The URL can be used to link to this page

Home My WebLink About186-057Suspended Well Inspection Review Report Reviewed By: P.I. Suprv Comm ________ JBR 09/15/2025 InspectNo:susSTS250729160116 Well Pressures (psi): Date Inspected:7/26/2025 Inspector:Sully Sullivan If Verified, How?Other (specify in comments) Suspension Date:9/5/2012 #312-087 Tubing:251 IA:405 OA:16 Operator:Hilcorp North Slope, LLC Operator Rep:Andy Ogg Date AOGCC Notified:7/25/2025 Type of Inspection:Subsequent Well Name:PRUDHOE BAY UN LIS LGI-08 Permit Number:1860570 Wellhead Condition No signs of leaks , valves operated and guages were readable Surrounding Surface Condition Clean well kept Condition of Cellar No signs of contaminents or subsidence Comments Location verified by well pad plot map Supervisor Comments Photos (2) attached Suspension Approval:Sundry Location Verified? Offshore? Fluid in Cellar? Wellbore Diagram Avail? Photos Taken? VR Plug(s) Installed? BPV Installed? Monday, September 15, 2025 9 9 9 9 9 9 9 9 9 9 9 9 9 9 2025-0726_Suspend_PBU_LGI-08_photos_ss Page 1 of 1 Suspended Well Inspection – PBU LGI-08 PTD 1860570 AOGCC Inspection Rpt # susSTS250729160116 Photos by AOGCC Inspector S. Sullivan 7/26/2025 7. Property Designation (Lease Number): 1. Operations Performed: 2. Operator Name: 3. Address: 4. Well Class Before Work:5. Permit to Drill Number: 6. API Number: 8. Well Name and Number: 9. Logs (List logs and submit electronic data per 20AAC25.071): 10. Field/Pool(s): Susp Well Insp Install Whipstock Mod Artificial Lift Perforate New Pool Perforate Plug Perforations Coiled Tubing Ops Other Stimulate Fracture Stimulate Alter Casing Pull Tubing Repair Well Other: Change Approved Program Operations shutdown 11. Present Well Condition Summary: Casing Length Size MD TVD Burst Collapse Exploratory Stratigraphic Development Service 14. Attachments (required per 20 AAC 25.070, 25.071, & 25.283) 16. Well Status after work: 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. OIL GAS WINJ WAG GINJ WDSPL GSTOR Suspended SPLUG Authorized Name and Digital Signature with Date: Authorized Title: Contact Name: Contact Email: Contact Phone: PBU LGI-08 Hilcorp North Slope, LLC 3800 Centerpoint Dr, Suite 1400, Anchorage, AK 99503 186-057 50-029-21562-00-00 13423 Conductor Surface Intermediate Liner 9409 80 4323 11931 1669 9000 20" 13-3/8" 9-5/8" 7" 6721 40 - 120 38 - 4361 35 - 11966 11753 - 13422 40 - 120 38 - 3979 35 - 8477 8355 - 9408 12334 470 2670 4760 7020 9000, 11700, 11925, 12611 1490 5380 6870 8160 12418 - 12930 2-7/8" 6.5# L-80 32 - 12408, 12590 - 12624 8748 - 9071 Structural 2-7/8" BOT HB Packer, 2-7/8" BOT I-B Packers (2) 2143, 2143 11708, 12389, 12590 8328, 8730, 8854 Dave Bjork for Bo York Operations Manager Andy Ogg andrew.ogg@hilcorp.com 907-659-5102 PRUDHOE BAY, LISBURNE OIL Total Depth Effective Depth measured true vertical feet feet feet feet measured true vertical measured measured feet feet feet feet measured true vertical Plugs Junk Packer Measured depth True Vertical depth feet feet Perforation depth Tubing (size, grade, measured and true vertical depth) Packers and SSSV (type, measured and true vertical depth) 12. Stimulation or cement squeeze summary: Intervals treated (measured): Treatment descriptions including volumes used and final pressure: 13a.Representative Daily Average Production or Injection Data Oil -Bbl Gas-Mcf Water -Bbl Casing Pressure Tubing Pressure Prior to well operation: Subsequent to operation: 15. Well Class after work: Exploratory Development Service StratigraphicDaily Report of Well Operations Copies of Logs and Surveys Run Electronic Fracture Stimulation Data Sundry Number or N/A if C.O. Exempt: ADL 0028301, 0028302, 0034628 32 - 8742, 8854 - 8875 N/A N/A 147 405 475 251 N/A 13b. Pools active after work:Lisburne Oil 2-7/8" Camco TRDP-1A SSSV 11708, 8328 / 12389, 8730 / 12590, 8854 STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS Sr Pet Eng: Sr Pet Geo: Form 10-404 Revised 10/2022 Submit in PDF format to aogcc.permitting@alaska.gov Sr Res Eng: Due Within 30 days of Operations By Gavin Gluyas at 3:54 pm, Aug 14, 2025 Digitally signed by David Bjork (3888) DN: cn=David Bjork (3888) Date: 2025.08.14 15:35:09 - 08'00' David Bjork (3888) RBDMS JSB 081825 J.Lau 11/4/25 ACTIVITY DATE SUMMARY 7/26/2025 T/I/O = 250/410/20. Temp = SI. AOGCC SU well inspection (AOGCC witnessed by Sully Sullivan). No flowline. Pictures taken. SV = C. WV = LOTO. SSV = C. MV = O. IA, OA = OTG. 09:00 Daily Report of Well Operations PBU LGI-08 Submit to: OOPERATOR: FIEL DD // UNITT // PAD: DATE: OPERATORR REP: AOGCCC REP: Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD 1860570 Type Inj W Tubing 495 2502 2453 2435 Type Test P Packer TVD BBL Pump 4.3 IA 620 2496 2446 2429 Interval O Test psi BBL Return 4.3 OA 10 10 21 21 Result P Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result Well Pressures: Pretest Initial 15 Min. 30 Min. 45 Min. 60 Min. PTD Type Inj Tubing Type Test Packer TVD BBL Pump IA Interval Test psi BBL Return OA Result TYPE INJ Codes TYPE TEST Codes INTERVAL Codes Result Codes W = Water P = Pressure Test I = Initial Test P = Pass G = Gas O = Other (describe in Notes) 4 = Four Year Cycle F = Fail S = Slurry V = Required by Variance I = Inconclusive I = Industrial Wastewater O = Other (describe in notes) N = Not Injecting Notes: STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION MMec hanicall Integrityy Tes t jim.regg@alaska.gov;AOGCC.Inspectors@alaska.gov;phoebe.brooks@alaska.gov chris.wallace@alaska.gov Notes: Notes: Notes: Hilcorp Alaska LLC Prudhoe Bay / PBU / LGI Pad Ryan Holt 06/01/22 Notes:Non Witnessed Suspended well CMIT-TxIA to verify plug and casing integrity Notes: Notes: Notes: LGI-08 Form 10-426 (Revised 01/2017)2022-0601_MIT_PBU_LGI-08 9 9 9 9 9 9 +LOFRUS1RUWK6ORSH//& -5HJJ Suspended well CMIT-TxIA CAUTION: This email originated from outside the State of Alaska mail system. Do not click links or open attachments unless you recognize the sender and know the content is safe. From:Oliver Sternicki To:Rixse, Melvin G (OGC) Cc:PB Wells Integrity Subject:RE: [EXTERNAL] RE: LGI-08 (PTD# 186057), 13-05 (PTD# 181103). Suspended wells with slow IA repressurization. Attachments:image001.png image002.png image003.png image004.png image005.png image006.png Mel, The tests were not witnessed. On LGI-08 the renewal application is due 7/5/2022, the last inspection was on 6/28/2020. If I turn the renewal in a week early we are going to be just within the 24 month window, but due to what is going on with the well I have a new inspection scheduled in the next few weeks. On 13-05 the renewal application is due by 09/24/2022, the last inspection was on 7/6/2019. We are planning on getting another inspection on this well in the next few weeks. Any idea when the new SU regs are going to come out? Oliver Sternicki Hilcorp Alaska, Hilcorp North Slope LLC Well Integrity Engineer Office: (907) 564 4891 Cell: (907) 350 0759 Oliver.Sternicki@hilcorp.com From: Rixse, Melvin G (OGC) <melvin.rixse@alaska.gov> Sent: Friday, June 3, 2022 10:25 AM To: Oliver Sternicki <Oliver.Sternicki@hilcorp.com> Cc: PB Wells Integrity <PBWellsIntegrity@hilcorp.com> Subject: [EXTERNAL] RE: LGI-08 (PTD# 186057), 13-05 (PTD# 181103). Suspended wells with slow IA repressurization. Oliver, A couple of questions: 1. Did anyone from the state witness the MITs on Wednesday? 