( )4! )*"9"4)8(*9! ,41(4"(1*98 8,4 *"1 !*! 41,(*"1 @AB@@+9- 14!!(*"" )1*11 9(*8, "4"8*) 9499!*,( )4(9(*,""4,)*! ,41(4, "* 8,4 ()*,) !*! 411(* 9 @AB@@+9- 14!1)*) ,!*!" 9(*,( "4 )*! 949 )*,1 )4(8 *99"4"!(*" ,41(4,99* 8,4", *, !*1 94!9(*9 @AB@@+9- 14(88*9" ,!*!) 9!*9! "48!*91 94)!*!! )4)9*"4""(*11 ,41(4)81*19 8,4"!!*), !*11 94! *!" @AB@@+9- 148!*1, ,!*!) 1*88 "48"(*8, 94)",*,9 )41 *"""4 (*), ,41(4)),*1 8,4,))* !*9, 94((9*( @AB@@+9- 149 ,*," )1*8 8*,1 "41* 9 94,(*8 )49,*,("4 8*99 ,41(4)!!*(8 8,4)88*" (*!" 94(,,*1( @AB@@+9- 14)"1* " )1*1( ,*8, "4189*) 94,"(* ) )4)!,*98"48)9*! ,41(49,* ) 8,4)9)*) * 94!!*) @AB@@+9- 14,"*1, )1*8) 9*8 4!)9*)1 94"(*,! )4),,*98"41!9*!1 ,41(49!9*91 8,4989*!) *(( 94) *(! @AB@@+9- 14", * ! )1*8 (*! 4(!)*,8 94"""*( )4,!)*!""41")*(8 ,41(4,(*(, 8,499*81 (*"8 941"*"8 @AB@@+9- 14 ,*91 )1*8( (1*9( 4(",*", 94 (*9) )4,,!*8 4!,*, ,41(4(1 *, 8,48)*"( (*,9 949)8*!( @AB@@+9- 148) *! )1*8, ("*,! 4"* 9 94 8*) )4,1,*" 4!8"*99 ,41(4()(*)) 8,498*"( * 94)!(*98 @AB@@+9- 141)(*(( )1*1! (9*9( 48 *9) 9489 *9 )4"9"*)! 4()"*1) ,41(4!89*", 8,4(1,*8" *,1 94),"*88 @AB@@+9- (!4!9,*") )1*8) !1*1! 49)8*8 94818*1( )4" )*" 4! *88 ,41(4!9*(8 8,4(,"*9! * " 94,(,* @AB@@+9- (!4(1*9" ,!* 9 ! *!8 4)!8*( 941"* )4 !8*") 4" * ,41((41"!*8( 8,4(!*(8 *,! 94, ,*") @AB@@+9- (!4( 1*)( ,!*1 !"*)( 4)91* 9411"*19 )4 "*(! 411*9 ,41((41"*", 8,4(!(* " (*() 94"!8*8! @AB@@+9- (!4*,( ,(*" !)*1( 4)""*89 )4! *( )4 )!*"9 49"*)9 ,41((481"*89 8,4!8"*)! * 1 94"9 * 1 @AB@@+)- (!49("*"! ,* , !,*18 4,)* , )4!1)*( )4 *)1 498)*9, ,41((489!* 1 8,4!,*"1 (*8 94 !*!! @AB@@+)- (!4)((*1 ,,*!! !9*98 4,8!*1, )4(")*! )48!)*"( 4))!*,, ,41((4 "(* " 8,4!(8*", 9*9 94 "1*(8 @AB@@+)- (!4,!,*)8 , *,9 !*!) 4"9*1! )49,*8) )489)*"9 4)1*,! ,41((4"1!*8, 8)418"*") *1, 94898*9) @AB@@+)- (!4"!!*(1 ,1* ) !(*,, 4"8*! )49(!*19 )48")*", 4,)(*8! ,41((4"("*"9 8)41,)*,, *9 941(!*8! @AB@@+)- (!4"1)*)9 "(* , !!*91 4 8*, )498 * ! )481)*! 4,8 *8, ,41((4,)!* ( 8)419*! *91 9418,*!! @AB@@+)- (!4 81*!" "9* 8 (11*9, 4 (*," )4)""*89 )41*"" 4"9(*(" ,41((4)"*)( 8)481*, *9" )4!"(*"! @AB@@+)- (!488* , ",* (1"*8, 48((*81 )4,) *! )41)8*1( 4" (*)1 ,41((498*8! 8)48"9* *8" )4(91*"9 @AB@@+)- (!41 *)8 ",*81 (1,*! 48,(*(! )4"9!*(( )41 *" 4 (!* ! ,41((49!!*,1 8)489 * (*8, )4!*)! @AB@@+)- ((4! (*)" ""* (19* 1 4881*! )4 (9*9( )411)*!9 4 )8*8! ,41((4(8*! 8)48()*!" (*9( )49!(*"9 @AB@@+)- ((4(",*() ""* ! (1(*81 41"*,8 )4 1 *!, ,4!(9*(( 4 8"*(8 ,41((4(9)*8) 8)4 1*"" (*1 )4989*,1 @AB@@+)- ((4,1*8" " *(" (81* 41"9* ! )488*", ,4!1*), 489*9! ,41((4!)1* ) 8)4 9*1" *(" )4)" *" @AB@@+)- ((49,9*1, " * 1 (8 * 4111* , )41"8*,, ,4!)*" 48,1*9, ,41(!41")*) 8)4 ,8*)( *! )4,,*! @AB@@+)- ((4))8*,) "8*, (8,*"" 84!9)*1, ,4!,,* ) ,4!,*8) 481)*,, ,41(!48 *9 8)4 ),* *(" )4"98*9( @AB@@+)- ((4,)*"8 "1*!1 (89* 1 84!"8*11 ,4()9*( ,4!"!*! 418*,1 ,41(!4 1!*() 8)4 9"*( (*1, )4 )*19 @AB@@+)- ((4"9"*9) "1*"8 (8(*") 84(!(*1 ,49!* ,4!")* 41"(*, ,41(!4 !* 9 8)4 1*,) *) )48((*88 @AB@@+)- ((4 9!* ( !*)8 ( 1*(( 84(9)*(9 ,49(1*)8 ,4!")* 1 4119* 9 ,41(!4"()*!8 8)4 "*,! *"" )41!!* @AB@@+)- ((48)*1) (*9" ( *(9 84(")*19 ,4)!8*)8 ,4!"(*8 84!)*,9 ,41(!4,,*!9 8)4 "*1, *(1 )4181* @AB@@+)- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # ((41(1*" (*1( ( ,*!8 84(1)* ,4)18*( ,4!,,* "84!,)*9 ,41(!4)9,*" 8)4 9!*, *() ,4! 1*!" @AB@@+)- (4!(9*9 *8( ( *" 849*(8 ,4,8"*1) ,4!)"*(184!8* 8 ,41(!49)"*( 8)4 9 *" *"8 ,4("8*9" @AB@@+)- (4(! * ! 9*") ( !*) 84,!*)( ,4" "*" ,4!9*8 84((!*!( ,41(!4,"*," 8)4 )8*,( *)! ,4,8*)" @AB@@+)- (4!* " )*"" ("8*,8 84 "*9 ,4 ""*( ,4!("*!84(9,*1 ,41(!4(""*9 8)4 "*" *(, ,49)1*)! @AB@@+)- (4",*1( ,*)9 (""* , 841*" ,48,* ,4!!9*("84(,* ,41(!4(!"*9! 8)4 )*!, 9*!, ,4)!1*8, @AB@@+)- (4991*! ,*18 (",*"! 849(!* 9 ,481)*"( )418"*84( !*99 ,41(!4!9 *! 8)4 81*! (* ! ,4) 1*8 @AB@@+,- (4)99*!! "*)1 ("*) 84999*!1 ,418*" )41"!*1,84(1*"1 ,41!141)8* ( 8)48((*81 9*, ,4,"1*! @AB@@+,- (4,8*!( 8*!" (,1*9 849,)*! "4!"1* , )419!*))84(9*" ,41!148"!*)! 8)4891*1" 9*) ,4",8*8) @AB@@+,- (4"9*) 1*8( (,"*9 849 *9! "4(,"*, )481,*!1849(*1! ,41!14 *1" 8)48 *1! 9*"8 ,4 ) *8 @AB@@+,- (4 (8*99 8(*)! (,)*,) 8498 *8 "4)(*,9 )48,"*!84) *) ,41!14"8"*"9 8)41!1*,1 *) ,489,*11 @AB@@+,- (48(*)1 89*(" (,*1) 84)!!*) "49,*! )48()* 984"!*! ,41!14"!(*8, 8)41)8*,9 *, ,41*"8 @AB@@+,- (41! *"9 8)*89 (,(*11 84)(!*)9 "4)!1*(! )4 !*1184 !*!9 ,41!14,("* 8 8)4181*1 *! "4!!1* 8 @AB@@+,- (94!!*)( 8"*," (,9*! 84)( *,) "4)19*!! )4 *,!84 *() ,41!14)9(* ! 8,4!9(*! *9 "4!1"*8 @AB@@+,- (94!18*!9 88*(" (,)*8 84)(*1) "4, 8*"" )4"8,*)848(*,) ,41!149))*1( 8,4! !*1) *! "4(8,*" @AB@@+,- (94(1*"" 88*9, (,9*1 84))*89 "4""9* " )4")9*1"848)*)9 ,41!14,8* ! 8,4(!1*89 !*98 "4 9* 9 @AB@@+,- (948"*81 88*9, (,(*)! 84) *,) "4 ) *)) )4"!!* )848 *() ,41!14( 9*8, 8,4(,!* ( * 9 "49"!*,8 @AB@@+,- (9498*8, 88*98 (,!*)1 84)9!*8 "489(*1 )4,,)*("8481*88 ,41!14!88* , 8,4(1)*1, !*1, "4)) *8 @AB@@+,- (94) *,9 88*9, (,* 84)9*18 "41()*9, )4,!8* 1841*,8 ,41!14!!)*) 8,49 *11 (*89 "4,9)*" @AB@@+,- (94, 9*! 88*11 (,* ) 84)9,*! "4111*!, )4)")*""841)*8! ,41!841(8*,8 8,4 1* , !*8" "4"*( @AB@@+,- (94"" *, 1!*( (,*"! 84)9,*19 4!8*1" )4)(*1841,*,9 ,41!84899*,( 8,49!* " (*( "4 !1*1 @AB@@+,- (94 "(* 1!*(9 (,*)9 84)9,* 9 4(""*, )49 *8841,*99 ,41!84 )8* 8,49"(*1! !*(8 "4 1"*!, @AB@@+,- (948,"*19 1!*(! (,*!, 84)9,*,9 4,!* )4999*) 841,*(9 ,41!84""9*9 8,4)!9*81 !*)! "4889*," @AB@@+,- (941,*,, 1!*! (,* 84)9,*91 499,*9( )488* 8841)*11 ,41!84, *,8 8,4))"*( !*(8 "41 (*9 @AB@@+,- ()4!) *) 1!*(" (,*! 84)9,*! 4)(1*9 )4))*)9841)*8! ,41!84)1*) 8,4)88*( !*(8 4!,8*,, @AB@@+,- ()4()9*! 81*91 (,(*) 84)9,*,8 4,!9*91 )4(11*!841,*(8 ,41!84)! *!1 8,4,9(*!1 (*!, 4()"*!) @AB@@+,- ()49,*) 81*)9 (,)*91 84)9"*,9 4,8,*") )4(, *(841"*(9 ,41!8499* ( 8,4, !*8 9*( 49(*9 @AB@@+,- ()499!*98 88*8 (,*8! 84)9 *1) 4" !*"8 )4(()*1!841 *,) ,41!849 *,9 8,4"(!* ( (* 8 49(1*,! @AB@@+,- ()4),*9( 88* , (,*9 84)91*1( 4 ,)*1( )4! (*("8411*,( ,41!84(,*( 8,4",*!1 !*, 4)!"*1) @AB@@+,- ()4,(1* 9 8 *18 (,*1 84))*"! 4898* ) )4! * 1849!*! ,41!84!" *(9 8,4"19*(( (*! 4)19*1, @AB@@+,- ()4"(,*!! 8 *8! (,*!" 84))"*(( 419*! 94189*8"849!,* ( ,41! 418(*)1 8,4 9)*"1 !*1 4,8(*"9 @AB@@+,- ()4 !1* ! 8 *8" (,*(, 84))1* ! 84!!"*89 94191*,8849!1*9! ,41! 481"*"" 8,4 "*" !*(( 4""8*, @AB@@+,- ()48!)*"! 88*8! (,9*!, 84),*)" 84!1(*!, 9481,*19849(*!" ,41! 48((* 8,48( *1 (*9 4 ,,*1) @AB@@+,- ()4811*"! 1!*(8 (,*89 84),9*9( 84( ,*") 948,* (849(*1( ,41! 4 ,*,( 8,48,8* " (*) 48)9* ! @AB@@+,- ()411)*"" 1!*! (,9*!1 84),9*(! 84"!*9( 948!1*,!849(* ! ,41! 4"91*"8 8,4811*"( !*9! 419(*,9 @AB@@+,- (,4!81*(( 1!*(! (,9*8, 84),*1" 849))*8 94 " *9(849(*," ,41! 4,,)*!) 8,4191*)9 !*8( 84!(1*( @AB@@+,- (,4(89*( 1!*)( (,9*(8 84),*,) 84)1*!) 94 ,*9,849(*() ,41! 4)"8*"1 8,41 1*!) !* 8 84(!"*)( @AB@@+,- (,4 *1 1!*! (,9*!9 84),*() 84,(9*,, 94"8*)8849((* ) ,41! 4989*!9 8"4!(1*,) !*91 84(1)*!" @AB@@+,- (,49 *8( 1!*(9 (,*8( 84),(*18 84,1 *11 94"91*9(849((*,8 ,41! 41 *) 8"4!"!*9, !*) 848(*" @AB@@+,- (,4)" *1 1!*! (,9*(( 84),(*8( 84"8* ! 94,1"*! 849((*)( ,41! 4((*,) 8"4(!(* !*9 849"1*,, @AB@@+,- (,4,"*)" 1!*(! (,*89 84),(*" 84 ""*1 94,,9*(!849((* ,41! 4("*(8 8"4()(*89 !*9! 84),"*1( @AB@@+,- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # (,4", *9) 1!*(! (,9*(8 84),(*,( 848,(*)" 94,(!*!)849((*(( ,41! 4!)!*) 8"4(8*,9 !*9 84,))*"! @AB@@+,- (,4 ,9*() 1!*(! (,*," 84),(*9) 8419"* 94)""*9,849(!*1) ,41!"41,)*!) 8"49*89 !*", 84"99*!" @AB@@+,- (,48) *9! 1!*!) (,*9( 84),(*9 14!!*(1 94)* 8849(!*89 ,41!"48"1*)! 8"4",*!" !* 84 (1* 9 @AB@@+,- (,41)*81 1!*(! (,*19 84),(*(( 14(!,*! 949 8*8849(!* ( ,41!"4 89*99 8"49!"*", !*", 848! *8) @AB@@+,- ("4!98*!) 1!*! (,*"! 84),!*1 14(81*" 9499,* 849(!*, ,41!"4"1 *," 8"49) *89 !*9, 8481,*"9 @AB@@+,- ("4(9*9 1!*! (,9*)9 84),!*8, 14 9* 9 941*) 849(!*), ,41!"4"(*9, 8"4988*8 !*88 8418*89 @AB@@+,- ("4 *,( 1!*(! (,9*!9 84),!* ( 149,8*" 94)1*"849(!*9( ,41!"4,"*, 8"4)8* , !*) 14! !*1( @AB@@+,- ("499* 1!*(1 (,*, 84),!*) 14))9*"8 94!,*"9849(!*! ,41!"4))!*!" 8"4) !*9" !*8 14(,1*(9 @AB@@+,- ("4)( *", 1!*(9 (,9* 84),!*! 14, *"9 94("*)(849!1*8! ,41!"49,)*1, 8"4,((*9 (*!8 14)"*" @AB@@+,- ("4,(*8 1!* (,9*9 84))1*1( 14"(* ! 94((1*"849!1*,( ,41!"4"8* 9 8"4,,(*") !*(( 1499)*), @AB@@+,- ("4"! *,9 81*,8 (,*1! 84),!*!8 14"1 *( 94! "*8(849!1*"8 ,41!"4(89*(" 8"4,1*!1 !*8( 14)*!( @AB@@+,- ("4 !*8 81*!1 (,9*) 84),(*(8 14 8(*" 94!9)*! 849(!* 8 ,41!"4!1 *), 8"4"9*) !* 1 14,!1*"1 @AB@@+,- ("4 1"* ( 88*9 (,9*9" 84),9*9( 148""*(! 411(*8849(*1( ,41!"4!((*81 8"4" *9, !*8 14,1 *( @AB@@+,- ("481(*,8 88*)( (,* 8 84),"*! 141,!*", 41)8*8 849(,*" ,41!,41"*(1 8"4 (*1) !*" 14"8)*1! @AB@@+,- ("418"*8" 88*11 (,*"( 84),8*(8 (!4!9,*1 41!,*( 849( * 8 ,41!,48)!*9 8"4 ,)*" !*"9 14 * , @AB@@+,- ( 4!8*() 81*") (,*,9 84),1*9 (!4((1*8, 48"(*1849(8*1 ,41!,4 ,)*"9 8"4 1,* 1 !*"1 148"!*,9 @AB@@+,- ( 4( *!, 81*") (,9*9, 84),1*1 (!4!)*9 48(8*((849(1*, ,41!,4""8*1, 8"489"*"! !*8" 141)8*( @AB@@+,- ( 4 *(" 81*") (,*9! 84)"!*,( (!488*18 4 )*" 849!*(( ,41!,4,89*( 8"48 *"" (*(! (!4!9"*!! @AB@@+,- ( 49""*8 81*"( (,(*9" 84)"(*(9 (!49 *)" 4 1*1"849!* 9 ,41!,4)18*)8 8"41!*!) !*11 (!4(* 8 @AB@@+,- ( 4)"!*!) 81*,8 (,!*! 84)"(* 1 (!4),9* ! 4"8)*9"849(*91 ,41!,4)("*!( 8"41"9*9 (*)) (!4! *98 @AB@@+,- ( 4,,)* 81*" (,!*" 84)"*)( (!4,9,*18 4"9 *,(849*!( ,41!,499*) 8 4!! *1( !*"1 (!419*( @AB@@+,- ( 4")1*", 81*" (,*)9 84)"*1" (!4"(1*)) 4,1*1849*," ,41!,4) * 1 8 4!,!* 1 (*8, (!49 1*1( @AB@@+,- ( 4 ))*89 81*") (,9*9) 84)"9*,9 (!4 !)*(" 4,)8*1(8499*(9 ,41!,4("(*1! 8 4!1(*8! !*1" (!4)" *8( @AB@@+,- ( 4891*! 81*" (,9*( 84)")*(! (!4 88*8 4,!"*,,8499* ! ,41!,4! "*") 8 4(9(*8( !*() (!4,,,*!9 @AB@@+,- ( 419)*9( 81*!9 (,9*", 84)",*(8 (!48 9*,! 4)"9*19849)* 8 ,41!)411!* 8 4( *!) !*8 (!4")9*9 @AB@@+,- (84!1*99 81*!! (,9*" 84)""*8( (!41,8*", 4)(* 8849"*)( ,41!)41!9*11 8 4((*8( !*!) (!4 9(*,1 @AB@@+,- (84("*8) 88*1" (,9*"8 84)"8*,, ((4!)"*!9 49 8*,,8498*(, ,41!)48(,*), 8 4,*"! !