2. I believe these wells fall into the old regs, i.e., inspections every 5 years and a renewal of suspension before 10 years. So do we have well inspections within the last 24 months? Mel Rixse Senior Petroleum Engineer (PE) Alaska Oil and Gas Conservation Commission 907-793-1231 Office 907-223-3605 Cell CONFIDENTIALITY NOTICE: This e-mail message, including any attachments, contains information from the Alaska Oil and Gas Conservation Commission (AOGCC), State of Alaska and is for the sole use of the intended recipient(s). It may contain confidential and/or privileged information. The unauthorized review, use or disclosure of such information may violate state or federal law. If you are an unintended recipient of this e-mail, please delete it, without first saving or forwarding it, and, so that the AOGCC is aware of the mistake in sending it to you, contact Mel Rixse at (907-793-1231 ) or (Melvin.Rixse@alaska.gov). From: Oliver Sternicki <Oliver.Sternicki@hilcorp.com> Sent: Thursday, June 2, 2022 10:28 AM To: Rixse, Melvin G (OGC) <melvin.rixse@alaska.gov> Cc: PB Wells Integrity <PBWellsIntegrity@hilcorp.com> Subject: RE: LGI-08 (PTD# 186057), 13-05 (PTD# 181103). Suspended wells with slow IA repressurization. Mel, Passing CMIT-TxIA pressure tests were conducted on both LGI-08 and 13-05 yesterday: LGI-08: 13-05: Attached are the 10-426 forms for these tests due to the unique nature of them. Next step on this is to bleed the tubing and IA down to ~100psi and monitor. We are currently reviewing the future utility of these 2 wells for the potential suspension renewals. Regarding my question to you about the 20AAC25.110(k) requirement for a report within 5 working days of notification. I did some digging and found that there is historic precedent from MPL-35A back in 2015 for the email communication to the AOGCC sufficing as the required “report”. Let me know your thoughts on this. Being how these wells have been inactive for so long and all previous work to convert to suspended status was under sundry, any pertinent historic info would be in AOGCC’s Data Miner. Oliver Sternicki Hilcorp Alaska, Hilcorp North Slope LLC Well Integrity Engineer Office: (907) 564 4891 Cell: (907) 350 0759 Oliver.Sternicki@hilcorp.com From: Oliver Sternicki Sent: Tuesday, May 31, 2022 1:55 PM To: Rixse, Melvin G (OGC) <melvin.rixse@alaska.gov> Cc: PB Wells Integrity <PBWellsIntegrity@hilcorp.com> Subject: LGI-08 (PTD# 186057), 13-05 (PTD# 181103). Suspended wells with slow IA repressurization. Mel, Suspended wells LGI-08 (PTD# 186057) and 13-05 (PTD# 181103) are coming up for renewal over the course of the next couple months. While reviewing these wells for the renewal application, I found that both wells show very slow IA repressurization since they were suspended back in 2012. Both wells have reservoir plugs in them, no surface lines or blinded surface lines, and IA fluid levels at surface. LGI-08 previously passed a CMIT-TxIA to 2500 psi on 9/5/2012. 13-05 passed a CMIT-TxIA to 2500 psi on 11/24/2012. Per 20AAC25.110(j) we are immediately notifying you that there is potential fluid migration occurring into the IA of these wells. Our plan forward is to CMIT-TxIA these wells to 2500 psi max applied pressure to verify the production casing and cement top integrity. I will relay the results to you when the tests are completed and we can discuss further steps if necessary. Let me know if you have any questions Oliver Sternicki Hilcorp Alaska, Hilcorp North Slope LLC Well Integrity Engineer Office: (907) 564 4891 Cell: (907) 350 0759 Oliver.Sternicki@hilcorp.com LGI-08: 13-05: The information contained in this email message is confidential and may be legally privileged and is intended only for the use of the individual or entity named above. If you are not an intended recipient or if you have received this message in error, you arehereby notified that any dissemination, distribution, or copy of this email is strictly prohibited. If you have received this email in error, please immediately notify us by return email or telephone if the sender's phone number is listed above, then promptly andpermanently delete this message. While all reasonable care has been taken to avoid the transmission of viruses, it is the responsibility of the recipient to ensure that the onward transmission, opening, or use of this message and any attachments will not adversely affect its systems or data. Noresponsibility is accepted by the company in this regard and the recipient should carry out such virus and other checks as it considers appropriate. ,ISHUIRUDWLQJ 7\SHRI5HTXHVW 2SHUDWRU1DPH $GGUHVV &XUUHQW:HOO&ODVV3HUPLWWR'ULOO1XPEHU $3,1XPEHU :HOO1DPHDQG1XPEHU 3URSHUW\'HVLJQDWLRQ/HDVH1XPEHU)LHOG3RROV $EDQGRQ 6XVSHQG 3OXJIRU5HGULOO 3HUIRUDWH1HZ3RRO 3HUIRUDWH 3OXJ3HUIRUDWLRQV 5HHQWHU6XVS:HOO 2WKHU6WLPXODWH )UDFWXUH6WLPXODWH $OWHU&DVLQJ 3XOO7XELQJ 5HSDLU:HOO 2WKHU &KDQJH$SSURYHG3URJUDP 2SHUDWLRQVVKXWGRZQ :KDW5HJXODWLRQRU&RQVHUYDWLRQ2UGHUJRYHUQVZHOOVSDFLQJLQWKHVSRRO" :LOOSODQQHGSHUIRUDWLRQVUHTXLUHDVSDFLQJH[FHSWLRQ"<HV 1R 7RWDO'HSWK0'IW 7RWDO'HSWK79'IW (IIHFWLYH'HSWK0' (IIHFWLYH'HSWK79' 0363SVL 3OXJV0' -XQN0' 35(6(17:(//&21',7,216800$5< 3HUIRUDWLRQ'HSWK0'IW 3HUIRUDWLRQ'HSWK79'IW7XELQJ6L]H 7XELQJ*UDGH 7XELQJ0'IW 3DFNHUVDQG66697\SH3DFNHUVDQG66690'IWDQG79'IW &DVLQJ /HQJWK 6L]H 0' 79' %XUVW &ROODSVH ([SORUDWRU\ 6WUDWLJUDSKLF 'HYHORSPHQW 6HUYLFH $WWDFKPHQWV (VWLPDWHG'DWHIRU &RPPHQFLQJ2SHUDWLRQV :HOO&ODVVDIWHUSURSRVHGZRUN :HOO6WDWXVDIWHUSURSRVHGZRUN 9HUEDO$SSURYDO ,KHUHE\FHUWLI\WKDWWKHIRUHJRLQJLVWUXHDQGWKHSURFHGXUHDSSURYHGKHUHLQZLOOQRWEHGHYLDWHGIURPZLWKRXWSULRUZULWWHQDSSURFDO 3URSRVDO6XPPDU\:HOOERUHVFKHPDWLF %236NHWFK'HWDLOHG2SHUDWLRQV3URJUDP 2,/ *$6 :,1- :$* *,1- :'63/ *6725 2S6KXWGRZQ 6XVSHQGHG 63/8* $EDQGRQHG 6HUYLFH'HYHORSPHQW6WUDVWLJUDSKLF([SORUDWRU\ $XWKRUL]HG1DPHDQG 'LJLWDO6LJQDWXUHZLWK'DWH $XWKRUL]HG7LWOH &RQWDFW1DPH &RQWDFW(PDLO &RQWDFW3KRQH $2*&&86(21/< &RPPLVVLRQ5HSUHVHQWDWLYH &RQGLWLRQVRIDSSURYDO1RWLI\&RPPLVVLRQVRWKDWDUHSUHVHQWDWLYHPD\ZLWQHVV 6XQGU\1XPEHU /RFDWLRQ&OHDUDQFH0HFKDQLFDO,QWHJULW\7HVW%237HVW3OXJ,QWHJULW\ 2WKHU 3RVW,QLWLDO,QMHFWLRQ0,75HT G" 6SDFLQJ([FHSWLRQ5HTXLUHG"<HV <HV 1R 1R 6XEVHTXHQW)RUP5HTXLUHG $SSURYHG%\'DWH $33529('%< 7+($2*&&&200,66,21(5 /,6%/*, 6XVSHQGHG5HQHZDO +LOFRUS1RUWK6ORSH//& &HQWHUSRLQW'U6XLWH $QFKRUDJH$. $'/ &RQGXFWRU 6XUIDFH ,QWHUPHGLDWH /LQHU /LQHU 1$ / 6WUXFWXUDO %27+%%27,% &DPFR75'3$ 'DWH %R<RUN 2SHUDWLRQV0DQDJHU 2OLYHU6WHUQLFNL 2OLYHU6WHUQLFNL#KLOFRUSFRP 358'+2(%$</,6%851(2,/ 67$7(2)$/$6.$ $/$6.$2,/$1'*$6&216(59$7,21&200,66,21 $33/,&$7,21)25681'5<$33529$/6 $$& &RPP &RPP6U3HW(QJ 6U3HW*HR 6U5HV(QJ )RUP5HYLVHG$SSURYHGDSSOLFDWLRQLVYDOLGIRUPRQWKVIURPWKHGDWHRIDSSURYDO By Samantha Carlisle at 10:03 am, Jun 23, 2022 'LJLWDOO\VLJQHGE\%R<RUN '1FQ %R<RUNRX 8VHUV 'DWH ; 0*5-81'/%'65 $'/ $'/ '/% GWV -/& Jeremy Price Digitally signed by Jeremy Price Date: 2022.06.28 13:17:17 -08'00' RBDMS JSB 070522 +LOFRUS1RUWK6ORSH//& %R<RUN 3%( 2SHUDWLRQV0DQDJHU &HQWHUSRLQW'U6XLWH $QFKRUDJH$ODVND &KDLUPDQ-HUHP\3ULFH $ODVND2LODQG*DV&RQVHUYDWLRQ&RPPLVVLRQ :HVWWK $YHQXH $QFKRUDJH$ODVND 6XEMHFW /LVEXUQHZHOO /*, 37' $SSOLFDWLRQIRU5HQHZDORI([LVWLQJ6XVSHQVLRQ 'HDU&KDLUPDQ 3ULFH $Q $2*&&ZLWQHVVHGVXVSHQGHGZHOOLQVSHFWLRQRI/LVEXUQH ZHOO/*,ZDVFRQGXFWHGRQ $$&K7KH VXEPLWWHGVXVSHQGHGZHOOLQVSHFWLRQUHIOHFWVWKHFXUUHQW FRQGLWLRQRIWKHZHOOUHIHUHQFH$$&IDQGVXSSRUWVWKHUHTXHVWIRUUHQHZDORI VXVSHQVLRQ5HFHQWHYHQWVIURPWKLVZHOOLQGLFDWHWKDWWKLVZHOOLVPHFKDQLFDOO\VRXQG6SHFLILF DWWDFKPHQWVLQFOXGH x 6XVSHQGHG:HOO6LWH,QVSHFWLRQIRUPGRFXPHQWLQJWKHSUHVVXUHVDQGVLWHFRQGLWLRQ x :HOOERUHGLDJUDPLOOXVWUDWLQJWKHFXUUHQWFRQILJXUDWLRQRIWKHZHOO /LVEXUQH ZHOO /*, ZDVVXVSHQGHGRQ DQGKDVIXWXUHXWLOLW\DVDULJVLGHWUDFN FDQGLGDWH 7KHVWUDWDWKURXJKZKLFKWKHZHOOZDVGULOOHGLVQHLWKHUDEQRUPDOO\JHRSUHVVXUHGRU GHSOHWHG7KHZHOOLV PHFKDQLFDOO\VRXQGDQGVHFXUHGZLWK DSDVVLQJSUHVVXUHWHVWRIWKH SURGXFWLRQFDVLQJDQGWXELQJ,$FHPHQWWRS WR SVLRQ DQGDJDLQRQ WR SVL %DVHGRQWKHVHFRQGLWLRQVDQGWKHLQVSHFWLRQRQ /LVEXUQH ZHOO/*, PHHWVWKHSURYLVLRQVUHTXLUHGLQ$$&D +LOFRUS1RUWK6ORSH//& UHTXHVWVDSSURYDOIRUUHQHZDORIWKHH[LVWLQJVXVSHQVLRQVWDWXVIRUWKLV ZHOO$WWDFKHGLVDQ$SSOLFDWLRQIRU6XQGU\$SSURYDOZLWKDWHFKQLFDOMXVWLILFDWLRQ VXPPDUL]LQJWKHLQIRUPDWLRQRQWKHFXUUHQWVWDWXVDQGFRQGLWLRQRIWKHZHOOUHIHUHQFH$$& DEHK ,QVXPPDU\+LOFRUS EHOLHYHV /LVEXUQH ZHOO/*, LVPHFKDQLFDOO\VRXQGDQGVHFXUHDQGPHHWV WKHUHTXLUHPHQWVIRUUHQHZDORIVXVSHQGHGVWDWXV ,I\RXKDYHDQ\TXHVWLRQVSOHDVHFDOOPHDW RU2OLYHU6WHUQLFNLDW 6LQFHUHO\ %R<RUN 3%( 2SHUDWLRQV0DQDJHU $WWDFKPHQWV 7HFKQLFDO-XVWLILFDWLRQ 6XVSHQGHG:HOO6LWH,QVSHFWLRQIRUP :HOOERUH6FKHPDWLF 'LJLWDOO\VLJQHGE\%R<RUN '1FQ %R<RUNRX 8VHUV 'DWH /LVEXUQH:HOO/*,37' 7HFKQLFDO-XVWLILFDWLRQIRU5HQHZDORI6XVSHQGHG6WDWXV :HOO+LVWRU\DQG6WDWXV /LVEXUQHZHOO/*,37'ZDVGULOOHGDQGFRPSOHWHGDVDSURGXFHULQ2FWREHURI 7KHZHOOZDVVKXWLQLQ-XO\GXHWRWXELQJE\LQQHUDQQXOXVFRPPXQLFDWLRQDQG UHPDLQHGLGOHXQWLOLWZDVVXVSHQGHGRQSHUVXQGU\2QD &0,77[,$WHVWLQJWKHSURGXFWLRQFDVLQJDQGWKHWXELQJ,$FHPHQWWRSDW¶0'SDVVHGWR SVL$SDVVLQJ&0,77[,$WRSVLZDVDOVRFRQGXFWHGRQ 7KHZHOOIXWXUHXWLOLW\LVDVDVLGHWUDFNFDQGLGDWH7KHZHOOZLOOQRWDOORZWKHPLJUDWLRQRIIOXLGV ZLOOQRWGDPDJHIUHVKZDWHURUSURGXFLQJRUSRWHQWLDOO\SURGXFLQJIRUPDWLRQVZLOOQRWLPSDLUWKH UHFRYHU\RIRLORUJDVDQGLVVHFXUHVDIHDQGQRWDWKUHDWWRSXEOLFKHDOWK7KHVWUDWDWKURXJK ZKLFKWKHZHOOZDVGULOOHGLVQHLWKHUDEQRUPDOO\JHRSUHVVXUHGRUGHSOHWHG &RQGLWLRQRIWKH:HOOKHDGDQG6XUIDFH/RFDWLRQ /LVEXUQHZHOO/*,LVORFDWHGRQDQDFWLYHZHOOPDLQWDLQHGSDGZLWKFOHDQJUDYHO7KHSLWDQG VXUURXQGLQJDUHDDUHLQJRRGFRQGLWLRQ7KHUHLVQRGLVFRORUDWLRQDQGQRVKHHQVRQWKHSDG SLWVRULQQHDUE\ZDWHU 7KHZHOOSUHVVXUHUHDGLQJVDUH7,2 SVL 5HTXHVW +LOFRUS1RUWK6ORSH//&UHTXHVWVDSSURYDOIRUUHQHZDORIWKHH[LVWLQJVXVSHQVLRQVWDWXVIRU /*, $YDULDQFHWRWKHSURYLVLRQVRI$$&FLVDOVRUHTXHVWHGXQGHU$$&L WRDOORZWKHZHOOWRUHPDLQDVVXVSHQGHGLQLWVFXUUHQWFRQGLWLRQ$OOK\GURFDUERQLQWHUYDOVDUH LVRODWHGDQGWKHUHDUHQRXQGHUJURXQGVRXUFHVRIIUHVKZDWHULQWKLVDUHD Suspended Well Inspection Review Report Reviewed By: P.I. Suprv Comm ________ JBR 06/21/2022 InspectNo:susMFH220606130737 Well Pressures (psi): Date Inspected:6/5/2022 Inspector:Matt Herrera If Verified, How?LAT / LONG Suspension Date:9/5/2012 #312-087 Tubing:475 IA:197 OA:8 Operator:Hilcorp North Slope, LLC Operator Rep:Ryan Holt Date AOGCC Notified:6/4/2022 Type of Inspection:Subsequent Well Name:PRUDHOE BAY UN LIS LGI-08 Permit Number:1860570 Wellhead Condition A little dirty with Grease and Hydraulic fluid. SSV barrel seal leaking slightly creating small stain on surrounding gravel. Cellar filled. All valves and gauges operational, with SSV in closed position. Wing valve also in the closed position and LO/TO Surrounding Surface Condition Good, No debris and no subsidence. Flowlines disconnected. Condition of Cellar Cellar filled to pad grade. Small hydraulic oil stain on snow and gravel surrounding wellhead. No other debris or anomalies apparent. Comments Operations addressed hydraulic oil stain cleanup and will service SSV to mitigate hydraulic oil leak. Well house on well. Supervisor Comments Suspension Approval:Sundry Location Verified? Offshore? Fluid in Cellar? Wellbore Diagram Avail? Photos Taken? VR Plug(s) Installed? BPV Installed? Tuesday, June 21, 2022 9 9 9 9 9 3KRWRV$WWDFKHG 2022-0605_Suspend_PBU_LGI-08_photos_mhPage 1 of 3 Suspended Well Inspection – PBU LGI-08 PTD 1860570AOGCC Inspect # susMFH220606130737 Photos by AOGCC Inspector M. Herrera6/5/2022 2022-0605_Suspend_PBU_LGI-08_photos_mhPage 2 of 3 2022-0605_Suspend_PBU_LGI-08_photos_mh Page 3 of 3 Operator Name:2. Development Exploratory Service 5 Permit to Drill Number:186-057 6.50-029-21562-00-00 PRUDHOE BAY, LISBURNE OIL Hilcorp North Slope, LLC 5. Well Name and Number:8. 10.Field/Pools: Well Class Before Work4. Present Well Condition Summary:11. Total Depth: measured feet feet Plugs measured feet feet Effective Depth: measured feet feet Packer measured feet feettrue vertical true vertical 13423 9000 6721 12334 2145, 8329, 8731, Casing: Length: Size: MD: TVD: Burst: Collapse: Structural Conductor 80 20" 40 - 120 40 - 120 1490 470 Surface 4323 13-3/8" 41 - 4364 41 - 3981 5380 2670 Intermediate 11931 9-5/8" 37 - 11968 37 - 8478 6870 4760 Production Perforation Depth: Measured depth: 12418 -12930 feet True vertical depth:8748 - 9071 feet Tubing (size, grade, measured and true vertical depth)2-7/8" 6.5# L-80 35 - 12412 35 - 8744 Packers and SSSV (type, measured and true vertical depth) Liner See Attachment See Attachment See Attachment See Attachment See Attachment See Attachment 12. Stimulation or cement squeeze summary: Intervals treated (measured): Oil-Bbl Gas-Mcf Water-Bbl Casing Pressure Tubing Pressure 60007276 00 0 6918 0 0 Representative Daily Average Production or Injection Data Prior to well operation: Subsequent to operation: 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. Contact Name: Contact Email: Ryan Holt Ryan.Holt@hilcorp.com Authorized Name:Bo York Authorized Title: Authorized Signature with Date:Contact Phone:659-5102 Treatment descriptions including volumes used and final pressure: 13. Operations Manager Operations Performed1. Abandon Plug Perforations Fracture Stimulate Pull Tubing GSTOR WINJ WAG GINJ SUSP 5 SPLUG 16. Well Status after work:Oil 5 Gas Exploratory Development 5 Stratigraphic 15. Well Class after work: Service WDSPL 14. Attachments: (required per 20 AAC 25.070.25.071, & 25.283) Daily Report of Well Operations Copies of Logs and Surveys Run true vertical measured9409 Sundry Number or N/A if C.O. Exempt: 2-7/8" Camco TRDP-1A SSV 2146 2145 Junk Packer Printed and Electronic Fracture Stimulation Data 5 Operations shutdown Change Approved Program 5 Senior Pet Engineer:Senior Res. Engineer: STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS Suspend Perforate Other Stimulate Alter Casing Plug for Redrill Perforate New Pool Repair Well Re-enter Susp Well 3.Address: 3800 Centerpoint Dr, Suite 1400, Anchorage, AK 99503 7.Property Designation (Lease Number):LISB LGI-08 9. Logs (List logs and submit electronic and printed data per 20AAC25.071): Stratigraphic Other: API Number: Form 10-404 Revised 03/2020 Submit Within 30 days of Operations 11700, 11925, 12611 11710,12391,12592 Suspended Well Inspection 034628 By Samantha Carlisle at 3:58 pm, Aug 04, 2020 Digitally signed by Bo York DN: cn=Bo York, c=US, o=HIlcorp Alaska LLC, ou=Alaska North Slope, email=byork@hilcorp.com Date: 2020.08.04 15:50:35 -08'00' Bo York ADL SFD 8/5/2020RBDMS HEW 8/5/2020 SFD 8/5/2020 , ADL 028302, ADL 028301 DSR-8/6/2020MGR10AUG2020 SFD 8/5/2020 ACTIVITYDATE SUMMARY 6/28/2020 T/I/O = 500/600/0. Temp = SI. SU well inspection (AOGCC witnessed by Bob Noble). No flowline. Pictures taken. SV = C. WV = LOTO. SSV = C. MV = O. IA, OA = OTG. 1050. Daily Report of Well Operations PBU LGI-08 Casing Length Size Burst CollapseCONDUCTOR 80 20" 91.5# H-40 40 - 120 40 - 120 1490 470SURFACE 20 13-3/8" 68# K-55 41 - 61 41 - 61SURFACE 4303 13-3/8" 72# L-80 61 - 4364 61 - 3981 5380 2670INTERMEDIATE 11931 9-5/8" 47# L-80 37 - 11968 37 - 8478 6870 4760LINER 1668 7" 29# L-80 11756 - 13424 8357 - 9410 8160 7020LINER 35 2-7/8" 6.5# L-80 12592 - 12627 8855 - 8877 10570 11160TUBING 12377 2-7/8" 6.5# L-80 35 - 12412 35 - 8744 10570 11160SSSV 82-7/8" Camco TRDP-1A SSV2146 - 2154 2145 - 2153 20000PACKER 8 2-7/8" BOT HB Packer 11710 - 11718 8329 - 8334PACKER 4 2-7/8" BOT I-B Packer 12391 - 12395 8731 - 8733NIPPLE 1 AVA Nipple 12406 - 12407 8740 - 8741PACKER 4 2-7/8" BOT I-B Packer 12592 - 12596 8855 - 8857NIPPLE 1 CAMCO "D" Nipple 12614 - 12615 8869 - 8870MD TVDCasing / Tubing AttachmentPBU LGI-08 Suspended Well Site Inspection Form Notify AOGCC Inspectors at least 10 days prior to inspection to allow witness Well Name:LGI-08 Field/Pool: Prudhoe Bay / Lisburne Oil Permit # (PTD):1860570 API Number: Operator:BP EXPLORATION (ALASKA) INC Date Suspended: 9/5/2012 Surface Location:Section: 1 Twsp: 11N Range: 14E Nearest active pad or road:LGI Pad Take to Location Digital camera Map showing well location /Aerial photos Brief well history Wellbore diagram showing downhole condition Latest Sundry or Completion report Past Site Visit documentation Site clearance documentation Pressure gauges, fittings, tools Sample containers for fluids on or near pad Condition of Surface Location AOGCC requires: 1) a description of the condition of the surface location, including discoloration, fluids or sheens visible on the ground or in any nearby water, 2) photographs showing the condition of the location surrounding the well General location condition: Good Pad or location surface: Good Location cleanup needed: None Pits condition: Good Surrounding area condition: Good Water/fluids on pad: None Discoloration, Sheens on pad, pits or water: None Samples taken: None Access road condition: Good Photographs taken (# and description): 5 - Wellhead, wellhouse, tree & area behind wellhouse Condition of Wellhead AOGCC requires: 1) a description of the condition of the wellhead, 2) well pressure readings, where practicable, 3) photographs showing the wellhead condition Wellhead/tree/valve description, condition: FMC Wellhead / Tree good condition Cellar description, condition, fluids: Dry gravel Rat Hole: Good Wellhouse or protective barriers: Good Well identification sign: Good Tubing Pressure (or casing if no tubing): 500 psi Annulus pressures: IA - 600 psi OA - 0 psi Wellhead Photos taken (# and description): 2 - Wellhead & tree Work Required: None Operator Rep (name and signature):Ryan Holt AOGCC Inspector: Bob Noble Other Observers: Randy Mork Inspection Date: 6/28/2020 AOGCC Notice Date: 6/26/2020 Time of arrival: 10:30 AM Time of Departure: 10:40 AM Site access method: Drive 50029215620000 Re-Inspection Suspended Well Inspection Review Report InspectNo: susRCN200630144826 Date Inspected: 6/28/2020 Inspector: Bob Noble Type of Inspection: Well Name: PRUDHOE BAY UN LIS LGI-08 Permit Number: 1860570 Suspension Approval: Sundry 4 312-087 Suspension Date: 9/5/2012 Location Verified? W If Verified, How? Other (specify in comments) Offshore? ❑ Subsequent Date AOGCC Notified: 6/26/2020 Operator: BP Exploration (Alaska) Inc. Operator Rep: Ryan Holt Wellbore Diagram Avail? ❑D Photos Taken? ❑O Well Pressures (psi): Tubing: 500 Fluid in Cellar? ❑ IA: 600 BPV Installed? ❑ OA: 0 VR Plug(s) Installed? ❑ Wellhead Condition Wellhead is in good condition. No flowline; all lines blinded with gauges. Condition of Cellar Good clean gravel Surrounding Surface Condition Good clean gravel Comments Location was verified with the use of a pad map Supervisor Comments Photos (3) .39C 11ZLt(ZaiL3 Tuesday, July 21, 2020 Suspended Well Inspection — PBU LGI-08 PTD 1860570 AOGCC Inspect # susRCN200630144826 Photos by AOGCC Inspector B. Noble 6/28/2020 WELL*=wLei0,8 OWNER Prudhoe Bay Unit OPERATOR API NUMBER SUR. LOCATION DRILLING PERMIT BP Exploration (Alaska) Ic. 50 -029 -21562 -00 -Or NE 1/4, Sec. 01, T11 R14E 186-057 2020-0628_Suspend_PBU_LGI-08_photos_bn.doex Page 1 of 2 3 - - - ., P 4i.....-'L,.Y rw.F W ft.,"I.r. STATE OF ALASKA H j 3 y ?015 • ALASKA OIL AND GAS CONSERVATION COM, ION REPORT OF SUNDRY WELL OPERAti. NS J ( � , 1. Operations Performed ° `�' Abandon 0 Plug Perforations 0 Fracture Stimulate 0 Pull Tubing 0 Operations shutdown 0 Suspend 0 Perforate 0 Other Stimulate 0 Alter Casing 0 Change Approved Program 0 Plug for Redrill 0 Perforate New Pool ❑ Repair Well 0 Re-enter Susp Well 0 Other:Suspend Well Ed IncnnMi.d 2. Operator Name: BP Exploration(Alaska),Inc 4. Well Class Before Work 5. Permit to Drill Number: 186-057 3. Address: P.O.Box 196612 Anchorage, Development 0 Exploratory ❑ AK 99519-6612 Stratigraphic 0 Service 0 6. API Number: 50-029-21562-00-00 7. Property Designation(Lease Number): ADL 0034628 8. Well Name and Number: LISB LGI-08 9. Logs(List logs and submit electronic and printed data per 20AAC25.071): 10. Field/Pools: PRUDHOE BAY,LISBURNE OIL 11.Present Well Condition Summary: Total Depth: measured 13423 feet Plugs measured See Attachment feet true vertical 9409 feet Junk measured 12334 feet Effective Depth: measured 9000 feet Packer measured See Attachment feet true vertical 6721 feet Packer true vertical See Attachment feet Casing: Length: Size: MD: TVD: Burst: Collapse: Structural Conductor 80 20"91.5#H-40 40-120 40-120 1490 470 Surface See Attachment See Attachment See Attachment See Attachment See Attachment See Attachment Intermediate 11931 9-5/8"47#L-80 37-11968 37-8478 6870 4760 Production Liner See Attachment See Attachment See Attachment See Attachment See Attachment See Attachment Perforation Depth: Measured depth: 12300-12350 feet 12389-12477 feet 12506-12550 feet 12640-12670 feet 12688-12704 feet 12748-12772 12792-12816 feet 12840-12876 feet 12920-12930 feet True vertical depth: 8675-8706 feet 8730-8784 feet 8802-8829 feet 8885-8904 feet 8915-8926 feet 8954-8969 8982-8997 feet 9013-9036 feet 9065-9071 feet Tubing(size,grade,measured and true vertical depth) 2-7/8"6.5#L-80 35-12412 35-8744 Packers and SSSV(type,measured and See Attachment See Attachment See Attachment true vertical depth) 2-7/8"Camco TRDP-1A SSV 2146 2145 12.Stimulation or cement squeeze summary: Intervals treated(measured): Treatment descriptions including volumes used and final pressure: SCANNE 13. Representative Daily Average Production or Injection Data Oil-Bbl Gas-Mcf Water-Bbl Casing Pressure Tubing Pressure Prior to well operation: 276 6918 7 0 600 Subsequent to operation: 0 0 0 0 0 14.Attachments:(required per 20 AAC 25.070 25 071,&25 283) 15.Well Class after work: Daily Report of Well Operations El Exploratory 0 Development ® Service 0 Stratigraphic 0 Copies of Logs and Surveys Run 0 16.Well Status after work: Oil 0 Gas 0 WDSPL 0 Printed and Electronic Fracture Stimulation Data 0 GSTOR 0 WINJ 0 WAG 0 GINJ 0 SUSP ® SPLUG 0 17.I hereby certify that the foregoing is true and correct to the best of my knowledge. Sundry Number or N/A if C.O.Exempt: Contact Catron,Garry R(Wipro) Email Garry.Catron@bp.com Printed Name Catron,Garry R(Wipro) Title PDC Principal Engineer Signature .,�j, f.t ( Phone +1 907 564 4424 Date 7/31/15 Form 10-404 Revised 5/2015 //7'� g/2/! .?u Su Original Only 7 / RBDM AUG 1 4 2015 Plugs Attachement LISB LGI-08 SW Name Date MD Description LGI-08 07/13/2012 11700 2-7/8"WFD Cement Retainer Plug LGI-08 01/10/1994 11925 PX Plug LGI-08 11/27/1986 12611 CA-2 Plug Packers and SSV's Attachment LISB LGI-08 SW Name Type MD ND Depscription LGI-08 SSSV 2145.51 2145.48 2-7/8"Camco TRDP-1A SSV LGI-08 PACKER 11710.41 8328.98 2-7/8" BOT HB Packer LGI-08 PACKER 12391.28 8731.4 _2-7/8" BOT I-B Packer LGI-08 PACKER 12592.42 8855.41 2-7/8" BOT I-B Packer 0. 000000 l0 I� IO ars 1-CO N r r O O O r N 4:r ti V 0000000 OCoCO1- CON- N .t OO r 0 0 In r M d' CO co r r co 0 N- O r CIO f� r i� N CO 0) Nr co N- M CO 0) CO CO O O r r N- LO CCS !l) CO CO CO CO CO CO CO 4.1141) CO N- N CO CNJ C11 e- r CO N O M M CO N r r r r V CI Q ' CO�0)(9 COM A- N M C M� r r W J O Lo co, O 00 00 COO J} --I •N N CO N "6, CD CO (A 0D QO N 00 00 V p M C? t-15 ti N N N O N N r J O N r O CO N T-- LU W � Q p)0 CU W W VDu_ I¢iwwwz Z c Q W W W f'- Z Z OO J H O >- 10 E E 0. co O 03u O 5 O m • N O J a d IX 0 '� a G N ' c -a U) N v a_ N N v a L w U) 0 U, W F N Q 0 M >_ CD N I-- _ m U Suspended Well Site Inspection Form 5 year Notify AOGCC Inspectors at least 10 days prior to inspection to allow witness Well Name: PRUDHOE BAY UN LIS LGI-08 Field/Pool: PRUDHOE BAY/LISBURNE OIL Permit#(PTD): 186-057-0 API Number: 50-029-21562-00-00 Operator: BP EXPLORATION (ALASKA) INC Date Suspended- 9/5/2012 Surface Location: Section: 1 Twsp: 11N Range: 14E Nearest active pad or road: LISBURNE GAS INJECTION PAD Take to Location Digital camera Map showing well location/Aerial photos Brief well history Wellbore diagram showing downhole condition Latest Sundry or Completion report Past Site Visit documentation Site clearance documentation Pressure gauges, fittings, tools Sample containers for fluids on or near pad Condition of Surface Location AOGCC requires: 1)a description of the condition of the surface location, including discoloration, fluids or sheens visible on the ground or in any nearby water, 2) photographs showing the condition of the location surrounding the well General location condition: Good Pad or location surface: Good/ Location cleanup needed: None Pits condition Good/snow Surrounding area condition: Good Water/fluids on pad Snow/snow melt Discoloration, Sheens on pad, pits or water: None Samples taken: No Access road condition: Good graded roads Photographs taken (#and description)' 4. Front of Wellhouse wl Sign, Left side of Wellhouse, Flowline(detached), Behind Wellhouse Condition of Wellhead AOGCC requires: 1)a description of the condition of the wellhead, 2)well pressure readings, where practicable, 3) photographs showing the wellhead condition Wellhead/tree/valve description, condition: Wellhead Functional/(SSV). Gauges Operational Cellar description, condition, fluids: No Cellar Rat Hole: None Wellhouse or protective barriers: Well house Well identification sign: Yes Tubing Pressure(or casing if no tubing): 50 psi Annulus pressures: IAP=300 psi, OAP = 0 psi Wellhead Photos taken (#and description) 2; Tree, Wellhead Work Required: None Operator Rep (name and signature): Kevin Parks llEi !Q t.4v AOGCC Inspector: Matt Herrera Other Observers: Matt Do Inspection Date: 5/30/2015 AOGCC Notice Date: 5/28/2015 Time of arrival: 9:00 AM Time of Departure: 10:00 AM Site access method: Vehicle Ms E ` . 