*!) (!48*(9 @AB@@+,- (84(*9, 81*91 (,,*1" 84)"1*1( ((4(9(*,) 4998*9)8491*,( ,41!)4 8*8, 8 41!*) *), (!41(!*, @AB@@+,- (849(,*) 88*"1 (, *! 84) (*)8 ((4( *"1 49!(*!98499(*!8 ,41!)4")(* 8 49,*9 (*, (!4111*)( @AB@@+,- (84)(!*!, 88*( (,,*9! 84) )*!8 ((49!)*)9 4"*8"84999*"8 ,41!)4,,9*1, 8 49"(*!" *!8 ((4!88*1( @AB@@+,- (84,!9* " 88*() (,9*) 84) *(! ((4988*8! 4*!8499"* ! ,41!)4)"8*)1 8 4911*9" *! ((4( "*) @AB@@+,- (84,1 *9, 88*() (,*9" 84)8!*() ((4) *!! 4( 1*),84991* ) ,41!)498)*() 8 4)91* 1 !*1) ((4"*, @AB@@+,- (84"1(*( 88*"9 (,(*) 84)8* 8 ((4,,)*") 4(9,*(9849)*98 ,41!)49!!*9! 8 4)8(* 1 (*9! ((49)8*)8 @AB@@+,- (84 8"*"9 81*) (,*)" 84)8)*," ((4"98*8! 4!1!*(!849))*(" ,41!)4()*19 8 4,)*) (*)9 ((4)9,*1) @AB@@+,- (8488!*(, 81*)9 (,(* ! 84)8,*") ((4 (*) 4!)"*9849),*) ,41!)4(9(*( 8 4,",*1) !*8) ((4,(* 1 @AB@@+,- (841 ,*99 1!*(! (,9*(9 84)8"*!9 ((48!,* 8 4!!*)849),*"9 ,41!)4!),*,8 8 4"! *", (*"" ((4"!1*98 @AB@@+,- (14!"1*() 1!*(! (,9*99 84)8,*8 ((4881*,) (41,1*11849),*) ,41!941"!*"1 8 4") *," !*( ((4"1"*9 @AB@@+,- (14("9*(" 1!*(9 (,(*1( 84)8,*"8 ((41 9*! (41("* ,849),*8 ,41!948 "*!) 8 4"88*)" (*,( ((4 8*81 @AB@@+,- (14, *), 1!*(! (,*)1 84)8,*)1 (4!,"*)9 (48 * 8849),*!1 ,41!94 1(*), 8 4 9!*(! !*" ((48"1*, @AB@@+,- (149,(*! 1!*(! (,(*1, 84)8,*99 (4(91*( (481*( 849))*19 ,41!94 ! *)1 8 4 (*)! !*,8 ((41,,*,( @AB@@+,- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # (14)),*8" 1!*(1 (,*!" 84)8,*!1 (4*1" (4 8)*",849))*"1 ,41!94"*,, 8 48(9*, !*(, (4!)*,9 @AB@@+,- (14,)!*,! 1!*! (,9*)8 84)8)*8 (49! *(( (4 )(*9,849))*) ,41!94,9 *9 8 48,)*, (*,( (4(1*8, @AB@@+,- (14"9)*(( 1!*(9 (,9*, 84)8)* ( (491!* 8 (4"11*98849))*9( ,41!94),*)9 8 481)*() !*, (4("*"! @AB@@+,- (14 8*, 1!*(! (,9*( 84)8)*, (4) )*8 (4","*1,849))*( ,41!949" *, 8 419)* !*!1 (49!9* ) @AB@@+,- (148*,, 1!*! (,9*"( 84)8)*98 (4,,1*(9 (4"()* (849)9*18 ,41!948(*8! 8 41 )*(! !*) (491(*() @AB@@+,- (141("*)" 1!*1 (,9*,! 84)89*, (4")9*( (4, *81849)9*( ,41!94(1"*"! 884!(9*, !*1( (4) 8* @AB@@+,- !4!(!*(9 1!* 8 (,9*(" 84)8*(8 (4 "*1! (4,9!*8,849)(* 8 ,41!94(((* 884!,9* !*91 (4,",*!) @AB@@+,- !4(!)*9" 1(*), (,*8 84)8!*9, (48(!*"9 (4)8 *" 84991*1, ,41!94!"*88 884!1)*(! (*( (4",(*1) @AB@@+,- !4(18*!! 1*!! (,*11 84) *,9 (4819* " (4)))*",8499 *(9 ,41!41)*"! 884(9)*8! !*1" (4 98* @AB@@+,- !41*"8 1(*1 (,(*", 84) )*, (41 *,, (4)!!* !84999*8, ,41!48, *" 884( "*)( (*)( (48,*) @AB@@+,- !498,*, 1(*! (,*(9 84) (*8 (94!,1*)( (49,"*1 8499(*) ,41!4 )*,8 884( *8) (*(, (41(!*9( @AB@@+,- !4) 8* ! 81*,! (,* 84) (*)! (94()*! (49(9*8 8499(*!! ,41!4"1!*8( 884,8*"9 (* (411"*!1 @AB@@+,- !4, *9" 81*,, (,9* 9 84) *(8 (94,*", (4 (* 8499(* 8 ,41!4"!"*!, 88418*)) (*!9 (94!8*8( @AB@@+,- !4"" *), 81*, (,*9) 84) *1, (949(!*)! (48*"!8499*,, ,41!4,!*() 884991*(1 (*)" (94( !* ( @AB@@+,- !4 "*) 81*, (,9*!, 84) 9* , (9491)*89 (4(8,*!84999*9, ,41!4)9)*,) 88498!*)( !* , (94,8*9) @AB@@+,- !48, *" 81*!1 (,)*,1 84) )*1! (94) 1*81 (4()9*!8499)*,! ,41!49)8*9" 884)(1*8, (*"1 (949)"*), @AB@@+,- !41,(*(9 81*( (,,*! 84) "*9" (94,")*89 (4(!9*88499,*1" ,41!4"*9) 884), *91 !*,( (94)9)*9! @AB@@+,- (4!),*"9 81*)9 (,9*(1 84) *," (94")1*8, (4!"*!,8499 *(" ,41!4( "*( 884)1"*) *! (94,*9 @AB@@+,- (4(91* 8 1!*(! (,)*,, 84) *1) (94 9)*98 (4!!*,18499 *,) ,41!4!1!*, 884,9,*9) (*"( (94"!1*8 @AB@@+,- (49)*( 1!*, (,9*(8 84) *"" (948(1*(( 1 1*!(8499 *" ,41!4!!)* 884, )*,) (*)" (94"1 *") @AB@@+,- (49"*"8 1!*(1 (,9*(1 84) *9! (941!(*" 19 *88499"*1! ,41!(41(*!) 884"(9*1 !*! (94 89*" @AB@@+,- (4)!* 1 1!*(1 (,9* 1 84) "*11 (9418,*81 81,*88499"*,1 ,41!(489,*"1 884",9*" !*") (948 !*,, @AB@@+,- (4,(9*)! 1!* (,9*!! 84) "*"" ()4!"8*"1 8,9*8!8499"*" ,41!(4 ,(* 884"1* !*8, (941,"*98 @AB@@+,- (4"!1*! 1!*8 (,9*9 84) "*) ()4(,)*!( 8(!*"98499,*8) ,41!(4"",*1 884 99*," !*9) ()4!))*8" @AB@@+,- (4 !*)( 1!*(1 (,9*(9 84) ,*8" ()49 *91 "8*,"8499,*)" ,41!(4,8!* 1 884 9*9! !*9 ()4(9(*9 @AB@@+,- (4 1 *,! 1!*(" (,*8 84) ,*, ()49(*81 )*1,8499,*( ,41!(4)1,*(( 8848()*,) !*81 ()4(1*!( @AB@@+,- (481(*) 1!*(" (,9*, 84) ,*9! ()4)!,*9 "8*!"8499)*1! ,41!(4)(!*"( 8848,,*(! (*!9 ()49!,*,( @AB@@+,- (418"*8 1!*(" (,9*, 84) ,*!) ()4)1!*! "91*)88499)*") ,41!(49)*,! 88481,*9! !*8 ()4919*,1 @AB@@+,- 4! 1*) 1!*(! (,9* 84) )*89 ()4, 9*,! ,18*(8499)*)9 ,41!(4)!*!1 88419)*) !*8 ()4) 1*1! @AB@@+,- 4( ,*!! 1!*(! (,9*8 84) )*"" ()4",1* ,,,*,8499)*" ,41!(4(,9*9 8841 )*,9 !*,( ()4,"8* ) @AB@@+,- 4 !*9 1!*(! (,*9, 84) )*)1 ()4 )9*19 ,(*!(8499)*!1 ,41!(4!" *9, 814!(,*" !*18 ()4","*") @AB@@+,- 49")*, 1!*, (,*" 84) )*( ()48 *"( )"8*) 84999*8( ,41!!418*)8 814!,"*8 !*9 ()4 )9*, @AB@@+,- 4),8*"" 1!*(9 (,9*" 84) 9*81 ()41((*, )"*!!84999*)1 ,41!!481 *98 814!1"*11 (*! ()489!*,1 @AB@@+,- 4,,*)" 1!*(" (,*8" 84) 9*"" ()411,*9, 989*8!84999*" ,41!!48(*)8 814(9"*8) !*8" ()41( *), @AB@@+,- 4") * 1!*(! (,9* 8 84) 9*)) (,4!8!*!" 9)(*984999*!) ,41!!4 "*" 814( *!) !*1 (,4!!,*8 @AB@@+,- 4 )!*"9 1!*(" (,*1 84) 9*9 (,4("9*, 11*)!8499*89 ,41!!4")*!9 814("*,) !*8 (,4!1(*8! @AB@@+,- 489,*,9 81*( (,9*) 84) 9* , (,4)8*(, ,"*) 84999*9, ,41!!4,,"*, 814, *(! (*!) (,4( 1*, @AB@@+,- 419!* 88*,! (,9* 84) ,*", (,499* (9*8(8499,*, ,41!!4) !*,9 8141 *)! !* , (,4" *" @AB@@+,- 94!)*91 88*!) (,9*"8 84) 8*)1 (,4)("*88 ( (* "84998*!1 ,41!!498,*) 81499 *(! !*"1 (,49,)*)1 @AB@@+,- 94((1*) 88*! (,9*)9 84)8(*"! (,4,!(* , (1*,)849)(*! ,41!!411*9 8149 "*1) !*9( (,4))*)" @AB@@+,- ' ( #( )#%!# ( * ( ( ( ( !" !" ## !( ## $ %& !"'()!*)! +,- +( !" ### (.( / ($ %& !"'()!*)! +,- ( !" 1 3 6 123 " 123 .-/% 1 3 ./% 1 3 * 1 3 * 1 3 # + 1 3 # -# + 1 3 * # 1 3 ) 12/783 # 94(9*88 8 *)" (,(*8) 84)8,*(8 (,4,8,* ) 8"*! 849))* 8 ,41!!4()*! 814)(8*!" (*8, (,4,1*"9 @AB@@+,- 949!8*8 8 *18 (,9*!( 84)88*1) (,4""1*9, )*)(849)8*,) ,41!!4(1*1 814),1*98 (*9" (,4"("*), @AB@@+,- 94)!(*1, 8 *1, (,*! 84)1*" (,4 ,*)" !*" 849,(*8" ,41!!4!),*! 814,!!*(9 !*8" (,4 !* @AB@@+,- 94)1"*,! 8 * ) (,!*81 84)1,*8 (,489,*,9 ),*"8849,,*) ,481141"!* ) 814,)*8 (*)! (,4 81*(! @AB@@+,- 94,1(*! 88*1, (,(*19 84)18*,, (,41(8*") 1!*18849,8*(, ,481148 "*)! 814,8,* 1 (*"8 (,48 ,*,, @AB@@+,- 94"8,*)) 81*, (,9*(8 84)11*8( ("4!!* (9)*)(849,1*)( ,48114 1(*"! 814""*88 (*)" (,41"*9" @AB@@+,- 94 "*!1 81*)" (,*,, 84,!!*" ("4!8*1) ( ,* ,849"!* ,48114 !1*8 814"",*1" !* ! ("4!)"*!" @AB@@+,- 948 !*) 81*)1 (,9*9! 84,!(*)8 ("4(""*19 (8*"1849"(*!8 ,48114")*"8 814 !"*,) !*8! ("4(99*(1 @AB@@+,- 941"9* 81*, (,*") 84,!*1 ("4)1*,1 "!*8"849"(*81 ,48114,)!*81 814 )"*)! !* ( ("4(8*1) @AB@@+,- )4!, *,( 81*8" (,*!, 84,!*8! ("4999*(! 9!)*"849"*)! ,48114),"*(1 814 8 *89 !* ("49!,*" @AB@@+,- )4(,)*)( 1!*)) (,*8 84,!*,) ("4)(1*! 9)1*)849"*() ,481149"1*! 81489!*9 (*!) ("491)*88 @AB@@+,- )4,!* " 1!*98 (,*!" 84,!(*8, ("4,!)*), 919*1"849"(*), ,481148*)9 8148 *98 !*8) ("4)89*,8 @AB@@+,- )49)*, 1!*9, (,* , 84,!(* ("4,8,* )9"*) 849"!*8 ,48114(11*1 8141(*"! !* , ("4,"8*! @AB@@+,- )4)98*" 1!*9, (,9*(1 84,!!*"8 ("4" (*) )8!*("849"!*8 ,48114((9*(, 8141,9*1! !*)" ("4","*8 @AB@@+,- )4,9*,) 1!*)( (,*9) 84,!!*!" ("4 ,)*88 ,9*(849,1*"" ,48114!8*,9 81411)*, !*1( ("4 )9*)8 @AB@@+,- )4"8*)) 1!*98 (,9*,) 84)11*)! ("48)!*8 ,""* ,849,1*!! ,481841)(*1" 1!4!9,* " (*, ("489*! @AB@@+,- )4 *98 1!*)) (,9*1) 84)18* ("41)*, "!8*9(849,8*9 ,481848,"*"! 1!4! )*1 !*)9 ("41(1*9, @AB@@+,- )48(,*1) 1!*98 (,)*9 84)18*!" ( 4!!8* ! ")1*(9849, *"" ,48184 (*9 1!4((9*)9 !*)( ( 4!!"*,( @AB@@+,- )41(!*89 1!*"8 (,9*(, 84)1 *(8 ( 4!19* 1 "1(*(849,"* 8 ,48184"8,*(! 1!4(,9*!) (* ( 4!1)*"" @AB@@+,- ,4!!9*89 1!* ( (,*,) 84)1"*!, ( 4( "*,9 99*,"849,,*", ,48184"!(* 1!4(19*( !*"" ( 4(8!*, @AB@@+,- ,4!1 *)! 1!*8 (,*99 84)1)* " ( 4,1*) "*8"849,)*9" ,48184,( *(( 1!49)*() !*8 ( 4""*") @AB@@+,- ,4(1(*88 1!*,! (,*)9 84)19*"9 ( 49)9*(8 8!*",849,9*9 ,48184)9*9 1!4 ,*"! !*)( ( 49,9*," @AB@@+,- ,48 *() 1!*,9 (,9*!! 84)1* ( 4) *8) 8")*9849,*9 ,481849)"*91 1!49("*81 !*"! ( 4))(*) @AB@@+,- ,498*( 1!*" (,*)9 84)1(*8 ( 4,(*, 1! *8"849,(*) ,48184"!*8( 1!49,8*! !*"( ( 4,1*! @AB@@+,- ,4) *!, 81*8" (,*81 84)1(*) ( 4,1"*, 1,(*)"849,(*! ,48184( ,*9 1!4911*9( !*1) ( 4"("*,) @AB@@+,- ,4, (*( 81*8" (,(* 9 84)1(*", ( 4" 1*8 11,*( 849,(*, ,48184!1!*8) 1!4))!*"1 (*9 ( 4 !9*!) @AB@@+,- ,4"",*,! 1!*) (,*8) 84)1(*98 ( 4 "9*) (4!91*!"849,!*18 ,48184!!"*(( 1!4)8*) (*9) ( 4 81*8 @AB@@+,- ,4 ,1*)" 1!*)) (,*88 84)1!*"9 ( 48) *!9 (4!8(*1849,!*9 ,481 41(*9, 1!4,* " !*!, ( 48 "*, @AB@@+,- ,48,9*99 1!*,9 (,*,( 84)81*8) ( 419!*)) (4()*18849)1*)) ,481 489"* 8 1!4,"9*)1 !*)( ( 41"9*(9 @AB@@+,- ,41)8*9" 1!*", (,*8" 84)88*8" (84!()*8" (4("8*,1849)8*)" ,481 4 ,(*(8 1!4"!)* 9 !*91 (84!,!* " @AB@@+,- "4!)(*99 1(*9" (,*! 84)8 *9 (84!1 * (4((*,1849)"*89 ,481 4"" *"( 1!4"),*)9 (*(8 (84(9"*9 @AB@@+,- "4(9"*!( 1*(, (,*8 84)8)*99 (84(8(*( (4,,*9 849)9*19 ,481 4,8*,9 1!4"8"*8" (*9 (849*)) @AB@@+,- "49!* ) 1*(" (,(*,8 84)8!* (84")*1 (411*)8849)!*9 ,481 4)1 *,1 1!4 8*"9 (*9" (849(!*)9 @AB@@+,- "499*89 1*(1 (,(* 84) *) (849)"* 1 (49)9*""8499"*8) ,481 4)()*,9 1!4 !*,( !*(, (8491,*,, @AB@@+,- "4)(8*9) 1* ) (,*,! 84) 9*( (84)9!*) (498 *88499* ,481 491*81 1!48(*9) (*!( (84)8*, @AB@@+,- "4,(9*! 1*(" (,9*,9 84)"1*( (84,()*,) (4)9!* ,8498* ,481 4))*)) 1!48,*1( (*, (84,"1*"8 @AB@@+,- "4"!(*), 1*8 (,9*8( 84)",* ! (84,19* 9 (4)"1*1)849,*9! ,481 4(")*(1 1!4881*88 !*9) (84",(* ) @AB@@+,- "4"9)*!! 1*8 (,9*8( 84)")*)! (84"*1 (4)8)*1849)*!! ,481 4(9)*" 1!41!9*) !