8 $ § e \ = 2 I e s = ƒ - o r'i 73 / k _ _ '®---� # 6 c m = — 2 ¢ 2 / ; / - _ _ - \ - { } \ \ \ \ \ \ / \ - % & \ r ( o $ $ o )�\ a 2 o - § 9 ® § c + t 2 7 0 S ) m e I. ; k Scj, ) § o o 4 to-• ' 0 r. § / o - , f « { 2#f ci j 4,4,--H‹__0 o a $= + mo o e ~ § § § g § Ioo = k ) -Ilif< � g §§ g )� Z.5 ! \ \ q � � 0 f \} , § \ � G ( y A\ 2\ �z z }Q ) in o 040 \) { oo k _ . . § Z ) g « ; % § 7 % 7 39 - d ! ! (71 ° t , ƒ . § I $0 1.. / � 1.. 7 § ,,'•.y t-,,...•".` ; .,'•:?:[''leo'-•,;.';.':.-4.'•,;.'-;''. . • • - , .. . .• . : ,• .. - . ,, . . . . , .. . , .,,,• , „.., , „ . f' , , . -,' :,.., • . . , . . .: , • •.„. , ,, : , • . .„ . . • , .. • ,••• ,. • I II , I . . . s • , • ...I t. ,,,,. ,.. , . . _ ...... ; :1 - . .. . ,. . ,. . • , . • . . , . .. . , . . ,. .. . ., ,, • ... I „„, • gi , ,,, . .... . . I If • . , ,. , . , - ••, . • . . 111 I .:, , .. ,R,. , .0? • 1 ,, , , t. . . ... , ' • ./ . ' a , • 1 , ; ,. ,, . I, . ; • ' ' Y e , • e , 1 . - - I , ,•. • . , . ' r • 0 • . . •„.. . . '.•,i'. ' 4. 1. • " • . , • , f i . • ,,- ' •' I .. " .. •'. , •, i i - . • ..,, . , . , •. . ,,, ., . • , . , • p , ‘ .itt, • -., ' ' I ',...: ,:. • .•,. • ,„ ,:,:„,, '''''l•.- , . vilk.4 , ' )'4• • : .... :•4:t,*;°".?4,•;4.44.)..%4. •A ,,' . 71:,•,,, 4.,,,.,,,,i ,:.,.;',., ,.,,. ,. .....,, ..._, , ,,,i.ft.?ip4:;:,..;:;;;.: I • ' ' ••• ' •' •.•'it'''5 V;int. ''• • le,IN ' - ' - '' 1-. •. ' - ' ' ' ';,‘.....•'•••";*-A eq,,,i-I'Vf.',.;.r,"-.....''. :1-'' . ` ' ' .',; '.., „., '' '.. . ' . ''.".."‘,.. “"r•:,.1.. ..el•-.40,r,„"..,:,:r .,." • .,'I,:" '.''•; • -' .' :I.'4:1'k.,01,44„i*:714_4`v.,,Wil,:•1',. ' " ,- ,-,-, I' 'f'"",- r'. -'...•,-/•:: ::,-I:r.:Il '-'''I'i".r75"i'"1;;Iit,74.'.4.'4.-.4 ' - . • ' ''.' IIII.:„.411,igl,I.4.#1";4, ' ',er;0. - I , ,,,,,,..,,.., , ..,-,..14,,0,,,,,.. ..• ,. /I,. , •,.-,, ,, ‘ , ,4.4.-4,-I :A.,• • • ..;,v "-.' • • .te ' . ,•,..: .'crz.,,,,,, : a",.• 4 . .. i,., . ,•;.. •,.',•,-. ..;',49; •„,..•,,,1,?,01,,,••• y, '.1 . . . . . , '•,,„„,,,L, , ,;• ' ; ••-•: l • • . , , , • . . .. _., . . . • ,.,.,4-, 4p-, -- 1 -• .. • 1 , ''•''''' #4•46...4. ,iga,,,7 t .,,,f .i : ki lid..0-11' • r''. .(,A ' •, ..-,;:riirl•,,;:.,,, . ;:,,t,'-'7%,,-..-44'.44.', i r •• .' '.4. • . -,,,. :„•-,..-... , --,• '. , .7'-e- Niter.•",..,,-,.:' .:',,,' ',..:,-,. iti.• .... - ,*. . • • ,.... - ., .1:4-ON...:',Vil..:',..‘,,,...f,•,- 4,,,r., 0, ., - . -r ,; - : . \ .--- •4-:40A24.,.-. . .'-, 'i,'''. '0 -.„ • : -till L -4,,ra4.-. ,30 ...• ‘,.../ - ,...,....40,.. . .--. -,-4.1.„ „.,. .f.,7'' ..•••! .- iii '7?/0•• " ;-- .;"•/•-• .7".••)' .4 _dift , ,.. t-1.:16.7!k.a.; ,.ff....IP J.;. ,,,., ,.!,,..,,,"....,..,,, r .. ......; .. ....,,,,,,,t,•• .., . .,40,,,,,... ,......,. 1`.1„,' .f' ''1. r.' ' ._ - : ..-,....-• . f- •, .-'f-'''' .ir4/44 -.: 4,-:6 '-'4F.,- ;••;1.1 ',1St:•. -,,, - •. 4,.,•••'...,,,.'-e„.. . '0,7 . ,".• - __•g. ,,,,,_,..,•f-v,,"ii•?..r.• ik,• I ...- ' , ,; •. , , 1-.,::‘4.-' ',''''‘i,',...'"'"...1:,-a... A,''' ,,'*.0t.....-'' ''''',A,".5...W.414f.E i:it'at"411:1; ' ' ''''s'i'ir -'-''.1* °AV.•..‘, -•,..0kititr•••. ....- . "'""•104 •,...r. 14'ti,'' ' . .' ...P'•A 1 if ...--, •cl•••••0 • ' Vla.^.. er*, , 1, ,. • , , '.'4,.. ,ori:-.1r.''',...-,.1-,,'- ''''‘'''=":,.r.,,./..,.....7,0-'1,,,i'lle.„„.:,,..,,,1,,..;1,„,.?,:c••,. : :,s!''' ' '.:,.4,,,.r",e,-.IX!' V,' ,-.%.•4.,4 .,"- •,..q., li , .i; .,' . ..,.. . iik. :r.e,,,,....,-' .1'',.'•t,..i.4-:-1,!,,,,l''''rk,Vi-1•.‘"A',4:4'.. _.4'' 7, iilli --.• .:,' - ' ' ,.•';'77,:r101"0:0.‘,(0;r•T•' -.." ';',.41,..'1"L,---4- '01 •.:A.. ..'"A..4- - '.*1.- .•''-, ,•, :, ! 4 . . - -, , ..,..Y :,' .,4,.•.-- e",,,I..4A-.',.,,,,f, -,'4,-*;!....-1.-_,'.',.•';';.4N+ 0:,-..0;,-,-1,,. ''.APP,62, A.,.....1.,;', („„ . i ,,,,, ,,:,...i.. ,f,V,iv'of.',:,,,,...::fv..f,^-••t,,4!4,,..7-,,,,, ( - ' ',4TIL ..-, ," -. 'v'r.',-,1,;ty.".i;''.,--' ;.,,•':: 7-.;.:. 4.: '.' :14'4',';',ilite",...-:''.‘,,•,....7,.:' •;.'ici*-:: : -‘, .!../ .,-- ,11;,-,,,v-mr ..?•,-"i•,,-'1%-..,,''.- ' 1,r;efo, )7.....• ,- ... %,, ,..1'.„.•. ..a •, , - *il-7, •..,,');,',.••.•"-.['i.,111-i;:';`-ii.,`,i,p'..,.'e.417,4'--..-";AP,if...',..' I ' ' 1 ,. ,,..• , .,,•_.z: ..••••.....-?,..„,•,•• ...-,. ,,,,,,,,4, •• ‘,..• - .„ ,rx•,..,-,•k•,!.•,; 1::•- • • ,....p.r.07.4..w,4,-,: , ..----.. .‘--.--..,.. ,-.4"......,.-.,..7„,•,... ,,,,,•,..„...,.....,,,,..,%.'-.. , , , . .. •.. .ff`p. ,._,.... '4:37A.., ,• .... ... .:'.'•,,",`,14-.•••.i,-. =:.',,;•••••,:c0,•/*'4:f4,..'f:', ''- 9"-- •." . • it. •,..-1,0i ri.;.-." 4-,. '; '.-,...' /-S.:;e.-:.7410%.:;71:4141,40-,114,1,*41S4r. e.' ....'..!:."'•:_ ,,,,,,, ,..,:„,.2. •••••;.:...;*-11:4:'.•..-...k.' I:... ...'.',: lir:--."." .--;-:... '..-rie...fie,..'7",!,,;.., i. ',..7":7=;1"...'... . r •....I-•ir,;- •4(1---,•' • , ..',- .. -,.11',.*A..kJ%, -,',... ,Fcc=t,if,;,7,-.10,%. I-1- '' . 0..' , '- ' : ' i.,-1,17,..*:` - ...LA,...,,,,.,. „-i.,•;.;,,,c,: :,,,T:-.:,.. ",.J.-• .r.r.! lke. •,..*.I...-i,...--..•.,- 1 ' - :.. -'.', ''4' - 0,,,',,,bm i',ii.•-•.1.1.4. -,• ,-,:,!,,,..tV,.,ilti,,r;;;,--P.1-• 4, ::-'-• ....:- t ' ,':-•..-•,-• . ',,7: qt`"**-•Y.'' IIIP,,,e0P4`-''? • -1..•r SP° is‘,4;t• °.. - .' e',Vg.'- eet'.. I ,0111° ,.......e`-..-"; - •-..evi ''.q.',.••-',.:' , _..d.-.--,;;,...... .."„.4*. , •;«,,,,-,!..,... ..,..... -., .r• , ..-144,,,•1•••1111.-A., -.0•0- ,:,,.,/,...,.,,,,.,,,:, -'il4 'At , .#;14„ ,iy-t • ,-''....;iiit,,,- ., 'v.* ° ,..'' ez r''j Int!41elt - .••.;:.-,7‘...k.S.••• %.17A,..i 1:4.- ‘ -'..'1 ,,,., .,,A.,-..,.,....:--- r-.r.'to'.?,..;. :i..,,,,,APP- A se, , ;TAP, .;....,..,.!,,., ,.e/413 •.::et,..1,-'•-t.1,-:,-. . ‘. • •4:,• j,;..It"c4itokt10.'el.."Il"iv 40 -...2.' 01„,iit.• :-.".,..,•':...r;f• -.:‘,:-.."..: -.. ",...,.• ' -•..-, ,.. ,• •-411‘..%;e:-It 'se'. ••••••••--,,2-riitic'--mr 4110. ,,,zi. • ,.. .. ','-,,- 4,..,...-,74,,,,.. , •,'.-- ,- - •r--,-,..--,..---it gre•ris.,_.'" ,'i..,elk•i 'c'"? ' • -' -1',-',1" :,'"Vi',•,',i,'"' - ., '• ,':,-,'`,,,.:.''',',',.:,,,,iii".,;,?,","'„,' Ir*' ''.:.',-;:p''•:,;,',.'..- ':-,.',..".F141i,,,,,,-"It. '..'-ri;:ilic..' • ',,,•'',,.,..', '.',,:ei °"!;,,,,,,g.ta7.,:it,'v,.., ,,,,g1,„'",. ' 'I"'"'"014-'',440;.,''')'--,,,'"', ,' ,,,‘"•'.,,,4 .'",-,•"'''',=,,,?0,i, -,,' ye ,,,,...4i,i,:-..,..,4,-,4,:-,,,..•,..-.,....,:::,,ty-ffx,ik:ifir'.,,,„,:,,.. .„....,, ,,.,..,,!,,,r .z .-::,.t. y.-._;„--,~,. , , ,44%.....-7:4- . . e., , . 11,...' r• •lit,41, %1' -IA. rie tr'Y..' ".4 ,•••' ' ' '::- .41 r.- i:- ''.?,:ver,. :4.tti, „We •,.'. .1 ' , '-....•, , .. ,.. , .,..4411-',.0440..- il......,.,-..- ... .:_....,„ '"`... • 1,0.4,. ....0 ..‘.• .,: •t.136.-'-.." i.".."' •1,"*"heit, ••*47•"•••41"- • ' -7-" • ‘-': •••1•„,..:"::7-,r,:.:-,?,:, : .: ','.:4••-•;"•••''',1A-•e,-..:',A1',;: , - , . '' ••••,-.1 S..' • 1 • ''4.-t•••-. .114,.?.,..A., ..,,,,:,,,. ,it s'e l'ireferi. • ' •-...• - -, , -.I,. 00' --.4,i,„A'..V."',4-• ..1-..1 ' tt*:42•.,E,.::. •*'',* •6•ee•• •• - - `• e ` , ;i " '•Vitlior,:,,' • ,•-•iV.V.i?it*, 'n*4;•,,,!.. ,•••:::-.,..T•ik.riii9,11-4* -*; ::' 4.;16**,;( '• ,,,..-' , - ., !,:rosi,,,,, -l', 41,.• ii,,i,:•.• :, :„..14,,.,liel,•7.4.,;to.' ;i7;447:1.'7 Tior„,,-..: NO' -- •••• el, - ::.',.‘.. .......;•. '''•,;1,: 4.4,i,..1,.w.,,r,t,i>.4ff..-1«,?..",- ..; -:. ''r* •:''zi,. -'.:. ' •• •=efr, - •• '... ! • %7^;'„:'.,42:: ,.. ' .;.t:•• !;•07.46.1.-;',.. ,r ...,,ls•' 4. .. ' : ..,,Q41.38''441,1 ' •••A,.. ,.. , ,_„ ;,...,,,,,,,..... ,.e..,,. 1,......„.,. ,,•,.,., ::,,„..,>•.;:,-..,,,..:-.... ...-V f• 'V.,.'••-•,',„'. 41r.....411ri..- • - ------ 11...-:••'..,' -ii..- P; •.4...'„,0i4,''-' .'s;-.; •.4-..': 0' ';.. -- . -'• ', -0.-_,•'..,..= *.„• , 1 • ' '‘` ''-,A.- i, , -1-;'4'.: • ,,', ,,,, -., , ... 4.,,,T, r:,14 ,1,-• • r , Aleft '''' •-z4Att-'., ' ''-d,-A--"- .• .' ..,.. k....--, t z.• •-, ,,,. -. .?• , --.. • . zir'.- i 4 .,.,- .4,,f, ..Ri,i4tg's ' ''. " •' ." '• •:.‘, • - '••••I': • " . 4 -'• . 11 ;.. . .• --,*.r ,TV,4; , -',. ••.