*!! (84"8(*18 @AB@@+,- RBDMS JSB 120222 From:Operations Engineer, Doyon 25 To:McLellan, Bryan J (OGC); Loepp, Victoria T (OGC); Rixse, Melvin G (OGC) Cc:Hobbs, Greg S; Gorham, Brad; WSC Rig Advisor; Njoku, Johnson; Davies, Stephen F (OGC) Subject:RE: [EXTERNAL]RE: MT7-06A TOC Sonic Logs Date:Monday, November 14, 2022 12:35:35 PM Attachments:image001.png image002.png Hi Bryan, Here’s a quick summary of the objectives and results for cement coverage on the MT7-06A hydrocarbon bearing zones. It seems we have covered these zones with the required TOC. With regards to the Tusk formation, please see the attached formation tops. The Tusk was not encountered on the well. Objectives for the 9 5/8” Casing Cement Job Objective: Bring TOC to 6504-ft MD (500-ft above Sub Albian 93). Provide Cement for drilling forward/ perform FIT. Acceptance Criteria: Pump cement job without incident and per program (density, rate, volume) Actual Sub Albian 93 Top (see below): 7003.97’ MD Required TOC: 7003.97’ MD – 500’ MD = 6,503.97’ MD Result: Apparent TOC in 9.625” casing: 5,038’ MD This is about 1,965’ MD above the Sub Albian 93 Objectives for the 7” Liner Cement Job Objective: Bring TOC to 11437-ft MD (250-ft TVD above the Alpine D Formation Top) [Plus Additional 20-bbls of cement pumped] Acceptance Criteria: Pump cement job without incident and per program (density, rate, volume) Actual Alpine D Top: 12191.5’ MD / 8273.4’ TVD Required TOC: 11417.2’ MD / 8023.4’ TVD Result: Apparent TOC in 7” liner: 10557’ MD / 7660.08’ TVD This is about 613’ TVD above the Alpine D If you have any further questions or concerns, please let me know. Thanks! Best regards, Doyon 25 Operations Engineer Sydney Deering / Celie Hull / Stephen Fell 25opseng@conocophillips.com MT7-06A As drilled formation tops: The Tusk formation was not encountered on this well. Prognosed As Drilled Formation X Y TVDSS TVD (KB=140.45)MD Well Plan Used Surface Used TVDSS TVD (KB=140.45)MD Perma_Frost 1429954.36 5915563.83 -839.39 979.84 981.70 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A C40 1429944.4 5915575.86 -940.06 1080.51 1083.58 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A C30 1429889.92 5915598.19 -1272.25 1412.70 1421.14 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A C20 1429841.86 5915592.28 -1494.12 1634.57 1648.36 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A C10 1429727.3 5915536.75 -1851.47 1991.92 2028.35 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A K3 1429079.25 5915023.9 -2862.25 3002.70 3347.64 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A SCP 1429033.59 5914986.25 -2912.07 3052.52 3425.00 MT7-06A_wp03 MT7-06 As-Drill Not Drilled In MT7-06A Albian_97 1428593.13 5914588.48 -3468.62 3609.07 4239.47 MT7-06A_wp03 Albian_97_Prog_Mar_2022 -3469.09 3609.54 4227.03 Albian_96 1428443.9 5914455.44 -3657.83 3798.28 4514.87 MT7-06A_wp03 Albian_96_Prog_Mar_2022 -3670.91 3811.36 4535.98 Albian_95 1428259.65 5914309.1 -3855.68 3996.13 4822.30 MT7-06A_wp03 Albian_95_Prog_Mar_2022 -3860.08 4000.53 4827.84 Albian_94 1427842 5913978 -4302.92 4443.37 5518.08 MT7-06A_wp03 Albian_94_Prog_Mar_2022 -4296.77 4437.22 5509.24 Albian_93 1427423.02 5913645.85 -4751.58 4892.03 6216.07 MT7-06A_wp03 Albian_93_Prog_Mar_2022 -4749.42 4889.87 6213.14 Sub_Albian_93 1426946.46 5913268.05 -5261.91 5402.36 7010.00 MT7-06A_wp03 Estimate from MT7-02 as drill -5257 5397.45 7003.97 Albian_92 1426251.29 5912716.94 -6006.32 6146.77 8168.10 MT7-06A_wp03 Albian_92_Prog_Mar_2022 -6004 6144.45 8164.97 Albian_91 1426053.66 5912560.26 -6217.96 6358.41 8497.35 MT7-06A_wp03 Albian_91_Prog_Mar_2022 -6214 6354.45 8490.55 Susitna 1425892.97 5912432.88 -6390.02 6530.47 8765.04 MT7-06A_wp03 HRZ_Prog_Mar_2022plus900feet Not Encountered HRZ 1425148.96 5911697.84 -7275.74 7416.19 10142.75 MT7-06A_wp03 HRZ_Prog_Mar_2022 -7290 7430.45 10164.16 INT1 1425131 5911663.48 -7307.30 7447.75 10192.75 MT7-06A_wp03 HRZ_Prog_Mar_2022+50' MD LCU 1425036.7 5911468.24 -7470.64 7611.09 10464.35 MT7-06A_wp03 LCU_Prog_Mar_2022 -7483.86 7624.31 10489.58 Alpine_D 1424791.74 5909928.67 -8131.88 8272.33 12188.57 MT7-06A_wp03 Alpine_D_Top_Alpine_ERS_Structure_D_MT7_Drilling -8132.95 8273.4 12191.5 INT2 1424800.28 5909881.22 -8145.11 8285.56 12238.57 MT7-06A_wp03 Alpine_D_Top_Alpine_ERS_Structure_D_MT7_Drilling + 50' MD Alpine_C 1424825.95 5909761.59 -8176.87 8317.32 12365.00 MT7-06A_wp03 Alpine_CTop_Alpine_ERS_Structure_D_MT7_Drilling-40 From: McLellan, Bryan J (OGC) <bryan.mclellan@alaska.gov> Sent: Monday, November 14, 2022 10:42 AM To: Operations Engineer, Doyon 25 <Doyon25.OperationsEngineer@conocophillips.com>; Loepp, Victoria T (OGC) <victoria.loepp@alaska.gov>; Rixse, Melvin G (OGC) <melvin.rixse@alaska.gov> Cc: Hobbs, Greg S <Greg.S.Hobbs@conocophillips.com>; Gorham, Brad <Brad.Gorham@conocophillips.com>; WSC Rig Advisor <wscrigadvisor@conocophillips.com>; Njoku, Johnson <Johnson.Njoku@conocophillips.com>; Davies, Stephen F (OGC) <steve.davies@alaska.gov> Subject: [EXTERNAL]RE: MT7-06A TOC Sonic Logs CAUTION:This email originated from outside of the organization. Do not click links or open attachments unless you recognize the sender and know the content is safe. Stephen, I’m filling in for Victoria while she’s away, so just getting up to speed on this well. I agree with Conoco’s assessment of TOC on the 7” and 9-5/8” cement jobs based on the logs. How do these tops compare to the minimum requirements for the well? I noticed the following statement in the approved PTD. Were all hydrocarbon zones isolated? How does TOC compare with tops of significant hydrocarbon zones? Thank you Bryan McLellan Senior Petroleum Engineer Alaska Oil & Gas Conservation Commission 333 W 7th Ave Anchorage, AK 99501 Bryan.mclellan@alaska.gov CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. +1 (907) 250-9193 From: Operations Engineer, Doyon 25 <Doyon25.OperationsEngineer@conocophillips.com> Sent: Friday, November 11, 2022 11:12 AM To: Loepp, Victoria T (OGC) <victoria.loepp@alaska.gov>; Rixse, Melvin G (OGC) <melvin.rixse@alaska.gov>; McLellan, Bryan J (OGC) <bryan.mclellan@alaska.gov> Cc: Hobbs, Greg S <Greg.S.Hobbs@conocophillips.com>; Gorham, Brad <Brad.Gorham@conocophillips.com>; WSC Rig Advisor <wscrigadvisor@conocophillips.com>; Njoku, Johnson <Johnson.Njoku@conocophillips.com> Subject: MT7-06A TOC Sonic Logs Hello, Please see attached for the sonic logs for both the 9-5/8” and 7” cement jobs on MT7-06A. Their TOC’s were 5,038’ MD and 10,557’ MD, respectively, as denoted on the logs. Please let me know if you have any questions. Thank you, Doyon 25 Operations Engineer Celie Hull / Sydney Deering / Stephen Fell 25opseng@conocophillips.com 1 Regg, James B (OGC) From:Rig 25 <rig25@doyondrilling.com> Sent:Saturday, October 22, 2022 4:57 PM To:DOA AOGCC Prudhoe Bay; Regg, James B (OGC); Brooks, Phoebe L (OGC) Cc:Drilling Supervisor, Doyon 25; WSC Rig Advisor; Greg.S.Hobbs@conocophillips.com; Ben Wedin; Bill Walter Subject:D25 7" and 5" rams/annular test Attachments:Doyon 25 10-22-22.xlsx; 10-22-22 test chart 4.5 x 7.pdf Everett Potter Rig 25 Toolpusher rig25@doyondrilling.com 907-670-4971 CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Greater Mooses Tooth Unit MT7-06APTD 2221080 Test of 4.5" x 7" VBR after reintall following 9 5/8"csg run - jbr, 11/25/2022 VBR Test - Doyon 25 GMTU MT7-06A PTD 2221080 10-23-2022 J. Regg; 11/25/2022 From:Regg, James B (OGC) To:AOGCC Records (CED sponsored) Subject:BOP - Doyon 25 Date:Friday, November 25, 2022 1:14:56 PM Attachments:2022-1022_BOP_Doyon25_VBR_GMTU_MT7-06A.pdf GMTU MT7-06A (PTD 2221080) VBR test Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 1 Regg, James B (OGC) From:Rig 25 <rig25@doyondrilling.com> Sent:Saturday, October 29, 2022 7:55 AM To:DOA AOGCC Prudhoe Bay; Regg, James B (OGC); Brooks, Phoebe L (OGC); BLM_AK_AKSO_EnergySection_Notifications@blm.gov Cc:Drilling Supervisor, Doyon 25; Greg.S.Hobbs@conocophillips.com; WSC Rig Advisor; Ben Wedin; Bill Walter; Samuel Dye Subject:Doyon 25 10-28-22 Attachments:Doyon 25 10-28-22.xlsx; Doyon 25 Test Chart 10-28-22.pdf; Doyon 25 10-28-22 Test Sequence.docx CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Test report for 10‐28‐22 attached Roy Fritts Rig 25 Toolpusher rig25@doyondrilling.com 907‐670‐4971 GMTU MT7-06A PTD 2221080 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:25 DATE:10/28/22 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2221080 Sundry # Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:Other:X Rams:250/3500 Annular:250/3500 Valves:250/3500 MASP:2925 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 P Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 4 P Test Fluid Water Inside BOP 2 P FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 13-5/8"x5000psi P Pit Level Indicators P P #1 Rams 1 2-7/8"x5-1/2" VBR P Flow Indicator P P #2 Rams 1 Blind/Shear P Meth Gas Detector P P #3 Rams 1 2-7/8"x5-1/2" VBR P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3-1/8"x5000psi P Time/Pressure Test Result HCR Valves 2 3-1/8"x5000psi P System Pressure (psi)3000 P Kill Line Valves 2 3-1/8"x5000psi P Pressure After Closure (psi)1600 P Check Valve 0 NA 200 psi Attained (sec)35 P BOP Misc 0 NA Full Pressure Attained (sec)188 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:P Quantity Test Result Nitgn. Bottles # & psi (Avg.):6 / 2008 P No. Valves 15 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 23 P #1 Rams 14 P Coiled Tubing Only:#2 Rams 18 P Inside Reel valves 0 NA #3 Rams 15 P #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:5.5 HCR Choke 2 P Repair or replacement of equipment will be made within days. HCR Kill 2 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 10/25/22 05:13 Waived By Test Start Date/Time:10/28/2022 12:00 (date)(time)Witness Test Finish Date/Time:10/28/2022 17:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Austin McLeod Doyon Test Annular, Ram #1 & #3 to 250/3500psi w/ 4" & 5" test joint. Test Ram #2 to 250/3500psi. Test 2 ea 4" & 5" FOSV and 1 ea 4" & 5" Dart Valve. All tests for 5/10 mins. Function primary & remote BOPE control stations. Test LEL & H2S alarms. BLM Notified w/ no response. R. Fritts / C. Bali CPAI J. Benedict / L. Shirley GMTU MT7-06A Test Pressure (psi): rig25@doyondrilling.com d25cm@conocophillips.com Form 10-424 (Revised 08/2022)2022-1028_BOP_Doyon25_GMTU_MT7-06A J. Regg; 11/28/2022 BOPE - Doyon 25 GMTU MT7-06A PTD 2221080 10/28/2022 J, Regg; 11/28/2022 MT7-06 10/28/2022 Tested to 250PSI / 5 MIN, 35OOPSI / 10MIN 5” Test Jt 1.Annular Preventer, Valves: 1, 13, 14, 15, 4” Kill Line Valve, UIBOP 2.Upper Pipe Rams (2.87” x 5.5” ), Valves: 2, 10, 12, HCR KILL & LIBOP 3.Valves: 6, 9 ,11, Manual Kill, 5” Dart Valve 4.Valves 5, 7, 8 & 5” FOSV # 1 5.Valves 3 & 5” FOSV # 2 6.Lower Pipe Rams (2.87” x 5.5” VBR’S) 7.Blind Shear Rams, Valves: 4 & 5” Dart Valve 8.Manually Operated & Super Choke ( 8A = Manual Choke – 8B = Super Choke) 4” Test Jt 9.Annular Preventer, HCR Choke , 5” FOSV # 1 10.Upper Pipe Rams (2.87” x 5.5” VBR’S) & Manual Choke, 5” FOSV # 2 11.Lower Pipe Rams (2.87” x 5.5” VBR’S) Doyon 25 (PTD 2221080) J. Regg; 11/28/2022 From:Regg, James B (OGC) To:AOGCC Records (CED sponsored) Subject:RE: BOP - Doyon 25 - REVISED Date:Monday, November 28, 2022 12:38:43 PM Attachments:2022-1028_BOP_Doyon25_GMTU_MT7-06A.pdf Forgot to attach test charts; revised file attached. Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 From: Regg, James B (OGC) Sent: Monday, November 28, 2022 12:31 PM To: AOGCC Records (CED sponsored) <aogcc.records@alaska.gov> Subject: BOP - Doyon 25 GMTU MT7-06A (PTD 2221080) Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 1 Regg, James B (OGC) From:Rig 25 <rig25@doyondrilling.com> Sent:Saturday, October 29, 2022 7:55 AM To:DOA AOGCC Prudhoe Bay; Regg, James B (OGC); Brooks, Phoebe L (OGC); BLM_AK_AKSO_EnergySection_Notifications@blm.gov Cc:Drilling Supervisor, Doyon 25; Greg.S.Hobbs@conocophillips.com; WSC Rig Advisor; Ben Wedin; Bill Walter; Samuel Dye Subject:Doyon 25 10-28-22 Attachments:Doyon 25 10-28-22.xlsx; Doyon 25 Test Chart 10-28-22.pdf; Doyon 25 10-28-22 Test Sequence.docx CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. Test report for 10‐28‐22 attached Roy Fritts Rig 25 Toolpusher rig25@doyondrilling.com 907‐670‐4971 GMTU MT7-06A PTD 2221080 STATE OF ALASKA OIL AND GAS CONSERVATION COMMISSION *All BOPE reports are due to the agency within 5 days of testing* Submit to:jim.regg@alaska.gov; AOGCC.Inspectors@alaska.gov; phoebe.brooks@alaska.gov Rig Owner:Rig No.:25 DATE:10/28/22 Rig Rep.:Rig Email: Operator: Operator Rep.:Op. Rep Email: Well Name:PTD #2221080 Sundry # Operation:Drilling:X Workover:Explor.: Test:Initial:Weekly:Bi-Weekly:Other:X Rams:250/3500 Annular:250/3500 Valves:250/3500 MASP:2925 MISC. INSPECTIONS:TEST DATA FLOOR SAFETY VALVES: Test Result/Type Test Result Quantity Test Result Housekeeping P Well Sign P Upper Kelly 1 P Permit On Location P Hazard Sec.P Lower Kelly 1 P Standing Order Posted P Misc.NA Ball Type 4 P Test Fluid Water Inside BOP 2 P FSV Misc 0 NA BOP STACK:Quantity Size/Type Test Result MUD SYSTEM:Visual Alarm Stripper 0 NA Trip Tank P P Annular Preventer 1 13-5/8"x5000psi P Pit Level Indicators P P #1 Rams 1 2-7/8"x5-1/2" VBR P Flow Indicator P P #2 Rams 1 Blind/Shear P Meth Gas Detector P P #3 Rams 1 2-7/8"x5-1/2" VBR P H2S Gas Detector P P #4 Rams 0 NA MS Misc 0 NA #5 Rams 0 NA #6 Rams 0 NA ACCUMULATOR SYSTEM: Choke Ln. Valves 1 3-1/8"x5000psi P Time/Pressure Test Result HCR Valves 2 3-1/8"x5000psi P System Pressure (psi)3000 P Kill Line Valves 2 3-1/8"x5000psi P Pressure After Closure (psi)1600 P Check Valve 0 NA 200 psi Attained (sec)35 P BOP Misc 0 NA Full Pressure Attained (sec)188 P Blind Switch Covers:All stations Yes CHOKE MANIFOLD:Bottle Precharge:P Quantity Test Result Nitgn. Bottles # & psi (Avg.):6 / 2008 P No. Valves 15 P ACC Misc 0 NA Manual Chokes 1 P Hydraulic Chokes 1 P Control System Response Time:Time (sec)Test Result CH Misc 0 NA Annular Preventer 23 P #1 Rams 14 P Coiled Tubing Only:#2 Rams 18 P Inside Reel valves 0 NA #3 Rams 15 P #4 Rams 0 NA Test Results #5 Rams 0 NA #6 Rams 0 NA Number of Failures:0 Test Time:5.5 HCR Choke 2 P Repair or replacement of equipment will be made within days. HCR Kill 2 P Remarks: AOGCC Inspection 24 hr Notice Yes Date/Time 10/25/22 05:13 Waived By Test Start Date/Time:10/28/2022 12:00 (date)(time)Witness Test Finish Date/Time:10/28/2022 17:30 BOPE Test Report Notify the AOGCC of repairs with written confirmation to: AOGCC.Inspectors@alaska.gov Austin McLeod Doyon Test Annular, Ram #1 & #3 to 250/3500psi w/ 4" & 5" test joint. Test Ram #2 to 250/3500psi. Test 2 ea 4" & 5" FOSV and 1 ea 4" & 5" Dart Valve. All tests for 5/10 mins. Function primary & remote BOPE control stations. Test LEL & H2S alarms. BLM Notified w/ no response. R. Fritts / C. Bali CPAI J.Benedict / L. Shirley GMTU MT7-06A Test Pressure (psi): rig25@doyondrilling.com d25cm@conocophillips.com Form 10-424 (Revised 08/2022)2022-1028_BOP_Doyon25_GMTU_MT7-06A J. Regg; 11/28/2022 From:Regg, James B (OGC) To:AOGCC Records (CED sponsored) Subject:BOP - Doyon 25 Date:Monday, November 28, 2022 12:32:03 PM Attachments:2022-1028_BOP_Doyon25_GMTU_MT7-06A.pdf GMTU MT7-06A (PTD 2221080) Jim Regg Supervisor, Inspections AOGCC 333 W. 7th Ave, Suite 100 Anchorage, AK 99501 907-793-1236 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov Chris Brillon Drilling Manager ConocoPhillips Alaska, Inc. PO Box 100360 Anchorage, AK 99510-0360 Re: Greater Mooses Tooth Field, Rendezvous Pool, MT7-06A ConocoPhillips Alaska, Inc. Permit to Drill Number: 222-108 Surface Location: 968' FSL, 1859' FWL, SESW, Sec. 32, T1ON, R2E, UM Bottomhole Location: 1070' FSL, 4554' FWL, SESW, Sec. 20, T9N, R2E, UM Dear Mr. Brillon: Enclosed is the approved application for the permit to drill the above referenced well. Per Statute AS 31.05.030(d)(2)(B) and Regulation 20 AAC 25.071,composite curves for all well logs run must be submitted to the AOGCC within 90 days after completion, suspension, or abandonment of this well, or within 90 days of acquisition of the data, whichever occurs first. This permit to drill does not exempt you from obtaining additional permits or an approval required by law from other governmental agencies and does not authorize conducting drilling operations until all other required permits and approvals have been issued. In addition, the AOGCC reserves the right to withdraw the permit in the event it was erroneously issued. Operations must be conducted in accordance with AS 31.05 and Title 20, Chapter 25 of the Alaska Administrative Code unless the AOGCC specifically authorizes a variance. Failure to comply with an applicable provision of AS 31.05, Title 20, Chapter 25 of the Alaska Administrative Code, or an AOGCC order, or the terms and conditions of this permit may result in the revocation or suspension of the permit. Sincerely, Jeremy M. Price Chair DATED this ___ day of August, 2022. Jeremy Price Digitally signed by Jeremy Price Date: 2022.08.29 13:12:15 -08'00' D7\SHRI:RUN E3URSRVHG:HOO&ODVV ([SORUDWRU\*DV 6HUYLFH:$* 6HUYLFH'LVS F6SHFLI\LIZHOOLVSURSRVHGIRU 'ULOO /DWHUDO 6WUDWLJUDSKLF7HVW 'HYHORSPHQW2LO 6HUYLFH:LQM 6LQJOH=RQH &RDOEHG*DV *DV+\GUDWHV 5HGULOO 5HHQWU\ ([SORUDWRU\2LO 'HYHORSPHQW*DV 6HUYLFH6XSSO\ 0XOWLSOH=RQH *HRWKHUPDO 6KDOH*DV 2SHUDWRU1DPH %RQG %ODQNHW 6LQJOH:HOO :HOO1DPHDQG1XPEHU %RQG1R $GGUHVV 3URSRVHG'HSWK )LHOG3RRO V 0' 79' D/RFDWLRQRI:HOO *RYHUQPHQWDO6HFWLRQ 3URSHUW\'HVLJQDWLRQ 6XUIDFH 7RSRI3URGXFWLYH+RUL]RQ '15$SSURYDO1XPEHU $SSUR[LPDWH6SXG'DWH 7RWDO'HSWK $FUHVLQ3URSHUW\ 'LVWDQFHWR1HDUHVW3URSHUW\ WR$$ E/RFDWLRQRI:HOO 6WDWH%DVH3ODQH&RRUGLQDWHV1$' .%(OHYDWLRQDERYH06/ IW 'LVWDQFHWR1HDUHVW:HOO2SHQ 6XUIDFH [ \ =RQH WR6DPH3RRO WR07 'HYLDWHGZHOOV .LFNRIIGHSWK IHHW 0D[LPXP3RWHQWLDO3UHVVXUHVLQSVLJ VHH$$& 0D[LPXP+ROH$QJOH GHJUHHV 'RZQKROH 6XUIDFH +ROH &DVLQJ :HLJKW *UDGH &RXSOLQJ /HQJWK 0' 79' 0' 79' / +\G [ / +\G / +\G 35(6(17:(//&21',7,216800$5< 7REHFRPSOHWHGIRU5HGULOODQG5H(QWU\2SHUDWLRQV -XQN PHDVXUHG 79' +\GUDXOLF)UDFWXUHSODQQHG"<HV 1R $WWDFKPHQWV 3URSHUW\3ODW %236NHWFK 'ULOOLQJ3URJUDP 7LPHY'HSWK3ORW 6KDOORZ+D]DUG$QDO\VLV 'LYHUWHU6NHWFK 6HDEHG5HSRUW 'ULOOLQJ)OXLG3URJUDP $$&UHTXLUHPHQWV &RQWDFW1DPH %UDG*RUKDP &KULV%ULOORQ &RQWDFW(PDLO %UDG*RUKDP#FRQRFRSKLOOLSVFRP :HOOV(QJLQHHULQJ0DQDJHU &RQWDFW3KRQH 'DWH 3HUPLWWR'ULOO $3,1XPEHU 3HUPLW$SSURYDO 1XPEHU 'DWH &RQGLWLRQVRIDSSURYDO ,IER[LVFKHFNHGZHOOPD\QRWEHXVHGWRH[SORUHIRUWHVWRUSURGXFHFRDOEHGPHWKDQHJDVK\GUDWHVRUJDVFRQWDLQHGLQVKDOHV 6DPSOHVUHT G <HV1R 0XGORJUHT G <HV1R +6PHDVXUHV <HV1R 'LUHFWLRQDOVY\UHT G <HV1R 6SDFLQJH[FHSWLRQUHT G <HV1R ,QFOLQDWLRQRQO\VY\UHT G <HV1R 3RVWLQLWLDOLQMHFWLRQ0,7UHT G <HV1R $33529('%< $SSURYHGE\ &200,66,21(5 7+(&200,66,21 'DWH &RPP &RPP 6U3HW(QJ 6U3HW*HR 6U5HV(QJ ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEH GHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURYDO 6XUIDFH 3HUIRUDWLRQ'HSWK79' IW */%)(OHYDWLRQDERYH06/ IW 3HUIRUDWLRQ'HSWK0' IW V[SSJ&ODVV* 8QFHPHQWHGOLQHUZIUDFVOHHYHV VZHOO SDFNHUV \DUGV /HDG EEOVRISSJ'HHS&UHWH 7DLO EEOVRISSJ&ODVV* (IIHFW'HSWK0' IW (IIHFW'HSWK79' IW $XWKRUL]HG7LWOH $XWKRUL]HG6LJQDWXUH 3URGXFWLRQ /LQHU ,QWHUPHGLDWH $XWKRUL]HG1DPH &RQGXFWRU6WUXFWXUDO /HQJWK&DVLQJ &HPHQW9ROXPH 0'6L]H 3OXJV PHDVXUHG LQFOXGLQJVWDJHGDWD &DVLQJ3URJUDP 7RS6HWWLQJ'HSWK%RWWRP6SHFLILFDWLRQV 7RWDO'HSWK0' IW 7RWDO'HSWK79' IW 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 3(50,772'5,// $$& V[SSJ&ODVV* V[H[W&ODVV* )6/ ):/6(6:67 15(80 )6/ ):/6(6:6715(80 32%R[$QFKRUDJH$ODVND &RQRFR3KLOOLSV )6/ ):/6(6:6715($$$$$$ 07$ *UHDWHU0RRVHV7RRWK 5HQGH]YRXV &HPHQW4XDQWLW\FIRUVDFNV &RPPLVVLRQ8VH2QO\ 6HHFRYHUOHWWHUIRURWKHU UHTXLUHPHQWV EEOVRI&ODVV* V1 \SHRI: / O 5 / E 6 &ODVV RV1 V1R V1 R 'V V V ' R ZHOOLVS * 6 6 66 6 V1RV1R 6 * \( 6 V1R V )RUP5HYLVHG7KLVSHUPLWLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDOSHU$$& J By Samantha Carlisle at 10:04 am, Aug 16, 2022 '/% 97/ ;; ;; ; ; '65 ; 6 7 1 5( ; ,QLWLDO %23 WHVW WR SVLJ VXEVHTXHQW WHVW WR SVLJ $QQXODU SUHYHQWHU WHVW WR SVLJ :DLYHU IRU &3$, 5RWDU\ 5LJ %23( 7HVW )UHTXHQF\ DSSOLHV DFFRUGLQJ WR RUGHU 27+ DWWDFKHG '/% ; dts 8/29/2022 8/29/22 Jeremy Price Digitally signed by Jeremy Price Date: 2022.08.29 13:12:02 -08'00' 333 West Seventh Avenue Anchorage, Alaska 99501-3572 Main: 907.279.1433 Fax: 907.276.7542 www.aogcc.alaska.gov -DQXDU\ &(57,),('0$,/± 5(78515(&(,375(48(67(' 0U/XNH/DZUHQFH :HOOV0DQDJHU &RQRFR3KLOOLSV$ODVND *6WUHHW $QFKRUDJH$. 