$1 ,, '•:',4,4,,, ...---.174„ '-'' .. 1,.. " • .' • "- - ‘'44.,--.,: ,- -, •, ,--. '-- ----,,- - ' ,',41kifill'F' .., ',, , - ' '11,',4"4,-, • I,- , ' 477.4.91'•. • •''''' • ..,..01.4., 4,1-!' ''''. ll •, - , • '• :':,°'•• •,,'' '.,, ,.. -,°,, . • 4 . • ..,,... •t • •,. , ' •,., •• • 1. • rt'aL .' ,,. • .. ''' ''' •• l•''''0 e .,•.•• ' .•••. ,1'" • ' • . ., e I'I :,'•‘.1 . , ..•.•• '4.* ' ..• . . , ••• • '" ,'•••.,.1.•' 1..•,,:,,,:I 1 , ..,5 _ - - --ri..•rwr'r . .. • 4- 1 i I i ir 1 . - i% ' -.. ' t ' • . . ,,,•:, ._ •• i • 51 .1,, e:" '''' ',i,,,1 i . . . . .." el '' ...; • ‘.. ' ,6 1 l• `' ' dr, •,_- - • , - • - • ' ' ' a '•" • . •. e .. Ii • . •"4. f ' 4 0- V. , ... a • . ' • * - ..- - .„-,. V .'•:....1:!' ..., ..,„„ II ..4, , , , _ ,.,„ , , , - Ard ,,,, 4 . , ',..,,,-4A?i• = ,, .. , . t;{,- 4 ', i .4(......, r 1 .. ' 'ill' •- .,„ . .,.,- .,,, '..f.,. ...•'',/,' r.,'; ...,..: ,,,,..1-• 11[ 4 ' i'..' . - a i t , I II:, r., . . .....--.. , ,...,....,, , ...., .,• . .. ..;_- ,,f, ,...,... _. _. .......,,,„. , , ,.,,,,,,,,,,:,;„:,:..'''''''':fr 4 f' ' #,',.'JI0 *--1 , , . ','-',„;,,‘;,;,' ,,,, ' ', 1 ''.: '''''''''''''''.''''.;,i.:''''',''''' ' ' : ,, ,,, .,L :...:,.. .,..... . . ,r,„-_,: .,-, '- :'.. ,...:,..,..7.' i ' ,, ,....,,,...,,l'!,:f,' 1,,I ,.., '.1'f11,.. ',.. • i , -- •-- - . ..., .,, ,,,. ,. .• '' 11 • •::: \ „:„... .... ' 1 . . .. , 6. 1 . -...........,.....„..,....,....,.... ....,, ,. . . .. ,,...,..v. , ...„,,.. 1 1til • ..:,. . . ., . ... , ..., . _,.. ., .. ..,...,,,, . , ,, .,..-..,,;..,.,.....„...,,..*:„. ,„.,, ,.., .,. „,...... ..„ , ... .... , 1 , 4....4„,„ .. ....,. ,„,....... ..,,,....,, . . ..... ... ... .. 4:4+. •,,,,,, .117 t ,.. —.-.P-• .„... . -• ...., ..., , . ,,,c c c, '' --i -•,•• ---• 44461' ''. „ . . . ,...,.. . , I ..., .; . ,. — .c..... . ,.., -c ''. ' • , „..,... „.,, , -.. .„, ,=., .,,, • . .., -,,, •-„„ gill,i', 1 „.„ . ,: -...,P1 w= -`-----ii\s,,,,,:") -, '. ,., fix`' i ,u, fir; . x,,,{ b# 4 0 0 .:.-.., 0 '1-1'44- :y • y ff i 411• eP t .l , # aria r o-7 k �> /e m t • 4 r a. ...Immo* _ .... - - -t1/4-1,'. ,, , lilt 1/4\ 10101 I- -It WNW lk.NI111111111111111111111110111011 i 0.`nom' �, * ,,ti k . vim i t �� ; m 0 I at 11111r ., , - - ... x- � lea a II oiLtoirs.ssoz, 0 t • il 1 r, 0, A 1 ,- a -�tee. 1 45 „ ,,,,,,,,,, I , . , 4., fie,,,, ) .i, ,,,,,,,,„,,,...-- ,,,,,,,. 1 i. , iiii t �►. r'''4,.:;:` r 4 �. *. ,,_ -* ,v by < ` —../q6 Q 4 gam 41,, 3r r ,. 1, r • 00 . CAR N y • 44. C ' +” . `e ..,E - t 4 � r ',♦ � _ •fix 'i �, -: sem. .1.y . �♦ 4�. , 1 l 4 i" " � 1.! . • ,•• • . . , ., ....... . . . • ' • t' t ••• ' .:.,• . : . • 11 :,,11. 1.,,' . , • ' ....i. • '' . ., . „, ..• . . . . ,., ,.• . . • . , 1 •-•'., • '... 11 i' i' . • , ' • ,. ,. , ,,,' ,.. . .. ‘ .. ...-:,•;.••., •-........ -,,..,... ...,. .•,.. . ..., „ . . , , •,, I- ,......?:: ', '' , .,, • ., ,, •• , . . '. :.• i ' ' '' ' . ,,,,,,. . • ,_, , .' '. . '''''... i •' ' ,,,,,,,,.., .. „ . '. .., .' • .,..- '. !, , . • ,t. -. ...t.. .. ' .::'..:,:ii.-.:•-••} ?. .* ......i. ''' t , . . • ... '... ,.. , . ,.„ ,..,-., ,. , , 'i•• •ti.1§' < , '' , ' • . i'.'. ', , ',•:. •• : - L'• i§' r,L1 i, . _.. ,.. . ,. .- r•.,- ii•-•FJ r ," • !,i - . 1 i ••;!"'..12. rc"; '•••,1 , ...• - • ' ' ' , - • A X ', . .• . . , . . ' .. .• . • , .• •, , , ... --._. • , .. ,, ,, , , • 1 I 11! 1.111.11.111.111.11111.111.11111111 , • - . . . . . , . . . . • ' I i / • ,••', ••• ' • ' i' • -•, ;-. ', :•....',;'. :'' .,,,'' ".??i• .:'-'*!),''•;,.';' '''. ';'..":','.:i•••• - i ' 'I' ' •"!i'.•, ', '. • : • ,.•••'• '- •••:''''i''.... .••,.','';:••1•• ' .: p .,• . .-!,,,, .., •, . ,. .: • ,-,,-;,..„ ,,,,, , , , ... 1 , :•,05' . . ., • •. , ••,.i.",• •,., ,, ,,,•••.,-..,,, , ',, .•..,...;, ,. ?.,,,,,,',..i• ••. . I TRIS= 5-118'FMC rLi-E D RCLGI-08 I iET"NOTES:WELL REQUIRES A SSSV. ACTUATOR= AX�SON , B.ELEV= 52.0' BF.aEv= N, ) ll I l lit I<OP= -4;13(i'. 20"CANDIiCTOR H -120 —-- 2143' Ab— 2-7/8"CA TROP-1 A TRSSSV. D=2.312" Max Angle 60"@ 9900' O Datum MD= 12,745' 91.56,14 40, Ct-EMCAL INJECTION MA NDRELS Datum ND= 8900,SS D=19.124" II (ST MD ND DEV TY FE ( VLV 'LATCJ PORT DATE 1 2199 21991 6 KBMG-L I DMY I BK-2 0 110/03/88 113--3/8"CSG,72#,L-80,D= 12.347 --I 4361' ! GAS LFT MANDRELS GIP (Minimum ID = 2.312" 2143' 1sT! IND TVD DEV TYPE VLV (LA TCI- PORT! DATE 2 2842 2823 21 TE/Th D DMY i BK-2 0 110/22/86 2-7/8° CAMCO SSSV TROP-1A 1II 3 6164 5057 52 TErT1VPDI DMY �'BK-2 - 110/22/86 ., 4 9074 6768 50 Tel-MR?' DMY BK-2 0 11/23/92 !TOC(07/14/12) 9000' .. '�Kx' ►:<_..<� i 5 11134 7963 51 TEITM D DMY BK-2 0 10/22/86 v.;{":. ( 6 1 11614 8269 50 TT IMPID EQ DMY RKP 0 07/05/93 TBG PUNCH(07/06/12) — 11600'- 11610' -ti'" •STA#3=DMY HAS A BROKEN LATCH(TAGGED 12/04/87) 2-7/8"WFD CEMENT RETAINER(07/13/12) 11700' 1... .;,;K. .`. �� 11708'-19-518'X 2-7/8'BOT HB FKR D=4.000' TBG PUNCH(07/06/12)j-{11720' - 11730' ' :" 11753' ---1TOPOF SOT TIEBACK SLEEVE ... ►� ( ¶ .. 11767' --{9-5/8"X 7"BOT LNR MANGERTT3GFLINCH(07106!12 i •:,.... '-11925' 1--1FISH: 1/2'X1"PIECE OF METAL SKIRT& 1 ) H 11895' -11905' ; -1-1/Y WRP ELEMENT(05/30/12) tool I 11925' --ID-COLLAR STOP.G-PACKOFF W/PX-PLUG 9-5/8'CSG,47#,L-80,(3=8681' 1 11966" - - I L(Qi/I0/94)-(P-PRONG PULLED ON 08/24/01) PERFORATION SUMMARY 1 '�I PRODUCTION MANDRELS REF LOT, LDT/CNL ON 05/27/87 ST MD 1 TVD DEV TYPE VLV I LATCH PORT DATE ANGLE AT TOP PET 52"©12300' 1 Ir 4 7 1225318647 52 TE TMPD DMY j BK-2 0 11/14/86 Note Refer to F4oducbon DB for historical pert data BB•IT LATCH(TAGGED 04/05/89)-DO NOT RERUN SIZE SF*" NTERVAL Opn/Scz I DATE 4" 4 12300- 12350 — S 07/14/12 2-1/8' 4 12389- 12477 C j 09/08/01 . 12323' --L 60'OF BOT BLAST JTS,D=2.441" 1 2-1/8' 4 12506-12550 C 1 09/08/0194 12334'dm 1—FISH- EODGLV AND BROKEN LATCH(09/26/88)1 4" 1 12640- 12670 C 11/26/86 11 44 f.,-4 " 1 12688- 12704 C 11/26/86 =� 12384' —2-718'AVA BPL N .V=2.25"/1 875"W/SLV 4" 1 12748- 12772 C 11/26/86 1 ►te •BP&2 MEM.GAUGES RUN ON 11/29/87 4" 1 12792- 12816 C 11/26/86 1 ��„jjjj 4" 1 12840- 12876 C 11/26/86 CI r -L 12389' — 7"X 2-7/8'BOT 1-B WR,ID=3.750' 4" 1 12920-12930 C 11/26/86 12403' { 2-'/8"AVA BNG NIP W/REDUCER D= 1,812" l 2-7/8"TBG-PC,6.5#,L-80, .0058 bpf,D=2.441" H 12407' 1 2-7/8' ID=2.441'1 8' BOT WLEG. 2. hil 240 1� ►�� i�� 12590'elm --I 7"X 2-7/8"SOT I-B PKR D=3.750" 12611° -2-7/8"CA MCO D NP,D=1.813' W/CA-2 PLUG(11/26/86) 2-7/8"TBG-PC,6.56,L-80, 0058 bpf,D=2.441' H 12623' 1 12624' —2-7/8"BOT TTUSOS,D=2.56"-1 1 PBTD I-L 13375' 11111111 /11111111111111 7"LNR,29#,L-80,.0371 bpf,D=6.184" —1 13422° ►a••W•• DATE # REV BY COMMENTS DATE REV BY COMMENTS PRUDHOE BAY UNIT 10/23186! NI ES INITIAL COMPLETION 07/30/12 RM /JMuMO SET CMT RETNR&CMT(07/13-14/12) WELL: LGI-08 02/11/11 I MB/JM) SSSV SAFETY NOTE 08/09/12 PJC PERF/SAFETY NOTE CORRECTION FERMTNo.'1860570 06/04/12 i GJF/JMD PULLED WFD WRP(05/30/12) AR No: 50-029-21562-00 06/04/121 GJF/JMD FISH JUNK ON"D"COLLAR(05/30/12) Sec.01,T11N,R14E, 1188'FM_&1669'FEL 06/17/12 PJC' DRAWING CORRECTION 07/10/12 I SET/JMD TBG RINCFES(07/06/12) 1 BP Exploration(Alaska) STATE OF ALASKA --4 La• '` . ALASKA OIL AND GAS CONSERVATION COMMI0oION [��i 2i.)I: REPORT OF SUNDRY WELL OPERATIONS 1 Operations Abandon ❑ Plug Perforations ❑ Fracture Stimulate ❑ Pull Tubin❑ "'''1Dpta ns+shutdown ❑ Performed. Suspend ❑ Perforate ❑ Other Stimulate ❑ Alter Casin[—❑ Change Approved Program ❑ Plug for Rednll ❑'erforate New Pool ❑ Repair Well ❑ Re-enter Susp Well ❑ Other _Suspended Well Inspection_ Q 2 Operator 4 Well Class Before Work. 5 Permit to Drill Number Name BP Exploration(Alaska),Inc Development ❑✓ Exploratory ❑ 186-057-0 3 Address P O Box 196612 Stratigraphic ❑ Service ❑ 6 API Number Anchorage,AK 99519-6612 50-029-21562-00-00 7 Property Designation(Lease Number) 8 Well Name and Number ADL0034628 LISB LGI-08 9 Logs(List logs and submit electronic and printed data per 20AAC25 071) 10 Field/Pool(s) PRUDHOE BAY,LISBURNE OIL 11 Present Well Condition Summary Total Depth measured 13423 feet Plugs measured See Attachment feet true vertical 9409 15 feet Junk measured 12334 feet Effective Depth measured 11704 feet Packer measured See Attachment feet true vertical 8325 04 feet true vertical See Attachment feet Casing Length Size MD TVD Burst Collapse Structural None None None None None None Conductor 80 20"91 5#H-40 39 84-119 84 39 84-119 84 1490 470 Surface See Attachment See Attachment See Attachment See Attachment See Attachment See Attachment Intermediate 11930 53 9-5/8"47#L-80 37 42-11967 95 37 42-8478 16 6870 4760 Production None None None None None None Liner See Attachment See Attachment See Attachment See Attachment See Attachment See Attachment Perforation depth Measured depth 12300-12350_ feet 12389-12477 feet 12506-12550 feet 12640-12670 feet 12688-12704 feet 12748-12772 feet 12792-12816 feet 12840-12876 feet 12920-12930 feet True Vertical depth 8675 49-8706 13 feet 8730-8783 95 feet 8801 8-8829 01 feet 8885 22-8904 11 feet 8915 48-8925 62 feet 8953.62-8968 98 feet 8981 83-8997 3 feet 9012 82-9036 18 feet 9064 87-9071 4 feet Tubing(size,grade,measured and true vertical depth) 2-7/8"6 5#L-80 34 92-12411 65 34 92-8743 86 Packers and SSSV(type,measured and true vertical depth) See Attachment See Attachment See Attachment Packer 2-7/8"Camco TRDP-1A SSV 2145 51 2145 48 SSSV 12 Stimulation or cement squeeze summary Intervals treated(measured) ,l. ., ; Treatment descriptions including volumes used and final pressure SCANNED .n 13 Representative Daily Average Production or Injection Data Oil-Bbl Gas-Mcf Water-Bbl Casing Pressure Tubing Pressure Prior to well operation 276 6918 7 0 600 Subsequent to operation 0 0 0 0 0 14 Attachments(required per 20 MC 25 070 25 071,&25 283) 15 Well Class after work Daily Report of Well Operations ❑ Exploratory❑ Development ❑ Service ❑ Stratigraphic ❑ Copies of Logs and Surveys Run ❑ 16 Well Status after work Oil ❑ Gas ❑ WDSPL ❑ i Printed and Electronic Fracture Stimulation Data ❑ GSTOR ❑ WINJ ❑ WAG ❑ GINJ ❑ SUSP 2SPLUG ❑ 17 I hereby certify that the foregoing is true and correct to the best of my knowledge Sundry Number or N/A if C 0 Exempt N/A Contact Nita Summerhays Email Nita.Summerha s• b• corn Printed Name Nita Summerhays Title Data Manager Sig - • -- � �l ' AA, ,' Phone 564-4035 Date 6/25/2015 t^r� �`q/1 RBDMS4-\ JUL - 1 2015 A rlr Form 10-404 Revised 10/2012 Submit Original Only • Suspended Well Site Inspection Form 5 year Notify AOGCC Inspectors at least 10 days prior to inspection to allow witness Well Name: PRUDHOE BAY UN LIS LGI-08 Field/Pool: PRUDHOE BAY/ LISBURNE OIL Permit#(PTD): 186-057-0 API Number 50-029-21562-00-00 Operator: BP EXPLORATION (ALASKA) INC Date Suspended: 9/5/2012 Surface Location: Section: 1 Twsp: 11N Range: 14E Nearest active pad or road: LISBURNE GAS INJECTION PAD Take to Location Digital camera Map showing well location/Aerial photos Brief well history Wellbore diagram showing downhole condition Latest Sundry or Completion report Past Site Visit documentation Site clearance documentation Pressure gauges, fittings,tools Sample containers for fluids on or near pad Condition of Surface Location AOGCC requires: 1)a description of the condition of the surface location, including discoloration, fluids or sheens visible on the ground or in any nearby water, 2) photographs showing the condition of the location surrounding the well General location condition: Good Pad or location surface: Good/ Location cleanup needed' None Pits condition: Good /snow Surrounding area condition. Good Water/fluids on pad: Snow/snow melt Discoloration, Sheens on pad, pits or water: None Samples taken: No Access road condition: Good graded roads Photographs taken (#and description): 4; Front of Wellhouse w/Sign, Left side of Wellhouse, Flowline(detached), Behind Wellhouse Condition of Wellhead AOGCC requires: 1)a description of the condition of the wellhead, 2)well pressure readings, where practicable, 3) photographs showing the wellhead condition Wellhead/tree/valve description, condition: Wellhead Functional/(SSV), Gauges Operational Cellar description, condition, fluids: No Cellar Rat Hole: None Wellhouse or protective barriers: Well house Well identification sign: Yes Tubing Pressure(or casing if no tubing): 50 psi Annulus pressures: IAP=300 psi, OAP= 0 psi Wellhead Photos taken (#and description): 2; Tree, Wellhead Work Required: None Operator Rep(name and signature): Kevin Parks K Pith AOGCC Inspector: Matt Herrera Other Observers: Matt Do Inspection Date. 5/30/2015 AOGCC Notice Date: 5/28/2015 Time of arrival: 9:00 AM Time of Departure. 10:00 AM Site access method: Vehicle c t Grp . ;: 1 • , a fes-h s - n • ■ sww- - w . L ., . • 1 _ , ;.,,,, ;. : « . . . . 1,, ?� �slail• l , ''' 'N' t . o 11 \ , "I ,..';•'4!‘•.;:41.1.••'''..7': $ µ i�', 1 � ,i ' 1 f�'�' � ! gyG ` ,. 11 st #a" '\ •d : '. tt lt! v;t a. ! , o ;- � moa44. 1 l +�r44ek.r'� "'4-4'.f.'•4•4•:.• .1.i , _4erG v , > M. t - ie' 1. .T., . ,,,,t. 1 - ,F' , ,. hi' ;� •• •,.icer rv: S'%, r . �, , N. ; 84 . ' .v. • 1 »..,. • • • r - : V 5V � ; f rr\ 4 • .,..1• 4 '3 . ♦ +A 'i,-,' : .; ., ' { ' 1 �' �:v' �L�',10 • � t t t...,+moi ?f, ,+ar a. , ` fy 4. , A •. e. 1l9 4 t 1 ,,!9 a', 9' 4 . .••••••i kI.` �.�p. is, ♦ • sw � +y bQj*flf 7T'yf�� ` �.• N• 4...b . u� �,+:: •r� 1 +�1e4. 1 . ♦a . �. • i. ' e ft •, li . .A by 1f 1 'y ..k,„„: , �t'r . . .44.-•4 T e*;k ' v ,...•4,4!..-..r.', a $ f �►,FA Vii" 'r SIJ fa � ,+�+}��) � � I�,i ?t. 1- � � ' !� �' • ,t n�` ' ,� � R w f- M a d , a . .w � �. I f, 1 ,q .x1 Y .♦1 .=4 ','P.A.:. 1: `�k+; '' "4'. i S'15"`fi t f •+i. 1 4t n• •• '1,': { 1),x �. s { a A�'®y� � �� T 1 � �� :,X6,,,-.,,, ♦°�,�ti��♦ �. tip', ♦ ! , � `,•p �,� 1'� � ,� 13 . 1 .,., -., ? s All -1111111111111 i ., • .- --"."-*'-' r i", • .. .01 ' -- -,jiaillP1 1 I -,--i.------- -- •- - • ..,.., —. ow ,.. ion, . RN ti 1111111111.1111111 '4111111111111111 No,1011111111111110 , III giri 0011111011101111111101111111111.1111111111111.111 ,.„._..... -, ., . ,....- . .--. __... ... .._,...... _ . . , . ''.'''''1•1,:''''. l'',7ib;:''a:;;:'*:'',...;.f.'''....Z,:,,:lit.4;1:,!;',*;47,' ,, . . - ''',:;:?,1,::•:';',,i.:,::::::':::;::;4:,,l'7'22:: '. ,;.c.:::',,,'..*T.I.:::.,,':::: ':::',.':,::,.,''.:::,',...-,*.',1.4;"5'24 40 1'-7;:,P.:;:;:,, ,,,,, ..-:::',:;..-;::4,: l''''''''',,:ii.',:j44$'''''''.§ 4-W*' 4-!:1:-,:,..,,,c4. . . .:. ..,,,:,•,,,..:;t.,:-.;;,.;.?,..,;.,.':„..'''Ym-,444°-''' ' '• ..-' '",..it.,.,. 5'44,4 =?..0 .,, ..„.., . , . ...,„..,,, „ , .. , - , ,. .....,,, ..,-. ''';',-. -,11:,.';:':.'...,4, .;:- , ' -4 ,A, ...... ... '(' trt - ',',$. `.. ''' J.„-„,' , fit,...'.s ,F`:��'''� ?4*t, ,w=., b,n . ,7„,l'''',4„.'''''',,,, ,> r r i Is v"5` ,,ma�yy ?: ff ti 4,ftL Y $ 4 4 11111111111111111111d { • -'' ' s o _a.«+ ^•x yr. ..,..-,,,`""\''- 'b4 • ,. .. { , ^fin, ... . w r s a ,', . - ' ,..,,,,',-.„.4,1,,:,, .,,,41-i:..‘ .., 1* I, ''s rr -.4'‘I. 4 ,:.• ' fa'* 0 '1 41' O lia;;;-74;174 "-. . ti S • 1 �.,„4 � ++ .. M t . i�: - 1 r s _ M I I- lip i 1 t' ::f.C., ,r. . iii to (iip -,:: Et t� ,ay. 1 0 3 TROUgLfWfL _ CALM�l OofRl7p II S'5/02 4'. . 0 ,ii ' ../..w f I r 1 . 4 •x {" GI L 417 ar.s . __ •t .. ' f i _^ , 4. „,v . s 1 I • 1 lea i I I , r f # , • 1 4 ' • y e • 4 . at ill111111111111111111111 is I II , . A4 , , , . 8 g,IP,J ' • • • --113 -,..-, ,• . , ••• ‘ ,$ tig 0 . . $ , .. , r I , . . 1 a ,; 1 , ..' • t; I. I • r •t . Al Oi .., ..., „.. , .. , t, . t • 4 ' I I #, ' ' ' ''' . '' ' ' 'g A a , ;Iv- . . .. .... . t b ,.„, , . . , , , 1 , • , . .., . a . . ',: , '.,. '' ' s .r • r E : m 3 O ^ in - 7 Y la YI a _ c J _ 1 -'y+'S N 'J �"` GJ CO , Q ,N O (n CD LO Z N O d J C in Q W 0 N a a 0_ ED w 0 t 0 a `o 1 C o (1) `� c C 0 d j = t J 0(40 CO •C J NN �a r1 N N • ....0.r-*le;:,t-'-'-:-'6'.1.' /0--)- - t lit '' •,, .. 1 o D: ,f O CO O, 3 '��. E m Vii. t o 11 .6...0•i - 1 i` Jo. 11 N N 1 1% OP) ca 11 <3 11 ..... 4.4 ,• ��t 1 ' _0 i ` ' � - zi � �.N 6.e` O`, cO L-,24 N. + N N. Q ri 11. 1 I I �� ,'' E 0 __ w_ .........................................r `\ _ - _`,__1 -0 E ct a) $ v = w — • V o On oONOO C y y a1 w^'' J W . J J a aC 1 I I i 1 1 ya Z Lnn , a o v GI it it) 51� �O O ti' -J J m Q o 4 = o a 0 g 0 i i m a -g, Q) C - 3 a C 0 m c L L3 a (I) a3o ._.l C `..... O b E.o `d +. d0,X61' `c_n 7 T r L L-1110 oy 1 7;o 1 �> ., 1 • trn10 r0 S{ C d _=*e_ 1 r^'... 