5H 'RFNHW1XPEHU 27+ $SSOLFDWLRQIRU:DLYHURQ&3$,5RWDU\ 5LJ%23(7HVW)UHTXHQF\ 'HDU0U/DZUHQFH %\OHWWHUGDWHG0D\&RQRFR3KLOOLSV$ODVND,QF &3$, UHTXHVWHGDZDLYHUIURPWKH $ODVND 2LO DQG *DV &RQVHUYDWLRQ &RPPLVVLRQ¶V $2*&& UHJXODWRU\ UHTXLUHG EORZRXW SUHYHQWLRQHTXLSPHQW %23( WHVWIUHTXHQF\IRUDOO&3$,URWDU\GULOOLQJULJVSHWLWLRQLQJWRWHVW WKHEORZRXWSUHYHQWLRQHTXLSPHQW %23( RQDGD\WHVWVFKHGXOH$2*&&JUDQWVDSSURYDO IRUOLPLWHGGXUDWLRQDQGVFRSH &3$,PHWZLWK$2*&&RQ$SULOVXPPDUL]HGLWVREMHFWLYHLQUHTXHVWLQJDSSURYDORID GD\%23(WHVWVFKHGXOH LPSURYH&3$,¶VDELOLW\WRFRPSHWHIRUFRUSRUDWH FDSLWDOLQYHVWPHQWV H[SODLQHGDOLJQPHQWZLWKLQGXVWU\VWDQGDUG%23(WHVWFULWHULD DQG&RQRFR3KLOOLSVJOREDOZHOO FRQWUROSROLF\DQGSURYLGHGDQRYHUYLHZRIQHZGULOOLQJWDUJHWVSODQQHGXVLQJD³KLJKVSHF H[WHQGHGUHDFKGULOOLQJULJ´&3$,DOVRSURYLGHGGHWDLOVDERXWWKHVFRSHDQG%23(SHUIRUPDQFH DFKLHYHPHQWV XQGHU LWV %HWZHHQ :HOO 0DLQWHQDQFH 3URJUDP %:0 IRU URWDU\ GULOOLQJ DQG ZRUNRYHUULJV $VZLWKSUHYLRXVUHTXHVWVWRH[WHQGWKH%23(WHVWLQWHUYDO&3$,UHIHUHQFHVQXPHURXVUHJXODWRU\ MXULVGLFWLRQVDVZHOODVVXJJHVWHGLQGXVWU\SUDFWLFHIURPWKH$PHULFDQ3HWUROHXP,QVWLWXWHUHODWLQJ WR WHVW IUHTXHQF\ HDFK SURYLGLQJIRU %23( WHVWLQJ DW LQWHUYDOV EH\RQG GD\V &3$, DOVR UHIHUHQFHVLWVLQWHUQDOZHOOFRQWUROPDQXDOZKLFKDOORZVIRUWHVWLQJDWLQWHUYDOVEH\RQGGD\V ϭW/^ƚĂŶĚĂƌĚϱϯ͕͞tĞůůŽŶƚƌŽů ƋƵŝƉŵĞŶƚ^LJƐƚĞŵƐĨŽƌƌŝůůŝŶŐtĞůůƐ͕͟ϱƚŚ ĚŝƚŝŽŶ;ĞĐĞŵďĞƌϮϬϭϴͿ ϮK'ĂƉƉƌŽǀĂůŽĨƚŚĞtDƉƌŽŐƌĂŵŚĂƐĞŶĂďůĞĚW/ǁŽƌŬŽǀĞƌƌŝŐƐƚŽĞdžƚĞŶĚƚŚĞŝŶƚĞƌǀĂůďĞƚǁĞĞŶKW ƚĞƐƚƐ ĨƌŽŵĞǀĞƌLJϳĚĂLJƐƚŽŶŽƚĞdžĐĞĞĚŝŶŐϭϰĚĂLJƐ͘W/ĚĂƚĂƐŚŽǁƐƚŚĞtDŚĂƐƌĞĚƵĐĞĚƚŚĞŶƵŵďĞƌŽĨĐŽŵƉŽŶĞŶƚ ĨĂŝůƵƌĞƐĚƵƌŝŶŐKW ƚĞƐƚŝŶŐďLJƌĞƉůĂĐŝŶŐĐŽŵƉŽŶĞŶƚƐƚŚĂƚŝŶĚŝĐĂƚĞƐƵƐƉĞĐƚŝŶƚĞŐƌŝƚLJďĞĨŽƌĞƚŚŽƐĞĐŽŵƉŽŶĞŶƚƐĨĂŝů ĚƵƌŝŶŐƚĞƐƚŝŶŐ͘ 'RFNHW1XPEHU 27+ &3$,±GD\%23(7HVW,QWHUYDO -DQXDU\ ,PSURYHPHQW LQ %23( SHUIRUPDQFH WHVWLQJ UHVXOWV DWWULEXWHG WR &3$,¶V %:0 SURJUDP LV UHFRJQL]HG&3$,LVFRPPHQGHGIRULPSOHPHQWLQJWKHSURJUDPDQGZLWK$2*&&DSSURYDO&3$, ZRUNRYHUULJV KDYHEHHQDXWKRUL]HGWRWHVW %23( DWLQWHUYDOVXSWR GD\V$2*&&UHFRJQL]HV WKHFRPSOH[GULOOLQJSURJUDPVWKDWKDYHEHHQLQLWLDWHGE\&3$,WRWDUJHWFKDOOHQJLQJUHVRXUFHV ZKLOHPDLQWDLQLQJDVPDOOHQYLURQPHQWDOIRRWSULQWDQGWKHFRPPLWPHQWWRXVHUREXVWGULOOLQJULJV DQGFUHZVWRSHUIRUPWKRVHSURMHFWVLQDVDIHDQGHIILFLHQWPDQQHU,QUHVSRQVHWRWKHVHFKDOOHQJHV DQG WKH FRPPLWPHQWV E\ &3$, LQFOXGLQJ LPSOHPHQWDWLRQ RI WKH %:0 SURJUDP $2*&& FRQGLWLRQDOO\DSSURYHG'R\RQ5LJWRWHVW%23(RQDQHYHQWEDVLVLQVWHDGRIDWVSHFLILFWLPH LQWHUYDOVZKLOHGULOOLQJVSHFLILFLQWHUYDOV LQDQXOWUDH[WHQGHGUHDFKZHOO &3$,¶VUHTXHVWIRUD YDULDQFHIURPUHJXODWRU\UHTXLUHPHQWV RI$$& H $ LV DSSURYHGIRUGULOOLQJULJV'R\RQDQG'R\RQDVDSLORWSURMHFWZLWKWKHIROORZLQJFRQGLWLRQV 7KHSLORWWHVWGXUDWLRQLVIRU21( \HDU IURPWKHDSSURYDOGDWHRIWKLVOHWWHUVXEMHFWWR SRWHQWLDOH[WHQVLRQDQG H[SDQVLRQWRLQFOXGHRWKHU&3$,RSHUDWHGULJVZLWK DWOHDVW PRQWKVRIFRQWLQXRXVULJZRUNDQG$2*&&UHYLHZRIDULJ¶V%23(V\VWHPUHOLDELOLW\ &3$,PXVWFRQWLQXHWRLPSOHPHQWWKH%:0SURJUDPDVDSSURYHGE\$2*&& 'HYHORSPHQWGULOOLQJZHOOVRQO\DUHLQFOXGHGLQWKLVDSSURYDO 7KHLQLWLDOWHVWDIWHUULJJLQJXS%23(WRGULOODZHOOPXVWEHWRWKHUDWHGZRUNLQJSUHVVXUH DVSURYLGHGLQ$3,6WDQGDUG &3$,LVHQFRXUDJHGWRWDNHDGYDQWDJHRIRSSRUWXQLWLHVWRWHVW5LJVPXVWWHVWEHIRUH UHHQWHULQJWKHZHOOLIDWULSWRVXUIDFHRFFXUVZLWKLQGD\VRIWKHGXHGDWHXQOHVVRWKHUZLVH DSSURYHGE\$2*&& &3$,PXVWDGKHUHWRRULJLQDOHTXLSPHQWPDQXIDFWXUHUUHFRPPHQGDWLRQVDQGUHSODFHPHQW SDUWVIRU%23( 5HTXHVWV IRU H[WHQVLRQV EH\RQG GD\V PXVW LQFOXGH MXVWLILFDWLRQ ZLWK VXSSRUWLQJ LQIRUPDWLRQGHPRQVWUDWLQJWKHDGGLWLRQDOWLPHLVQHFHVVDU\IRUZHOOFRQWUROSXUSRVHVRUWR PLWLJDWHDVWXFNGULOOVWULQJ KRXUDGYDQFHQRWLFHIRUD%23(WHVWVKDOOEHSURYLGHGWR$2*&&IRURSSRUWXQLW\WR ZLWQHVV ,I\RXKDYH TXHVWLRQVUHJDUGLQJWKLV SOHDVH FRQWDFW-LP5HJJ DW 6LQFHUHO\ -HUHP\0 3ULFH &KDLU&RPPLVVLRQHU FF *UHJ+REEV &3$, 0LNH.QHDOH &3$, 9LFWRULD/RHSS $2*&& $2*&&,QVSHFWRUV HPDLO Jeremy Price Digitally signed by Jeremy Price Date: 2022.01.25 13:00:50 -09'00' &RQRFR3KLOOLSV$ODVND,QF 3RVW2IILFH%R[ $QFKRUDJH$ODVND 7HOHSKRQH $XJXVW $ODVND2LODQG*DV&RQVHUYDWLRQ&RPPLVVLRQ :HVWWK$YHQXH6XLWH $QFKRUDJH$ODVND 5H $SSOLFDWLRQIRU3HUPLWWR'ULOO 'HDU6LURU0DGDP &RQRFR3KLOOLSV$ODVND,QFKHUHE\DSSOLHVIRUD3HUPLWWR'ULOODQRQVKRUH$OSLQH&6DQGSURGXFHUZHOOIURPWKH07 GULOOLQJSDG7KHLQWHQGHGVSXGGDWHIRUWKLVZHOOLV,WLVLQWHQGHGWKDW'R\RQEHXVHGWRGULOOWKHZHOO 07DOUHDG\KDV´FDVLQJLQVWDOOHGDQGWKHVLGHWUDFNZLOOEHUHGULOOHGE\NLFNLQJRXWMXVWEHORZWKHH[LVWLQJ´ VXUIDFFDVLQJ7KH´LQWHUPHGLDWHKROHZLOOEHGULOOHGWRWKHWRSRIWKH+5=IRUPDWLRQ$ ´FDVLQJVWULQJZLOOEHUXQ DQGFHPHQWHGLQSODFHZLWKD¶0'RU¶79'FROXPQRIFHPHQW DERYHWKHKLJKHVWK\GURFDUERQEHDULQJ]RQH,IDQ DGGLWLRQDOK\GURFDUERQ]RQHLVSUHVHQWDQGVWDJHFHPHQWMREZLOOEHSHUIRUPHGWRFRYHU¶79'DERYHDQGEHORZWKH LQWHUYDO7KH´[ ´XQGHUUHDPHGLQWHUPHGLDWHVHFWLRQZLOOEHGULOOHGDQGODQGHGLQWKH$OSLQH'$´OLQHUVWULQJ ZLOOEHVHWDQGFHPHQWHGIURP7'WRVHFXUHWKHVKRHDQGFRYHU¶0'RU¶79'DERYHDQ\K\GURFDUERQEHDULQJ]RQHV 7KHSURGXFWLRQLQWHUYDOZLOOEHFRPSULVHGRID´[´KRUL]RQWDOKROHWKDWZLOOEHJHRVWHHUHGLQWKH$OSLQH&VDQG 7KHZHOOZLOOEHFRPSOHWHGDVDQSURGXFHUZLWK´XQFHPHQWHGOLQHUZLWKIUDFVOHHYHVDQGVZHOOSDFNHUV7KHXSSHU FRPSOHWLRQZLOOLQFXGHDSURGXFWLRQSDFNHUZLWK*/0¶VDQGWLHGEDFNWRVXUIDFH ,WLVUHTXHVWHGWKDWDYDULDQFHRIWKHGLYHUWHUUHTXLUHPHQWXQGHU$$& K LVJUDQWHG$W07WKHUHKDV QRWEHHQDVLJQLILFDQWLQGLFDWLRQRIVKDOORZJDVRUJDVK\GUDWHVWKURXJKWKHVXUIDFHKROHLQWHUYDO 3OHDVHILQGDWWDFKHGWKHLQIRUPDWLRQUHTXLUHGE\$&& D DQG F IRU\RXUUHYLHZ3HUWLQHQWLQIRUPDWLRQ DWWDFKHGWRWKLVDSSOLFDWLRQLQFOXGHVWKHIROORZLQJ )RUP$33/,&$7,21)253HUPLWWR'ULOOSHU$&& D $SURSRVHGGULOOLQJSURJUDP $SURSRVHGFRPSOHWLRQGLDJUDP $GULOOLQJIOXLGVSURJUDPVXPPDU\ 3UHVVXUHLQIRUPDWLRQDVUHTXLUHGE\$&& G 'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFHLQIRUPDWLRQDVUHTXLUHGE\$&& E ,QIRUPDWLRQSHUWLQHQWWRWKHDSSOLFDWLRQWKDWLVSUHVHQWO\RQILOHDWWKH$2*&& 'LDJUDPVRIWKH%23HTXLSPHQWGLYHUWHUHTXLSPHQWDQGFKRNHPDQLIROGOD\RXWDVUHTXLUHGE\$&& D DQG E $GHVFULSWLRQRIWKHGULOOLQJIOXLGVKDQGOLQJV\VWHP 'LDJUDPRIULVHUVHWXS ,I\RXKDYHDQ\TXHVWLRQVRUUHTXLUHIXUWKHULQIRUPDWLRQSOHDVHFRQWDFW1LQD$QGHUVRQDW %UDG*RUKDP#FRQRFRSKLOOLSVFRPRU&KULV%ULOORQDW FKULVOEULOORQ#FRQRFRSKLOOLSVFRP 6LQFHUHO\FF 07 :HOO)LOH-HQQD7D\ORU $72 'DYH/HH$72 %UDG*RUKDP &KULV%ULOORQ $72 'ULOOLQJ(QJLQHHU $QG\0DFN .XXNSLN&RUS QRWEHHQDVLJQLILFDQWLQGLFDWLRQRIVKDOORZJDVRUJDVK\GUDWHVWKURXJKWKHVXUIDFHKROHLQWHUYDO ,WLVUHTXHVWHGWKDWDYDULDQFHRIWKHGLYHUWHUUHTXLUHPHQWXQGHU$$& K LVJUDQWHG$W07WKHUHKDVTT J &RQFXU '/% 'LYHUWHU QRW UHTXLUHG RQ WKLV VLGHWUDFN 97/ 07$ $JXXVWWK MT7-06A Page 1 of 14 07$:HOO3ODQ Application for Permit to Drill 7DEOHRI&RQWHQWV .................................................................................................................................................................. :HOO1DPH(Requirements of 20 AAC 25.005 (f)) /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) 3URSRVHG'ULOOLQJ3URJUDP 'LYHUWHUDQG%23,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) 0$63&DOFXODWLRQV 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV(Requirements of 20 AAC 25.005 ©(5)) &DVLQJDQG&HPHQWLQJ3URJUDP 'ULOOLQJ)OXLG3URJUDP Requirements of 20 AAC 25.005(c)(8)) $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) 'ULOOLQJ+D]DUGV6XPPDU\ 07$3URSRVHG,QMHFWLRQ&RPSOHWLRQ6FKHPDWLF 07$ $JXXVWWK MT7-06A Page 2 of 14 :HOO1DPH(Requirements of 20 AAC 25.005 (f)) 7KHZHOOIRUZKLFKWKLVDSSOLFDWLRQLVVXEPLWWHGZLOOEHGHVLJQDWHGDV07$ /RFDWLRQ6XPPDU\(Requirements of 20 AAC 25.005(c)(2)) /RFDWLRQDW6XUIDFH µ)6/ ):/6(6:6715(80 NAD 1927 Northings: 5915791 Eastings: 289937 RKB Elevation ¶$06/ Pad Elevation ¶$06/ 7RSRI3URGXFWLYH+RUL]RQ +HHO )6/ ):/6(6:67 15(80 NAD 1927 Northings: 5909892 Eastings: 1424798 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ 7RWDO'HSWK 7RH )6/ ):/6(6:6715(80 NAD 1927 Northings: 5895976 Eastings: 1431351 Measured Depth, RKB: ¶ Total Vertical Depth, RKB: ¶ Total Vertical Depth, SS: ¶ 3OHDVHVHHDWWDFKHGZHOOVWLFNGLDJUDPIRUWKHFXUUHQWSODQQHGGHYHORSPHQWRIWKHSDG 5(6 7 1 '/% 07$ $JXXVWWK MT7-06A Page 3 of 14 MT7 Pad Layout MT7 Pad Well Stick Diagram 07$ $JXXVWWK MT7-06A Page 4 of 14 MT7-06A PTD Plat 07$ $JXXVWWK MT7-06A Page 5 of 14 3URSRVHG'ULOOLQJ3URJUDP 0,58'R\RQRQWR07 ,QVWDOODQGWHVW%23(ZLWKWKHIROORZLQJHTXLSPHQWFRQILJXUDWLRQ ´DQQXODUSUHYHQWHU´[´ 9%5EOLQGUDPDQG´[´9%5 7HVW%23(WRSVLORZSVLKLJK KUUHJXODWRU\QRWLFH )RUUHHQWHU DEDQGRQPHQWRSHUDWLRQVVHH07VXQGU\ 3XOODQGOD\GRZQ´WXELQJ &XWDQGSXOO´FDVLQJ 3XPSFHPHQWNLFNRIISOXJ 6WDUWRI07$3HUPLWWR'ULOO 3LFNXSDQGUXQLQWKHKROHZLWK´GULOOLQJ%+$WRGULOOLQWHUPHGLDWH 'LVSODFHZHOOWR33*/61':%0 'ULOO´KROHWRWKHFDVLQJSRLQW &LUFXODWHZHOOERUHFOHDQDQG322+ &KDQJHXSSHU9%5VWR ´VROLGERG\UDPV7HVWVDPHWRSVLORZSVLKLJK 5XQ ´LQWHUPHGLDWHFDVLQJWR7' 3XPSVLQJOHVWDJHFHPHQWMREWRLVRODWHWKHFDVLQJVKRHRU¶0'DERYHXSSHUPRVWK\GURFDUERQEHDULQJ ]RQH1RWHWKDWDVKDOORZHUK\GURFDUERQEHDULQJVDQGPD\EHHQFRXQWHUHGDQGDQGVWDJHFHPHQWMREZLOOEH FRPSOHWHGLIWKHRQHLVGHWHFWHGZKLOHGULOOLQJ5HVXOWVRIWKHFHPHQWRSHUDWLRQZLOOEHVXEPLWWHGDVVRRQDV SRVVLEOH D7KHUHLVSRWHQWLDOIRUWKHSUHVHQFHRIWKH7XVNVDQGZKLFKPD\EHK\GURFDUERQEHDULQJDQGUHTXLUHD VHFRQGVWDJHFHPHQWMREWRSODFHFHPHQW¶79'DERYHDQGEHORZWKHLQWHUYDO7KHUHTXLUHG HTXLSPHQWDQGFHPHQWSODQVDUHSUHSDUHGLIWKLVEHFRPHVQHFHVVDU\ &KDQJHXSSHU ´VROLGERG\UDPVWR´[´9%5V7HVW%23(WRSVL KUUHJXODWRU\ QRWLFH 3LFNXSDQGUXQLQWKHKROHZLWK[ ´GULOOLQJ%+$WRGULOOLQWHUPHGLDWH6LP2SVSHUIRUP DQQXOXV/27IOXVKDQGIUHH]HSURWHFWZLWKWKH%DOOPLOO &KDUWFDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHV 'ULOORXWVKRHWUDFNDQG¶RIQHZKROH 3HUIRUP),7WRSSJ(0:0LQLPXPUHTXLUHGWRGULOODKHDGLVSSJ(0: 'LVSODFHZHOOWR33*9HUVDFOHDQ2%0V\VWHP 'ULOO[ ´KROHWRVHFWLRQ7' $$VDQLGHQWLILHGFRQWLQJHQF\SODQ ,I&DVLQJ'ULOOLQJLVUHTXLUHGGXHWR*HRORJLF,QVWDELOLW\LQ ,QWHUPHGLDWHVHFWLRQUHIHUWREHORZVWHSV 3LFNXSDQGUXQLQWKHKROHZLWKWKH´VWHHUDEOHGULOOLQJOLQHU3LFNXSDQGVWDELQ´SLORW%+$ DVVHPEO\ /:'3URJUDP *55(6 5,+WRERWWRPZLWK´6'/RQ´GULOOSLSH 'ULOO´6'/KROHWRSURGXFWLRQFDVLQJSRLQWLQWRWKH$OSLQH&VDQGXVLQJ0DQDJHG3UHVVXUH 'ULOOLQJWRPDLQWDLQFRQVWDQWERWWRPKROHSUHVVXUHRQFRQQHFWLRQV /:'3URJUDP *55(6 /DQG´OLQHUDW7''LVFRQQHFW6'/DQG322+WRVXUIDFHZLWKLQQHUVWULQJDQGSLORW 5XQLQKROHZLWKLQQHUVWULQJFHPHQWLQJ%+$6WDELQWROLQHU&LUFXODWHDQGFRQGLWLRQPXGLQ SUHSDUDWLRQVIRUFHPHQWLQJ 07$ $JXXVWWK MT7-06A Page 6 of 14 &HPHQW´OLQHUWRWRSRIOLQHU6HWOLQHUWRSSDFNHU&LUFXODWHH[FHVVFHPHQWIURPWRSRIOLQHU 322+OD\LQJGRZQ´GULOOSLSH &RQWLQXHWR6WHSEHORZ &LUFXODWHZHOOERUHFOHDQDQG322+ 3LFNXSDQGUXQLQWKHKROHZLWKWKH´OLQHURQ´'3WRVHFWLRQ7' &LUFXODWHDQGFRQGLWLRQPXGLQSUHSDUDWLRQVIRUFHPHQWLQJ &HPHQW´OLQHUWRUHTXLUHG72&6HWOLQHUWRSSDFNHU&LUFXODWHH[FHVVFHPHQWIURPWRSRIOLQHU322+OD\LQJ GRZQ´GULOOSLSH5HVXOWVRIWKHFHPHQWRSHUDWLRQZLOOEHVXEPLWWHGDVVRRQDVSRVVLEOH &KDQJHRXWXSSHUUDPVWR´[´9%5V7HVWVDPHWRSVLORZSVLKLJK 3LFNXS´'37HVW%23(WRSVLORZSVLKLJK KUUHJXODWRU\QRWLFH 3LFNXSDQG5,+ZLWK´GULOOLQJDVVHPEO\ /:'3URJUDP *5$]LPXWKDO5(6 &KDUWFDVLQJSUHVVXUHWHVWWRSVLIRUPLQXWHVDQGUHFRUGUHVXOWV 'ULOORXWDQGSHUIRUP),7WR33*(0:PD[LPXP0LQLPXPDFFHSWDEOHOHDNRIIIRUGULOOLQJDKHDGLV SSJ(0: 'ULOOKRUL]RQWDOKROHWRVHFWLRQ7' /:'3URJUDP *5$]LPXWKDO5(6 &LUFXODWHWKHKROHFOHDQDQG322+ 5XQ´OLQHURQ´'3VHWOLQHUKDQJHUDQGSDFNHU&KDUWFDVLQJSUHVVXUHWHVWSVLIRUPLQ322+ /''3 5XQQHZ´WXELQJZLWKODQGLQJQLSSOHJDVOLIWPDQGUHO V '+*DQGSURGXFWLRQSDFNHU'LVSODFHPXGLQ SURGXFWLRQFDVLQJWRNLOOZHLJKWEULQHVSDFHRXWDQGODQGWXELQJKDQJHUZLWKSUHLQVWDOOHGSUHWHVWHG%39 3UHVVXUHWHVWVHDOVWRSVL1LSSOHGRZQ%23 ,QVWDOOWXELQJKHDGDGDSWHUDVVHPEO\3UHVVXUHWHVWDGDSWHUDVVHPEO\WRSVL5HPRYH%39 &RQQHFWWXELQJDQG,$WKHQSXPSIUHH]HSURWHFWGRZQ,$WDNLQJUHWXUQVXSWKHWXELQJ$OORZIUHH]HSURWHFWWR XWXEHOHDYLQJIUHH]HSURWHFWLQWKHWXELQJDQG,$¶79'EHORZEDVHRISHUPDIURVW 6HFXUHZHOO5LJGRZQDQGPRYHRXW 'LYHUWHUDQG%23,QIRUPDWLRQ(Requirements of 20 AAC 25.005(c)(7)) 3OHDVHUHIHUHQFH%23DQGGLYHUWHUVFKHPDWLFVRQILOHIRU'R\RQ 07$ $JXXVWWK MT7-06A Page 7 of 14 0$63&DOFXODWLRQV 7KHIROORZLQJSUHVHQWVGDWDXVHGIRUFDOFXODWLRQRIDQWLFLSDWHGVXUIDFHSUHVVXUH $63 GXULQJGULOOLQJRIWKLVZHOO &DVLQJ 6L]H LQ &VJ6HWWLQJ'HSWK 0'79' IW )UDFWXUH *UDGLHQW SSJ 3RUHSUHVVXUH SVL $63'ULOOLQJ SVL QD 352&('85()25&$/&8/$7,1*$17,&3$7('685)$&(35(6685( $63 $63LVGHWHUPLQHGDVWKHOHVVHURI VXUIDFHSUHVVXUHDWEUHDNGRZQRIWKHIRUPDWLRQFDVLQJVHDWZLWKDJDVJUDGLHQW WRWKHVXUIDFHRU IRUPDWLRQSRUHSUHVVXUHDWWKHQH[WFDVLQJSRLQWOHVVDJDVJUDGLHQWWRWKHVXUIDFHDVIROORZV $63 > )*[ @' :KHUH $63 $QWLFLSDWHG6XUIDFHSUHVVXUHLQSVL )* )UDFWXUHJUDGLHQWDWWKHFDVLQJVHDWLQOEJDO &RQYHUVLRQIURPOEJDOWRSVLIW *DVJUDGLHQWLQSVLIW ' WUXH9HUWLFDOGHSWKRIFDVLQJVHDWLQIW5.% 25 $63 )33± [' :KHUH )33 )RUPDWLRQ3RUH3UHVVXUHDWWKHQH[WFDVLQJSRLQW )33 [79' $63&$/&8/$7,216 'ULOOLQJEHORZ´FRQGXFWRU $63 > )*[ ±@' > [ ±@[ SVL 25 $63 )33± [' ± [¶ SVL Minimum MW needed = 8.7 PPG 'ULOOLQJEHORZ´VXUIDFHFDVLQJ $63 > )*[ ±@' > [ ±@[¶ SVL 25 $63 )33± [' ± [ SVL Minimum MW needed = 8.8 PPG 'ULOOLQJEHORZILUVW LQWHUPHGLDWHFDVLQJ $63 > )*[ ±@' '/% '/% Minimum MW needed = 8.7 PPG Minimum MW needed = 8.8 PPG 07$ $JXXVWWK MT7-06A Page 8 of 14 > [ ±@[ SVL 25 $63 )33± [' ± [ SVL Minimum MW needed = 8.7 PPG 'ULOOLQJEHORZ´SURGXFWLRQOLQHU $63 > )*[ ±@' > [ ±@[ SVL 25 $63 )33± [' ± [ SVL Minimum MW needed = 8.8 PPG (B) data on potential gas zones; 7KHZHOOERUHLVQRWH[SHFWHGWRSHQHWUDWHDQ\JDV]RQHV (C) data concerning potential causes of hole problems such as abnormally geo-pressured strata, lost circulation zones, and zones that have a propensity for differential sticking; 3OHDVHVHH'ULOOLQJ+D]DUGV6XPPDU\ 3URFHGXUHIRU&RQGXFWLQJ)RUPDWLRQ,QWHJULW\7HVWV(Requirements of 20 AAC 25.005 ©(5)) 'ULOORXWVXUIDFHFDVLQJVKRHDQGSHUIRUP/27WHVWRU),7LQDFFRUGDQFHZLWKWKH$OSLQH/27),7SURFHGXUHWKDW &RQRFR3KLOOLSV$ODVNDKDVRQILOHZLWKWKH&RPPLVVLRQ &DVLQJDQG&HPHQWLQJ3URJUDP &DVLQJDQG&HPHQWLQJ3URJUDP Csg/Tbg OD (in) Hole Size (in) Weight (lb/ft) Grade Conn. Cement Program /+\G¶79'RU¶0'ZKLFKHYHULVJUHDWHUDERYHKLJKHVW SURGXFLQJ]RQH [ /+\G¶79'RU¶0'ZKLFKHYHULVJUHDWHUDERYHKLJKHVW SURGXFLQJ]RQH /+\G8QFHPHQWHGOLQHUZLWKIUDFVOHHYHVDQGVZHOOSDFNHUV '/% Minimum MW needed = 8.7 PPG Minimum MW needed = 8.8 PPG '/% 07$ $JXXVWWK MT7-06A Page 9 of 14 ´6XUIDFH&DVLQJUXQWR¶0'¶79'&HPHQW3ODQ 7KH´VXUIDFHFDVLQJZDVLQVWDOOHGDQGFHPHQWHGGXULQJWKHRULJLQDO07GULOOLQJRSHUDWLRQVLQ$WRWDORI EEOVRISSJ'HHS&UHWHZDVSXPSHGDVWKHOHDGVOXUU\DQGZDVIROORZHGXSE\ EEOVRISSJ&ODVV*WDLO VOXUU\ ´,QWHUPHGLDWH&DVLQJUXQWR¶0'¶79'&HPHQW3ODQ 7KHOHDGVOXUU\ZLOOEHDSSJH[WHQGHG&ODVV*IROORZHGE\DWDLOVOXUU\RISSJ&ODVV*FHPHQW7KHWRSRI FHPHQWZLOOEHSODFHG¶0'DERYHWKH6XE$OELDQ RUVKDOORZHVWK\GURFDUERQEHDULQJ]RQH,IDVKDOORZHU K\GURFDUERQ]RQHRISURGXFLEOHYROXPHVLVHQFRXQWHUHGZKLOHGULOOLQJDVWDJHFHPHQWMREZLOOEHSHUIRUPHGWRLVRODWH WKLV]RQH$VVXPHH[FHVVDQQXODUYROXPHLQRSHQKROH /HDGVOXUU\IURP 0'WR 0'ZLWK([WHQGHG&ODVV*#SSJ 7RWDO9ROXPH IW ! V[RISSJ([WHQGHG&ODVV*$GG V# IWVN 7DLOVOXUU\IURP 0'WR 0'ZLWK&ODVV*#SSJ 7RWDO9ROXPH IW !V[RISSJ&ODVV*$GG V#IWVN ´,QWHUPHGLDWH&DVLQJUXQWR ¶0' ¶79'&HPHQW3ODQ 7RSRIVOXUU\LVGHVLJQHGWREHD¶0'ZKLFKLV¶0'RU¶79'DERYHWKHSURJQRVLVVKDOORZHVW K\GURFDUERQEHDULQJ]RQH$OSLQH'$VVXPHH[FHVVDQQXODUYROXPH 7DLOVOXUU\IURP¶0'WR¶0'ZLWKSSJ&ODVV*$GGV 7RWDO9ROXPH IW !V[RISSJ&ODVV*$GGV#IWVN 07$ $JXXVWWK MT7-06A Page 10 of 14 'ULOOLQJ)OXLG3URJUDP Requirements of 20 AAC 25.005(c)(8)) ,QWHUPHGLDWH ,QWHUPHGLDWH 3URGXFWLRQ +ROH6L]HLQ[ &DVLQJ6L]HLQ 'HQVLW\33*±±± 39F3 <3OE IW )XQQHO 9LVFRVLW\VTW ,QLWLDO*HOVOE IW 0LQXWH *HOV OE IW $3,)OXLG /RVV FF PLQ 1$ +3+7)OXLG /RVV FF PLQ± S+ ±1$ ± ,QWHUPHGLDWH )UHVKZDWHUSRO\PHUPXGV\VWHP(QVXUHJRRGKROHFOHDQLQJE\SXPSLQJUHJXODUVZHHSVDQGPD[LPL]LQJIOXLG DQQXODUYHORFLW\0DLQWDLQPXGZHLJKWIURP SSJDQGEHSUHSDUHGWRDGGORVVFLUFXODWLRQPDWHULDO*RRG ILOWHUFDNHTXDOLW\KROHFOHDQLQJDQGPDLQWHQDQFHRIORZGULOOVROLGV E\GLOXWLQJDVUHTXLUHG ZLOODOOEHLPSRUWDQWLQ PDLQWDLQLQJZHOOERUHVWDELOLW\ ,QWHUPHGLDWH 7KHLQWHUPHGLDWHKROHVHFWLRQZLOOEHGULOOHGZLWK2%0ZHLJKWHGWRSSJ(QVXUHJRRGKROHFOHDQLQJE\ PD[LPL]LQJIOXLGDQQXODUYHORFLW\7KHUHLVDVOLJKWSRWHQWLDOIRUORVWFLUFXODWLRQSDUWLFXODUO\DIWHUWKHUHVHUYRLULV SHQHWUDWHG(QVXUHDGHTXDWH/&0PDWHULDOLVDYDLODEOHRQORFDWLRQDQGLQWKHILHOGWRDGGUHVVDQ\H[SHFWHGORVVHV 0DLQWDLQPXGZHLJKWZLOOEHWDUJHWLQJ(0:XVLQJ03'*RRGILOWHUFDNHTXDOLW\KROHFOHDQLQJDQG PDLQWHQDQFHRIORZGULOOVROLGV E\GLOXWLQJDVUHTXLUHG ZLOODOOEHLPSRUWDQWLQPDLQWDLQLQJZHOOERUHVWDELOLW\1RWH 0DQDJHG3UHVVXUH'ULOOLQJ 03' ZLOOEHXWLOL]HGIRUDGGLQJEDFNSUHVVXUHGXULQJFRQQHFWLRQVWRPLWLJDWHVKDOH LQVWDELOLW\DQGF\FOLQJ 3URGXFWLRQ+ROH 7KHKRUL]RQWDOSURGXFWLRQLQWHUYDOZLOOEHGULOOHGZLWK)OR3URZHLJKWHGWR SSJ03'ZLOOEHXVHGWRKROG EDFNSUHVVXUHNHHSLQJWKHZHOOG\QDPLFDOO\EDODQFHG 'LDJUDPRI'R\RQ0XG6\VWHPRQILOH 'ULOOLQJIOXLGSUDFWLFHVZLOOEHLQDFFRUGDQFHZLWKDSSURSULDWHUHJXODWLRQV $EQRUPDOO\3UHVVXUHG)RUPDWLRQ,QIRUPDWLRQ(Requirements of 20 AAC 25.005 (c)(9)) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO '/%33*±± ±'HQVLW\ 07$ $JXXVWWK MT7-06A Page 11 of 14 6HLVPLF$QDO\VLV(Requirements of 20 AAC 25.005 (c)(10) 1$$SSOLFDWLRQLVQRWIRUDQH[SORUDWRU\RUVWUDWLJUDSKLFWHVWZHOO 6HDEHG&RQGLWLRQ$QDO\VLV(Requirements of 20 AAC 25.005 (c)(11)) 1$$SSOLFDWLRQLVQRWIRUDQRIIVKRUHZHOO (YLGHQFHRI%RQGLQJ(Requirements of 20 AAC 25.005 (c)(12)) (YLGHQFHRIERQGLQJIRU&RQRFR3KLOOLSV$ODVND,QFLVRQILOHZLWKWKH&RPPLVVLRQ 'LVFXVVLRQRI0XGDQG&XWWLQJV'LVSRVDODQG$QQXODU'LVSRVDO (Requirements of 20 AAC 25.005 (c)(14)) ,QFLGHQWDOIOXLGVGHYHORSHGIURPGULOOLQJRSHUDWLRQVRQZHOO07$ZLOOEHLQMHFWHGLQWRDSHUPLWWHGDQQXOXVRQ WKH07SDGRUKDXOHGWRWKH&ODVVGLVSRVDOZHOORQ&' 7KH07$VXUIDFHLQWHUPHGLDWHFDVLQJDQQXOXVZLOOEHIOXVKHGZLWKEEOVRIIUHVKZDWHUSULRUWRIUHH]H SURWHFWLQJZLWKGLHVHOWRa 79'6LJQLILFDQWK\GURFDUERQ]RQHVLQFOXGHRQO\WKH$OSLQHVDQGEDVHGRQSUHGULOO LQWHUSUHWDWLRQV 2QFH07$KDVEHHQGULOOHGDQGFRPSOHWHGFRQVLGHUDWLRQPD\EHJLYHQWRSHUPLWWKLVZHOOIRUDQQXODU LQMHFWLRQ$QDSSOLFDWLRQIRU6XQGU\2SHUDWLRQVIRUPZLOOWKHQEHILOHG$QQXODUSXPSLQJRIIOXLGV RFFXUULQJGXHWRGULOOLQJRSHUDWLRQVSHUUHJXODWLRQ$$&FRXOGWKHQEHJLQRQFHSURSHUO\SHUPLWWHG$V VWDWHGDERYHDQ\]RQHVFRQWDLQLQJVLJQLILFDQWK\GURFDUERQVZLOOEHLVRODWHGSULRUWRLQLWLDWLQJDQQXODUSXPSLQJ 7KHUHZLOOEHQR86': VRSHQEHORZWKHVKRHRUSRWDEOHLQGXVWULDOZDWHUZHOOVZLWKLQRQHPLOHRIWKHUHFHLYLQJ ]RQH5HIHUHQFHWKHHQFORVHGGLUHFWLRQDOGULOOLQJSODQIRURWKHUIRUPDWLRQPDUNHUVLQWKLVZHOO 6XUIDFHFDVLQJZLOOEHVHWQHDUWKHEDVHRIWKH&IRUPDWLRQZLWKLQWKH.IRUPDWLRQ7KHVH WKLFNVKDOHV DUHSDUWRIWKH&ROYLOOH*URXSDQGDUHNQRZQWRSURYLGHYHUWLFDOEDUULHUVWRIOXLGIORZLQRWKHUDUHDV 7KHPD[LPXPYROXPHRIIOXLGVWREHSXPSHGGRZQWKHDQQXOXVRIWKLVZHOOZLOOQRWH[FHHGEEOZLWKRXWWKH VSHFLILFSHUPLVVLRQRIWKH$2*&&)OXLGGHQVLWLHVZLOOUDQJHIURPGLHVHOWRDPD[LPXPRISSJIRUGULOOLQJ IOXLGZDVWHV8VLQJSSJIOXLGDQGWKHULJ¶VVSHFLILHGPD[LPXPSXPSLQJSUHVVXUHRISVLIRUDQQXODU LQMHFWLRQWKHPD[LPXPSUHVVXUHDWWKHVXUIDFHFDVLQJVKRHLVHVWLPDWHGE\ 0D[6KRH3UHVVXUH SSJ 6XUI6KRH79' SVL SSJ ¶ SVL SVL 3RUH3UHVVXUH SVL 7KHUHIRUH 'LIIHUHQWLDO ± SVL 7KHLQWHUQDOFDVLQJSUHVVXUHLVFRQVHUYDWLYHVLQFHIULFWLRQDOORVVHVZKLOHSXPSLQJKDYHQRWEHHQWDNHQLQWR FRQVLGHUDWLRQ7KHVXUIDFHDQGLQWHUPHGLDWHFDVLQJVWULQJVH[SRVHGWRWKHDQQXODUSXPSLQJRSHUDWLRQVKDYH VXIILFLHQWVWUHQJWKE\XVLQJWKHFROODSVHDQGEXUVWUDWLQJVOLVWHGLQWKHIROORZLQJWDEOH 2':W SSI *UDGH5DQJH&RQQHFWLRQ 7\SH&ROODSVHRI &ROODSVH%XUVWRI %XUVW ´/+SVL SVLSVLSVL ´/+SVLSVLSVLSVL 07$ $JXXVWWK MT7-06A Page 12 of 14 'ULOOLQJ+D]DUGV6XPPDU\ 7REHSRVWHGLQ5LJ)ORRU'RJKRXVH3ULRUWR6SXG ´+ROH ´&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVWFLUFXODWLRQ/RZ5HGXFHSXPSUDWHVUHGXFH WULSVSHHGVUHDOWLPH(&' PRQLWRULQJPXGUKHRORJ\ DGGORVWFLUFXODWLRQPDWHULDO +ROHVZDEELQJRQWULSV0HGLXP5HGXFHWULSVSHHGVFRQGLWLRQ PXGSURSHUWLHVSURSHUKROH ILOOLQJSXPSRXWRIKROHUHDO WLPH(&'PRQLWRULQJ03' VWULSSLQJSUDFWLFHV $EQRUPDO3UHVVXUHLQ 2YHUEXUGHQ)RUPDWLRQV /RZ:HOOFRQWUROGULOOVFKHFNIRU IORZGXULQJFRQQHFWLRQV LQFUHDVHPXGZHLJKW 6KDOORZKD]DUGVWXG\QRWHG PLQLPDOULVN +ROH&OHDQLQJ/RZ0RQLWRU(&'DQGWRUTXHGUDJ WUHQGVFRQWUROGULOODQGXVH EHVWKROHFOHDQLQJSUDFWLFHV [ ´+ROH´/LQHU&DVLQJ,QWHUYDO (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ 6ORXJKLQJVKDOH7LJKW KROH +LJK03'IRUVKDOHVWDELOLW\6WHHUDEOH'ULOOLQJ/LQHU ,QFUHDVHPXGZHLJKWFRQWURO523FRQQHFWLRQDQG WULSVSHHGVVZHHSVDQGUHDOWLPHHTXLYDOHQW FLUFXODWLQJGHQVLW\ (&' PRQLWRULQJUXQFDVLQJDV OLQHU /RVWFLUFXODWLRQ/RZ5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDO +ROHVZDEELQJRQWULSV0HGLXP5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ/LQHUZLOOEHLQSODFHDW7' $EQRUPDO5HVHUYRLU 3UHVVXUH /RZ:HOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVLQFUHDVHPXGZHLJKW +\GURJHQ6XOILGHJDV/RZ+6GULOOVGHWHFWLRQV\VWHPVDODUPVVWDQGDUGZHOO FRQWUROSUDFWLFHVPXGVFDYHQJHUV ´+ROH´3UH3HUIRUDWHG/LQHU+RUL]RQWDO3URGXFWLRQ+ROH (YHQW5LVN/HYHO0LWLJDWLRQ6WUDWHJ\ /RVWFLUFXODWLRQ/RZ5HGXFHSXPSUDWHVUHGXFHWULSVSHHGVUHDOWLPH (&'PRQLWRULQJPXGUKHRORJ\DGGORVWFLUFXODWLRQ PDWHULDO +ROHVZDEELQJRQWULSV0HGLXP5HGXFHWULSVSHHGVFRQGLWLRQPXGSURSHUWLHV SURSHUKROHILOOLQJSXPSRXWRIKROHUHDOWLPH(&' PRQLWRULQJ 07$ $JXXVWWK MT7-06A Page 13 of 14 $EQRUPDO5HVHUYRLU 3UHVVXUH /RZ:HOOFRQWUROGULOOVFKHFNIRUIORZGXULQJ FRQQHFWLRQVLQFUHDVHGPXGZHLJKW 'LIIHUHQWLDO6WLFNLQJ/RZ8QLIRUPUHVHUYRLUSUHVVXUHDORQJODWHUDONHHSSLSH PRYLQJFRQWUROPXGZHLJKW +\GURJHQ6XOILGHJDV/RZ+6GULOOVGHWHFWLRQV\VWHPVDODUPVVWDQGDUGZHOO FRQWUROSUDFWLFHVPXGVFDYHQJHUV :HOO3UR[LPLW\5LVNV 07ZLOOEHDPXOWLZHOOSDGFRQWDLQLQJDQRULJLQDOSODQRIZHOOV'LUHFWLRQDOGULOOLQJFROOLVLRQDYRLGDQFH LQIRUPDWLRQLVSURYLGHGLQWKHIROORZLQJDWWDFKPHQWV 'ULOOLQJ$UHD5LVNV 5HVHUYRLU3UHVVXUH 2IIVHWLQMHFWLRQKDVWKHSRWHQWLDOWRLQFUHDVHUHVHUYRLUSUHVVXUHRYHUSUHGLFWHG$OWKRXJKWKLVLV XQOLNHO\WKHULJZLOOEHSUHSDUHGWRZHLJKWXSLIUHTXLUHG :HDNVDQGVWULQJHUVFRXOGEHSUHVHQWLQWKHRYHUEXUGHQ/&0PDWHULDOZLOOEHDYDLODEOHWRVHDOLQORVVHVLQWKH LQWHUPHGLDWHVHFWLRQ /RZHU6KDOH6WDELOLW\ +5=.DOXELN0LOXYHDFKLQWKHLQWHUPHGLDWHDQGLQWHUPHGLDWHKROHVHFWLRQVZLOOUHTXLUH KLJKHUPXGZHLJKWVWKDQKLVWRULFDOO\XVHGWRHQKDQFHZHOOERUHVWDELOLW\0DQDJHG3UHVVXUH'ULOOLQJZLOOEHXVHGLQ FRQMXQFWLRQZLWKDVWULQJFDVLQJGHVLJQWRPLWLJDWHVKDOHLQVWDELOLW\LQWKHVHIRUPDWLRQV6WDQGDUG/&0PDWHULDO DQGZHOOERUHVWUHQJWKHQLQJSLOOVDUHH[SHFWHGWREHHIIHFWLYHLQGHDOLQJZLWKORVWFLUFXODWLRQLIQHHGHG *RRGGULOOLQJSUDFWLFHVZLOOEHVWUHVVHGWRPLQLPL]HWKHSRWHQWLDORIWDNLQJVZDEEHGNLFNV '/% 5HVHUYRLU3UHVVXUH 2IIVHWLQMHFWLRQKDVWKHSRWHQWLDOWRLQFUHQDVHUHVHUYRLUSUHVVXUHRYHUSUHGLFWHG 07$ $JXXVWWK MT7-06A Page 14 of 14 07$3URSRVHG,QMHFWLRQ&RPSOHWLRQ6FKHPDWLF 7UXH9HUWLFDO'HSWK XVIWLQ 9HUWLFDO6HFWLRQDW XVIWLQ 07B67B5HYB/DQGLQJB07B67B5HYB7RHB,17 ,17 070767BZS6HFWLRQ9LHZ3URMHFW :HVWHUQ1RUWK6ORSH6LWH *075HQGH]YRXV3DG:HOO 07:HOOERUH 0767'HVLJQ 0767BZS 3ODQ9LHZ3URMHFW :HVWHUQ1RUWK6ORSH6LWH *075HQGH]YRXV3DG:HOO 07:HOOERUH 0767'HVLJQ 0767BZS6RXWK 1RUWK XVIWLQ :HVW (DVW XVIWLQ 07B67B5HYB7RHB07B67B5HYB/DQGLQJB,17 ,17070767BZS ! ! " #$ %& % & ' () *+ ,,,,, -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 5 ' 25 6 7 5251 230 * &.' .230 * & 4* & 41' 5 6- 1 '7 ! ' 1 '77 ' ! ! !! 8 5 ! 0! 0 /! !! 9 ! & !/ : !/ '! )/ +# ,- 28 ! 0 #' 4243 ! 4 04# ! ! 89## * 8 90 00 % % !! 0 /! 0! : !/ & !/ ;:<% ;&< !! 9 !' 0) 4+##2 4240 ! 4 #242# 32 ! 2 !% : )! ! ! 89## #* 8 903 3 ! 3 3# ! % 3 2 !! =>? 8! / =? 5 2 2! "/ =>? &5/! :++## 2;;### 03 3 0 4 0 4 ! "!& 2 !/)/ 0 6* 4! ! 2 8 5=42? = 1? ;&< = 1? 2! ! =>? ;:<% = 1? !@2 0420 # 0 02 2 8 5 = 1? ) /5 5# &5)=% 3 ? 2 = 1? 2;#;### <(= #<+< >+<(= #<7< )/ 0"$0420 ##400 3 -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ $ !! =>? "(!5 =>? ;:<% = 1? 8@ =>? ;&< = 1? 2 = 1? 4! 2 = 1? 2 / / =><+ 1? -! =><+ 1? =><+ 1? ! / 4# 22 042 3##3 0420 # 2 # 0 40 3 0040# ## 043 3 403 34 004 ### 40 3 03 ## # # 4# #34 043#0 3##0 4 #0 40 0304#3 242 0 #0 24 #0 2 0 0# # 40 42 #4 # # 4# # 4 0 4 2 4 30 2## 4# # 3 # 3# 02# 4202 # 4# 0420 ## 430 3 # #2 ## # 423 42 2340 #40 420 42 3340#3 #4 0# 0 30 422 043 3#34 ## 3 33 204 3 4 430# 34 0 3 33 20402 )) -#)6 0# # 4 43 0034 00 30 32 20422 3 4 3 234#0 34 3 0 32 2#400 3)) -#) 42## 24 034 3 0 32 2#400 3 -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 2 = 1? $ !! =>? "(!5 =>? ;:<% = 1? 4! ! = 1? 2 / / =><+ 1? ;&< = 1? -! =><+ 1? =><+ 1? ) 4! 2 = 1? 02 02 3 #0 3 0 #2 03 #2 23 # # 2 2 23 23 # 0# 00 # 2 00 3 2 3 # 0 0 30 # 2 2 # 0 # 3 22 0 0 3# # 3 0# 00 # # # 3 0 20 3 ## # # 0 2 # # 0 # 2 2 0 20 002 3 2 0 22 00 03 0 3 0 0 00 33 3 # 2 00 2 2 0 0 32 30 00 22 32 # 0 33 2 0 3 # 22 0 3 3 0# 0 233 0 # #2 # 0 3 43 2 2 0 0 43 3 0 0# # 0 #2 2 3 3 42 # #23 #2 4 0 # 0 2 0 # #0 # 3 4#0 20 #33 4# 3# # 3 2 2 3 # ## 40 2 3 #3 # 40 2 3 # # 3 # 2 2 4 # # # 0 4 0 02 # # # #3 2# # 30 2 4 0 # 3 # 4 #0 2 3 # 2 # 00 # #3 3 4# #0 ## 2 403 0# 3 0 #0 00 # 3 3 4 # 3 23 4#3 0 # 30 3 02 # # 0 43 0 2 3 # 0 22 433 30 # 3 0# 3 # 0 ## 420 ## 0 #0 0 42 0 0 0# 0 3 #3 # # #4#2 #3 # #00 # 422# 3 2 #0 # 2 # 33 # # 00 #4#0 # #0# #4 3 # #3 3# # 0 # 0 2 #4# 23 #3 #00 3 #4# # # # 0 0# ## # #40# 0 2 #00 #4# # 3 0 # 030 0 0 2 3 # # # #4 0 00 #0# 3 #40#0 2 0 # 3#0 3 032 30 # 3 #4 0 #0 0 #4 # 2# # 3 23 0# # # #420 03 2 #0 #4 # 00 # 33 #3 2 # # #43 3# 02 22 #0 0 #4 3 #2 # ## 0# 3 #43 2 ##3 2 #43 0 ## # # 2#2 # 3 # # # # #43 # # ## 3 #43 # # 2200 2 # 2 #422 # ##3 2 #4# # #3 0 # 0 0 33 23 040 3 # ##3 00 #43 # 0# 22 # 3020 #3 3 # 3 04 3 0 ##3 #2 #433 0# 0# 00 # 0 00 04## 2 ##3 30 #42 # # 3 3# 0 040 3 2 33 ##3 2 04# # # 30 33 0402 # 2 2 ##3 20 04 3 2 #3 33 # 0 04 # 2 20 ##3 30 04# # 3 2 # #2 2#0 + <AB 04 2 2 ##3 043# # 2 #2 33 2 04 23 #0 0 ##3 0 0422 0 20 0 2 20 3 3 0420 # ##3 042 3 3 032 4# 2 0 ## 04 ##3 0 04 2 3 0 0 # 4# 2 # 0 04 3 ## 2 04##2 3 0 43 0 # # 3 043 3 ## 040# # #3 0 0 40 3 # 2 3 042 ## 0402 0 2 3 430 # 4 ## 04 02 02 0 3 4#00 # 4 ## 04 3 ## 2 4#30 # 4# ## 043 3#2 3 2 4000 # 40 3 ## 04 # 3 4 0 403 3 4 3 ## 22 04# 2 23 # 4 0 4 0 3 22 # 4 3 32 ##3 2 0433 2# # # 40 2 4 32 2 # # 23 4 #0 #0 043#0 3# 23 2 # 4 4# #3 # 32 4 #0 0430 # 4 33 40 # 4 3 -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 2 = 1? $ !! =>? "(!5 =>? ;:<% = 1? 4! ! = 1? 2 / / =><+ 1? ;&< = 1? -! =><+ 1? =><+ 1? ) 4! 2 = 1? 4 #0 042 # 4 2 0 4## 4 3# 43 #0 0423 3 42# 03 4# 4 42 #0 4 3 40 0 40 22 4# 3 4 #0 4 0 43 33 40 #0 43# 3 4 #0 4 4### 0 4 2 3 43 4# #0 4#03 2# 4# 03 4 3 # 42 #0 40 #0 400 2 403 0 4 2 423 2 4 #0 40 40 33 4 # #4 4 #0 4 0 402 0 4 #4 #3 4 #0 4 2 0 4 03 03 4 3 #40 2 4 #0 4 0 4 3 0 4 2# #420 43 #0 4# 2 4# 33 4 #4## 00 42 #0 433 3 43 0 430 #40 4 #0 40 4 03 43# #402 2 4 #0 43 # 4 0 42 33 #4 #3 0 4# #0 433 42 33 42 # #4 3 40 #0 42 23 4 0 #4 0 #4 4 #0 4 # 43 03 #4 2 #4 # 4 #0 4 43# 0 #423 3 #40 4 #0 403 3# 43 33 #4 3 3 #4# 3 4 #0 4#0 42 0 #42 0# #43 43 #0 4# 03 42 03 #4# #4302 42 #0 400 #4 0 #4#2 3 #432 30 4 #0 402 20 #4 0 33 #40 #42 4 #0 4 # #43 # #402 #3 04 # 4# #0 4# 2 #40 0 #4 0 # 040 33 40 #0 433 #40 # #4 2# 040# 4 #0 40 #4# 3 #4 # 042 # 4 #0 4 00 #4# # #42 # 04# 2 20 4 #0 43 #400 0 #4 3 0403 4 #0 43 33 #40 # #432 0 040 #2 43 #0 42 #4032 3 #403 2 04 # 2 42 #0 42 #4 00 # #433 # 04 3 34 #0 403 # #4 0 #430 04 0 0 34 #0 40 #42 # #433 2 04# # 34# #0 4 #3 #4# 3 #420 20 04 340 #0 4#0 #4 # #423 042 02 34 #0 4#2 3 #4 2 0 040 043 34 #0 40 #42# # 0430 0430 34 #0 4 # 02 #40 3 040# 32 0432 0 34 #0 4 33 #42 # 043# 0 042 # 343 #0 4# 2 #43## 0 04#0 0 4# 3 342 #0 4 #0 #43 # 04#3 4 3 24 #0 43 #423 3 040#2 3 40 24 #0 4 2 #42# # 0402 2 433 3 24# #0 43 #422 0 04 #3 00 4# 0 240 #0 43 0 0403 # 04 40 # 24 #0 #0 42 0 0430 04#3 2 40 03 24 2 30 ## 23 40 # 04# 0 # #04 4 ## # 0 24 2 ##0 3 4 2 04 # #040 4 2 0 24 2 ## 40# ## 04## 3 # #043 4# 3 0 243 2 3# # 3 42 3 04#3 # # #04 3# 4 23 3 0 242 2 22 # 0# 4# ## 0400 03 # #0433 3 4# 3# 0 4 # # 2 40# 0 0402 # # #0430 #2 4# 00 # 0 0 -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 2 = 1? $ !! =>? "(!5 =>? ;:<% = 1? 4! ! = 1? 2 / / =><+ 1? ;&< = 1? -! =><+ 1? =><+ 1? ) 4! 2 = 1? 4 3 #3 3 4032 2 04 0 # #042 # 4 # 0 0 4# # # 4 # 04# # # 42 # 40 # 0 $&+ 4# # # 4 30 2# 042 2 4 2 4 0 40 # 3 # 4 3 0420 # # 43 0 4 3 # 03 22 4 #0 4 04# 23 # 40 43 # 03 2 4 2 ## 40 040 # 4##2 2 430# 23 # 02 32 4 2 0 # 30 430 0 043 # 403 0 43 # 3 4 # 0 40# 2 04333 2 # 4032 0 432 2 # 3 43 # # 43 042 2 # 4 # 42#3 0 # 430 # 420 # 0422 # 4# 0 4202 # # 42 0 23 43# 2 4 2 2 # # 43 423 # 3 # 4 3# 2 23 43 3 400 3 # # 4 423 0 # 0 4 0 20 42# 02 4#2 # # 400 0 43 3 # 4# 2 2 3 42 # 40 3 # # 43#0 4#3 # 2 # 02 40 3 33 3# 423 402 # # 420 20 4 0 # # 0 4 3 #0 3 343 # 4 3 3 # #4 4 3 # 0 4 3 2# 3 34 2 4 # # #423 4 2 # 0# 4 2 3 3 342 42 # #42 3 4 0 # # 0 4 02 2 34# 0 40 # #4#3 3 4 2 # #3 43 0 34 # 43 #2 # #403 2 43 2 3 # # 42 23 3433 33 42# # #4 3 4# 3 # # #4 # 3 # 3 34#2 0 4 # #42 # 4# 30 # ## #4 0 34# 23 4 0 # #4 0 403 30 3 # # #4# 3 3 34# 0 4#03 33 # #43 2 4# 33 # 3 #4#2# 0 34#22 40# 3 # #43 03 4 23 2 # $& #40 0# 340 #3 400 # #430 # 4 00 2 # #40 340 4020 # #42 2 423 2 # #4 340# 4 0 # 42 0 42 2 #4 340#3 4 0 42 3 420 #4 # 3 340 3 3 4# #0 0 4 42 2 # #4 2 0# 0 3403 3 4# 0 400 3 423 # #4 3 3 3403 3 4 3 0 4## # 433# 2# 2 # #43 3# 2 34022 43 0 40 0 43 0 3 3 # # #42 3 # 0 34 42 0 0 4 2 43 3 3# # 04 3 34 3 422 0 0 4 20 3 40 30 # 02 04 3 33 2 3 34 ## 42# 00 0 43 3# 422 0 30 # 03 04# 33 2 3 34 # #0 4 3 4 3 4 2 2# 040 33 2 3 34 # 3 4# 4 2 42 0402 33 2 3 34 0 40 3 430# 4 04 33 3 2 34 0 40 0 # 430 4 02 # # 04 32 34 0# 4 # 42# 4 20 # # 0422 3 32 2 0 34 00 3 403 # 43 00 4 # 04 32 2 0 34 00 3 40# ## 42 2 4 32 043 32 2 0 34 0 # 4# 0 43 40 042 32 2 0 34 0 433 3 4# # 40 0 4 32 2 0 34 0 2# 42 40 #0 4# 4 32 2 0 34 0 #3 4 4 0 4#2 0 4# 32 2 0 34 0 42 3 4 0 40 23 40 32 2 0 34 0 42 40# 4#3 4 32 2 0 34 0 0 4#3 0 4# 430 ## 4 32 2 0 34 0 0 40 # 43 40 3 4 32 2 0 34 0 2 4 03 4322 33 0422# -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 2 = 1? $ !! =>? "(!5 =>? ;:<% = 1? 4! ! = 1? 2 / / =><+ 1? ;&< = 1? -! =><+ 1? =><+ 1? ) 4! 2 = 1? 4 32 2 0 34 0 40 4233 22 042 3 43 32 2 0 34 0 3 4 343 042 2 42 32 2 0 34 03 4 2 34 # 043 0 4 32 2 0 34 03 0 43 # 2 34# 0# 043 20 4 32 2 0 34 03 32 420 0 340 0 04 4# 32 2 0 34 02 # 34#2 34 0 0 04# 40 32 2 0 34 02 34## #3 34#0 04 2 4 32 2 0 34 02 2 34# 34# 04#2 4 32 2 0 34 00 3403 34 3 043 # 4 32 2 0 34 2 34 342 2 0403 4 32 2 0 34 34 2 3 3433 3 04 20 # 43 32 2 0 34 343 20 3422 2 04 33 42 32 2 0 34 343 243 #2 04 # 2 4 32 2 0 34 # 0 34 2 24 040 4 32 2 0 34 # 2 343 0# 24#0 040 0 4# 32 2 0 34 # 3 342 240# # 04# 0 40 32 2 0 34 0 # 240 24 0 04## 2 4 32 2 0 34 0 24 240 3 04 2 4 32 2 0 34 0 20 24#02 30 242# 2 040 # 4 32 2 0 34 #2 2400# 2 243# 043 3# 4 32 2 0 34 24 # 2 24 0402 43 32 2 0 34 242 ## 243 # #422 42 32 2 0 34 0 24# 0 242 2 03 #42 3 3 4 32 2 0 34 0 24 403 2 #420 #2 4 32 2 0 34 2 2423 4# #43 2 4# 32 2 0 34 2432 0 4# #43# 0 40 32 2 0 34 3# 2423 3 40 3# #4 4 32 2 0 34 3 4 22 402 20 #4# 4 32 2 0 34 4 # 4 3 0 #4 02 4 32 2 0 34 2 4# # 40 #40 4 32 2 0 34 3 # 40 03 4# # #43 # 43 32 2 0 34 3 # 4 4 0 #4 # 42 32 2 0 34 3 23 4 0 0 43 #4 2 3 34 32 2 0 34 2 0 40 42#2 3 #4 2 3 34 32 2 0 34 2 4#2 32 43 2 #4 34# 32 2 0 34 43#0 # 4 3 #403 340 32 2 0 34 # 42 42 2 #400 00 34 32 2 0 34 3 42 #3 4#3 #4# 2 34 32 2 0 34 4# 40 # #4### 34 32 2 0 34 42 4 #0 #4 2 34 32 2 0 34 3 4#33 40 0 #40 3 343 32 2 0 34 # ## 403 2 4 # #43 # 342 32 2 0 34 # 3 4 2# 40 #4 24 32 2 0 34 # 2 43 43# 422 24 32 2 0 34 0 0 4 3 422 42 #3 24# 32 2 0 34 0 4 0 4223 33 42 2 240 32 2 0 34 # 43 #43 22 432 24 32 2 0 34 03 42 #4 43 0 24 32 2 0 34 #400 #4# # 43 24 32 2 0 34 #4# 3# #40 0# 4#0 0 24 32 2 0 34 #4#2 2 #4 0 4 22 243 32 2 0 34 3# #400 3 #400 40# 242 32 2 0 34 3 #4 # #4## 43 ## #4 32 2 0 34 #4 22 0 #4 4 3 -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 2 = 1? $ !! =>? "(!5 =>? ;:<% = 1? 4! ! = 1? 2 / / =><+ 1? ;&< = 1? -! =><+ 1? =><+ 1? ) 4! 2 = 1? #4 32 2 0 34 2 #42# #43 3 4 2 #4# 32 2 0 34 # #43 #4332 2 4 3 #40 32 2 0 34 0 #43 0 #422 3 4 #4 32 2 0 34 22 #43 3 043 2 40 0 #4 32 2 0 34 3 0 #42 23 04 0 40 20 #4 32 2 0 34 3 043 04# 4#2 #4 32 2 0 34 2 04 # 0400 4## #43 32 2 0 34 2 0 04# 0 04 # # 43 2 #42 32 2 0 34 2 2 0400 040 0 400 #4 32 2 0 34 04 0 0 04# 3 433 # #4 32 2 0 34 04#0 042 2 4 # #4# 32 2 0 34 3 04 32 043 22 # #40 32 2 0 34 #0 04 043 2 33 #4 32 2 0 34 2 0430 0422 # 2 #4 32 2 0 34 2 0432 # 4 3 03 3 #4 32 2 0 34 # 0 04232 40 2 3 0 #4 32 2 0 34 # 43# 0 4## 0 #43 32 2 0 34 0 0 4 40 # 2 #42 32 2 0 34 0 02 4#3 2 4 3# 2 2 ##4 32 2 0 34 0 40 2# 4 20 20 0 # ##4 32 2 0 34 4 430 33 3# ##4# 32 2 0 34 4 3 4# 0 ##40 32 2 0 34 30 4 0 4 # 23 ##4 32 2 0 34 2 40 0 43 0 # 3 ##4 32 2 0 34 43# 4202 0 ##4 32 2 0 34 2 42# 2 4#3 3 0 2# ##4 32 2 0 34 # 40 3# 4 2 0 0 ##43 32 2 0 34 4 2 4# 3 # ##42 32 2 0 34 4# 3 4#2 2 ## #04 32 2 0 34 0 4#20 # 403 3 02 #04 32 2 0 34 # 403 00 4 # 0 #04# 32 2 0 34 3 3 4 2 40 #0 32 # #040 32 2 0 34 3 4# 2 4# 0 # #04 32 2 0 34 3 3 4 # 4 #04 32 2 0 34 2 43 3 430 # #04 32 2 0 34 2 # 43 23 422 2 2 #04 32 2 0 34 2 33 42 43 3 0 #3 #043 32 2 0 34 # 403 #0 42 33 3# #042 32 2 0 34 40 0 43 22 ##3 # 4 32 2 0 34 2 4## 2 4# #0 0 # 4 32 2 0 34 0# 40 # 40 # 03 3 # 4# 32 2 0 34 3 4 4 0# 0 2 # 40 32 2 0 34 # 40 33 4 0 0 2 # 4 32 2 0 34 # 42 40# 2 # 4 32 2 0 34 # 42 4# 0 # 4 32 2 0 34 0 # 430 # 43 # # 4 32 2 0 34 0 3 43 02 4322 3 2 # 43 32 2 0 34 0 3 422 # 4233 2 0 3 # 42 32 2 0 34 # 4# 43 3 3 3 #4 32 2 0 34 4 3 4 2 # # #4 32 2 0 34 2# 4# 3 2 4# 0 # 0 #4# 32 2 0 34 #3 40 # 40 33 #40 32 2 0 34 4 0 4 0 # 30 02 #4 32 2 0 34 4#3 0 4#0 # 23 -#./ 0 ! 1 23 !"#$42 1 % &' ' ( )* 5 !"#$2 1 * & 6 & 1 +# ,- ! ''. .% - ) ! % % 3 )/ 02 !/ 2 = 1? $ !! =>? "(!5 =>? ;:<% = 1? 4! ! = 1? 2 / / =><+ 1? ;&< = 1? -! =><+ 1? =><+ 1? ) 4! 2 = 1? #4 32 2 0 34 0 4# # 4# 0 2 #4 32 2 0 34 # 4 4 3 222 #4 32 2 0 34 2 43 3 42 2 4 2# #43 32 2 0 34 42 3 433 42 0 #42 32 2 0 34 3 4220 2 422 40 3 #4 32 2 0 34 3 343 343 #3 43 #4 32 2 0 34 3 0 343 # 34 03 4## #4# 32 2 0 34 3 32 34#0 00 34#0 2 4# 30 #40 32 2 0 34 2 # 340 340# 40 # #4 32 2 0 34 2 34 2 3 34 40# 2 #4 32 2 0 34 2 2 34# 340 3# 4 2 #4 32 2 0 34 3 00 34 3 342# 20 4 0 0 #400 3 32 2 0 34 3 34 0 34#0 4 3 2 #4 32 2 0 34 3 2 3403 2 343# 4 23 #43 32 2 0 34 3 3430# 34 4 # #42 32 2 0 34 3 342# #0 343 # 432 #4 32 2 0 34 3 243 0 342 2 0 40 33 #4 32 2 0 34 3# 0 24 2 2403 43 # #4# 32 2 0 34 3# 2 24# 24# 3 4# #40 32 2 0 34 3# 3 24#2 24# 2 4 0 #4 32 2 0 34 30 # 2402 3 240 3 43 #4 32 2 0 34 30 24 3 2402 2 43 2 #4 32 2 0 34 30 20 24 0 24 3 # 42 #400 3 32 2 0 34 3 243 24 0 42## /&5 !<5! / 42 = 1? & !/ = 1? : !/ = 1? ;&< = 1? ;:<% = 1? 2 !// 0 /!0! 2! "/ =>? 2! 2!C =>? )) -#)634 0 423430 4 #4#02 #430# 4 829 232* 8 09 &' 7 ' )) -#) )34 3 432432 4 042#0 34#0 4 3 2 892 0* 8 9 #3 &' 7 ' 4! 2 = 1? 2 = 1? !/ 2!5 =!? . 2!5 =!?&5 !/ ! 00;3?04# #04 # 0 0 (*4 # 4# #2 # 2 # (*#34#22 #4#2# 5HYLVHG 75$160,77$//(77(5&+(&./,67 :(//1$0( BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 37' BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBB'HYHORSPHQW BBB6HUYLFH BBB([SORUDWRU\ BBB6WUDWLJUDSKLF7HVW BBB1RQ&RQYHQWLRQDO ),(/' BBBBBBBBBBBBBBBBBBBBBBBBBB 322/ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KHFN%R[IRU$SSURSULDWH/HWWHU3DUDJUDSKVWREH,QFOXGHGLQ7UDQVPLWWDO/HWWHU &+(&. 237,216 7(;7)25$33529$//(77(5 08/7, /$7(5$/ ,IODVWWZRGLJLWV LQ$3,QXPEHUDUH EHWZHHQ 7KH SHUPLW LV IRU D QHZ ZHOOERUH VHJPHQW RI H[LVWLQJ ZHOO 3HUPLW 1XPEHU BBBBBBBBBBBBB$3, 1XPEHUBBBBBBBBBBBBBBBBBBBBBB 3URGXFWLRQ IURPRULQMHFWLRQ LQWRWKLVZHOOERUHPXVW EHUHSRUWHGXQGHU WKHRULJLQDO$3,1XPEHUVWDWHGDERYH 6SDFLQJ ([FHSWLRQ 7KHSHUPLWLVDSSURYHGVXEMHFWWRIXOOFRPSOLDQFHZLWK$$& $SSURYDO WR SURGXFH RU LQMHFW LV FRQWLQJHQW XSRQ LVVXDQFH RI D FRQVHUYDWLRQ RUGHU DSSURYLQJ D VSDFLQJ H[FHSWLRQ 7KH 2SHUDWRU DVVXPHVWKHOLDELOLW\RIDQ\SURWHVWWRWKHVSDFLQJH[FHSWLRQWKDWPD\ RFFXU 'U\'LWFK6DPSOH $OOGU\GLWFKVDPSOHVHWVVXEPLWWHGWRWKH$2*&& PXVWEHLQQRJUHDWHU WKDQIRRW VDPSOHLQWHUYDOVIURPEHORZWKHSHUPDIURVWRUIURPZKHUH VDPSOHVDUHILUVWFDXJKWDQGIRRW VDPSOHLQWHUYDOVWKURXJKWDUJHW ]RQHV 1RQ &RQYHQWLRQDO :HOO 3OHDVHQRWHWKHIROORZLQJVSHFLDOFRQGLWLRQRIWKLVSHUPLW 3URGXFWLRQRU SURGXFWLRQWHVWLQJRIFRDOEHGPHWKDQHLVQRWDOORZHGIRUWKLVZHOO XQWLO DIWHUWKH2SHUDWRUKDVGHVLJQHGDQGLPSOHPHQWHGDZDWHUZHOOWHVWLQJ SURJUDPWRSURYLGHEDVHOLQHGDWDRQZDWHUTXDOLW\DQGTXDQWLW\7KH 2SHUDWRU PXVWFRQWDFWWKH$2*&& WRREWDLQDGYDQFHDSSURYDORIVXFK D ZDWHUZHOOWHVWLQJSURJUDP :HOO/RJJLQJ 5HTXLUHPHQWV 5HJXODWLRQ$$& D DXWKRUL]HVWKH$2*&&WRVSHFLI\W\SHV RIZHOOORJVWREHUXQ,QDGGLWLRQWRWKHZHOOORJJLQJSURJUDPSURSRVHG E\ WKH2SHUDWRULQWKHDWWDFKHGDSSOLFDWLRQWKHIROORZLQJZHOOORJVDUH DOVRUHTXLUHGIRUWKLVZHOO 3HU6WDWXWH$6 G % DQG5HJXODWLRQ$$& FRPSRVLWHFXUYHVIRU DOO ZHOOORJVUXQPXVWEHVXEPLWWHGWRWKH$2*&& ZLWKLQ GD\VDIWHUFRPSOHWLRQVXVSHQVLRQRUDEDQGRQPHQWRIWKLV ZHOORUZLWKLQ GD\VRIDFTXLVLWLRQRIWKHGDWDZKLFKHYHURFFXUVILUVW *UHDWHU 0RRVHV 7RRWK ; ; 5HQGH]YRXV 2LO *078 07$ ; WELL PERMIT CHECKLISTCompanyConocoPhillips Alaska, Inc.Well Name:GMTU MT7-06AInitial Class/TypeDEV / PENDGeoArea890Unit10750On/Off ShoreOnProgramDEVField & PoolWell bore segAnnular DisposalPTD#:2221080GRTR MOOSES TOOTH, RENDEZV OIL - 28220NA1Permit fee attachedYes2Lease number appropriateYes3Unique well name and numberYes4Well located in a defined poolYes5Well located proper distance from drilling unit boundaryYes6Well located proper distance from other wellsYes7Sufficient acreage available in drilling unitYesMuch appreciated! DLB8If deviated, is wellbore plat includedYes9Operator only affected partyYes10Operator has appropriate bond in forceYes11Permit can be issued without conservation orderYes12Permit can be issued without administrative approvalYes13Can permit be approved before 15-day waitNA14Well located within area and strata authorized by Injection Order # (put IO# in comments) (For NA15All wells within 1/4 mile area of review identified (For service well only)NA16Pre-produced injector: duration of pre-production less than 3 months (For service well only)NA17Nonconven. gas conforms to AS31.05.030(j.1.A),(j.2.A-D)NA18Conductor string providedNA19Surface casing protects all known USDWsNA20CMT vol adequate to circulate on conductor & surf csgNo21CMT vol adequate to tie-in long string to surf csgNoProductive interval will be completed with uncemented frac sleeves/swell packers22CMT will cover all known productive horizonsYes23Casing designs adequate for C, T, B & permafrostYes24Adequate tankage or reserve pitYesPTD 221-048, Sundry 322-48825If a re-drill, has a 10-403 for abandonment been approvedYesAnti-collision analysis complete; no major risk failures26Adequate wellbore separation proposedNA27If diverter required, does it meet regulationsYesMax formation pressure is 3839 psig(8.9 ppg EMW); will drill w/ 8.8-12.0 ppg EMW28Drilling fluid program schematic & equip list adequateYes29BOPEs, do they meet regulationYesMPSP is 2925 psig; will test BOPs to 3500 psig30BOPE press rating appropriate; test to (put psig in comments)Yes31Choke manifold complies w/API RP-53 (May 84)Yes32Work will occur without operation shutdownNo33Is presence of H2S gas probableNA34Mechanical condition of wells within AOR verified (For service well only)YesH2S not expected; rig has sensors and alarms.35Permit can be issued w/o hydrogen sulfide measuresYes36Data presented on potential overpressure zonesNA37Seismic analysis of shallow gas zonesNA38Seabed condition survey (if off-shore)NA39Contact name/phone for weekly progress reports [exploratory only]ApprDLBDate8/18/2022ApprVTLDate8/25/2022ApprDLBDate8/18/2022AdministrationEngineeringGeologyGeologic Commissioner:Date:Engineering Commissioner:DatePublic CommissionerDate-03