11 t m 1 tr.'''' 11 i 1 11 • `o 1 11 <1 t 1 11 n x W / 11 r —— 1 I ' -- ----- i ,1L II I I YIIIHE ,i 11 1 Cit., 01 E.111 1,1 1 i cI �• I t ! o I. t. m k $ C 0 $ } 2 / / 2 \ a @ \ & / I \ o = tit a) CI) a (13a c W p . / D R % ) a. o c D \ % - ` _ D 09- » o U- = 7 p � / (1) � 7 / 6 , / R w \ o \ m / / 3 m f:C o• 0 0 o o cg O N rnco 6 zzr ' o Nr N o 0 0 D o o Q I... O) co in M = Cr CO — 0) m co 00 Or M V CO co V (C) co r r O) M O CO 00 O (0 N-_. O r N- CO d- V 00 (0 O) N- r 00 d) CO CO 00 a H V 00 CV LO coti CO 0) . O O) N- (C) (() O O co co co 00 R co co 00 00 = 00 V I- N CD ON V CO O r N CO CO N r r r U o 4- N CO N < CD co N rn LC) V M O CO CO M = la O J ~ CI o 0 o n o Q -1- C9oapaoap = d #k �# J (C) N N Vcs) - _ (0 Oa0 N co oO 00 N• O) (-J CO CO N CO r CS)CD M CO O O C 00 co co N M M w r r U-! H (X C HHC) LLI W W CvD 2 «° U O cC cccc W W Z Z W W W /xm O H Z_ Z j j j U ZJJU) U) H Packers and SSV's Attachment ADL0034628 SW Name Type MD TVD Depscription LGI-08 SSSV 2145.51 2145.48 2-7/8" Camco TRDP-1A SSV LGI-08 PACKER 11710.41 8328.98 2-7/8" BOT HB Packer LGI-08 PACKER 12391.28 8731.4 2-7/8" BOT I-B Packer LGI-08 PACKER 12592.42 8855.41 2-7/8" BOT I-B Packer LGI-08 186-057-0 Plugs Attachement SW Name Date MD Description LGI-08 12/20/2003 11730 Set IBP LGI-08 8/25/2001 11925 PX Plug LGI-08 11/27/1986 12611 CA-2 Plug TREE= 5-1/8"FAC VVIILHEXD RCS.1-08 S. •Y NOTES:WELL REQUIRES A SSSV. ACTUATOR= AXELSON' KB.BPI= 52.0' BFELEV= NA1 K 2400 20'CONDUCTOR, H -120 P- 2143' H 2-7/8"CA TRSSSV,D=2.312" KOP=OP Max Angle= 60"@ 9900' Datum MD= 12,745' 91.5#,H-40, CHEMICAL INJECTION MANDRELS Datum TVD= 8900'SS D=19.124' ST MD TVD DEV TY PE VLV LATCH FORT DATE 1 2199 2199 6 KBMGMV L DBK-2 0 10/03/88 13-3/8"CSG,72#,L-80,D= 12.347" --{ 4361' - GAS LFT MANDRELS Iiir Minimum ID = 2.312" 2143' ST MD TVD DEV TYPE VLV LATCH PORT DATE 2 2842 2823 21 TFJ1W) DMY BK-2 0 10/22/86 2-7/8" CAMCO SSSV TRDP-1A 3 6164 5057 52 TFJTWD DMY *BK-2 - 10/22/86 Row s w0 4 9074 6768 50 TE/T?vfO DMY BK-2 0 11/23/92 TOC(07!14/12} — 9000' •• •40.0i� 5 11134 7963 51 TEITMPO DMY BK-2 0 10/22/86 TBG PUNCH(07/06/12) H11600'-11610' • �•46 11614 8269 50 TE/TrvPD EQ DMY RKP 0 07/05/93 411140- •• 41 • *STA#3=DMY HAS A BROKEN LATCH(TAGGED 12/04/87) 2-7/8"WFD CEMENT RETAINER(07/13/12) -1 11700' IhiI•A•; i•a 11708' H9-5/8"X 2-7/8"BOT HB PKR,D=4.000' TBG FLINCH(07/06/12) H 11720'-11730` f 11753' --TOP OF BOT TEBACK SLEEVE • •{ ' i9 vr••A.4 11767' H 9-5/8'X 7"GOT LNR HANGER -11925' -FISH: 1/2"X 1'PIECE OF METAL SKIRT& TBG PUNCH(07/06/12) — 11895'-11905' K �, • _ -1-1/2"WRP ELEMENT(05/30/12) (.x — _ 11925' —D-COLLAR STOP,G-PACKOFF W/PX-PLUG 9-5/8'CSG,47#,L-80,C)=8.681" H 11966' <-1 44 L (01/10/94)-(P-PRONG PULLED ON 08/24/01) 404 • PERFORATION SUMMARY •4• 4 PRODUCTION MANDRELS IIPREF LOG:LDT/CHL ON 05/27/87 cKI pj ST MD TVD DEV TYPE VLV LATCH PORT DATE ANGLE AT TOP PERF:52'@ 12300' PC,< In, 4 7 12253 8647 52 TE/TMPD DMY BK-2 0 -11/14/86 Note:Refer to Production DB for historical pert data {{ BENT LATCH{TAGGED 04/05/89)-DO NOT RERUN SIZE SPF INTERVAL TE2VAL Opn/SDATE { 4" 4 12300-12350 S 07/14/12 f{v' 2-1/8" 4 12389-12477 C 09/08/01 12323' H 60'OF BOT BLAST JTS,ID=2.441' 2-1/8" 4 12506 12550 C 09/08/01 K'x 12334'slm H FISH-EQDGLV AND BROKEN LATCH(09/26/88) 4" 1 12640-12670 C 11/26/86 4" 1 12688-12704 C 11/26/86 K y< 4 12384' —2-7/8"AVA BR NP,D=2.25"!1.875'W/SLV 4" 1 12748-12772 C 11/26/86 �:' 1 x •BP&2 MEM.GAUGES RUN ON 11/29/87 4" 1 12792-12816 C 11/26/86 K`x I x 4' 1 12840-12876 C 11/26/86 i� �� 12389' H 7'X 2-7/8"BOT I-B PKR,D=3.750' 4" 1 12920-12930 C 11/26/86 J 1 12403' - I 2-7/8-AVA BNG NP W/REDUCER,D=1.812' 2-7/8"TBG-PC,6.5#,L-80, 0058 bpf,D=2.441" --I 1240T 12408' H 2-7/8"BOT MEG,D=2.441" I g 12590"eIm H 7"X 2-7/8"BOT 1-B PKR,D=3.750" IR 12611' —2-7/8"CAMCO DMP,D=1.813' ' W/CA-2 RUG(11/26/86) 2-718"TBG-PC,6.5#,L-80, .0058 bpf,D=2.441' — 12623' i ' 12624' —I2-7/8"BOT TT /SOS,D=2.56' I FBTD H 13375' •••••••1 /••••••• 7"LHR,29#,L-80,.0371 bpf,D=6.184" N 13422' ...............1 DATE REV BY COMMENTS NTTS DATE REV BY COMMENTS FRIAHOE BAY UNIT 10/23/86 N1 E5 INITIAL COMPLETION 07/30/12 RTwNJMD SET CMT RETTR&CMT(07/13-14/12) WELL. LGI-08 02/11/11 M3/JM) SSSV SAFEI Y NOTE 08/09/12 PJC FERE/SAFE!Y NOTE CORRECTION FERMT No:'1860570 06/04/12 GJF/JMD PULLED WFD WRP(05/30/12) AR No: 50-029-21562-00 06/04/12 GJF/JM) FISH JUNK ON"D"COLLAR(05/30/12) Sec.01,T11N,R14E, 1188'Ff'L&1669'FEL 06/17/12 PJC' DRAWING CORRECTION - 07/10/12 SET/JMD TBG PUNCHES(07106/12) 8P Exploration(Alaska) STATE OF ALASKA • ALASKA OIL AND GAS CONSERVATION COMMISSION Suspended Well Inspection Report Date Inspected. 05/30/15 Inspector: Matt Herrera ' Operator. BP Exploration Alaska Well Name: PBU LGI-08 Oper.Rep Matt Do/Kevin Parks PTD No 1860570 Oper.Phone. 907-659-5766 Location Verified? Yes Oper Email. ADC proiectswellinteoritvenaineer(a).bp corn If Verified,How? Distance from Lease Lines Onshore/Offshore • Onshore Suspension Date 09/05/12 Date AOGCC Notified 05/25/15 Sundry No: 312-087 Type of Inspection Subsequent Wellbore Diagram Avail.? Yes Well Pressures(psi) Tubing 50 psi Photos Taken? Yes IA 300 psi OA 0 psi Condition of Wellhead Well head looked good SSV was operational in closed position and opened to obtain Tubing pressure.SSV was left closed upon completion of , inspection.All gauges Tree Cap IA and OA were operational and clean Cellar was filled and Well house on well,flowlines disconnected and tapped blind installed, Condition of Surrounding Surface Location Drill site clear of snow no water around well house Gravel - Follow Up Actions Needed NONE - Comments Operator was notified to to keep regular pressure recordings on wellhead and monitor surrounding area for any leaks Attachments. Pictures(4) REVIEWED BY:/ Insp.Supry ,- 6, 1/01. Comm 5.000 PLB 12/2014 2015-0530_Suspend_PBU_LGI-08_mh xlsx Suspended Well Inspection—PBU LGI-08 PTD 1860570 Photos by AOGCC Inspector M. Herrera 5/30/2015 • WELL: LGI-08 Pnd.oe Bay Lint E 0OPER ATOP BP Elnioraton(Alaska)inc. AA MJMBER 50-029-21562-00-00 SUR.LOCATION NE 1 4,Sec.01.T11N R14E RAILING PERFKT 186-057 . g i'. id ili 44, 4 r , , it r -40111.• ♦ 111 • 2015-0530_Suspend_PBU_LGI-08_photos mh.docx Page 1 of 2 OP. %. 4 - ofdir - �� ,, w ilk; , , A It lig) .,,,, c Y i, / r---- . - , . "mar i • - 4 e �` y « s f Y 2015-053 0_Suspend_PBU_LGI-0 8_photo s_mh.docx Page 2 of 2 Image Project Well History File Cover Page XHVZE This page identifies those items that were not scanned during the initial production scanning. They are available in the original file, may be scanned during the rescan activity or are viewable by direct inspection of the file. RESCAN DIGITAL DATA [] Color items: D Diskettes, No. [] Grayscale items: [] Other, No/Type [] Poor Quality Originals: _ .j~' Other:~-'~-~ ORGANIZED BY~REN NOTES: VINCENT SHERYL MARIA LOWELL Project Proofing OVERSIZED (Scannable) [] Maps: Other items scannable by large scanner OVERSIZED (Non-Scannable) ~Logs of various kinds [] Other O IIIIIIIIIIIIIIIIIII Staff Proof By: Date: PROOFED BY: BEVERLY BREN VINCENT SHERYL MARIA LOWELL DATE: Is~ PAGES: /?~ (at the time of scanning) SCANNED BY: BEVERLY BREN VlNC~~MARIA LOWELL RESCANNED BY: BEVERLY BREN VINCENT SHERYL MARIA LOWELL DATE: /S/ General Notes or Comments about this file://0 ~ / ?'"" <~ ~ Quality Checked (done) Rev1 NOTScanned.wpd i • UNSCANNED, OVERSIZED MATERIALS AVAILABLE: f - FILE # To request any /all of the above information, please contact: Alaska Oil & Gas Conservation Commission ! 333 W. 7th Ave., Ste. 100 Anchorage, Alaska 99501 Voice (907) 279 -1433 Fax (907) 276 -7542 r RECEIVED • • STATE OF ALASKA SEP 2 5 2012 ALASKA OIL AND GAS CONSERVATION COMMISSION AOGCC WELL COMPLETION OR RECOMPLETION REPORT AND LOG la. Well Status: ❑ Oil ❑ Gas ❑ SPLUG ❑ Other ❑ Abandoned _ Suspended • 1b. Well Class: 20AAC 25.105 20AAC 25 110 . 0 Development ❑ Exploratory ❑ GINJ ❑ WINJ ❑ WAG ❑ WDSPL ❑ Other No. of Completions Zero ❑ Service ❑ Stratigraphic 2. Operator Name: 5. Date Comp., Susp., or Aband.: 12. Permit to Drill Number: BP Exploration (Alaska) Inc. 9/5/2012 186 - 057 312 3. Address: 6. Date Spudded: 13. API Number: P.O. Box 196612, Anchorage, Alaska 99519 - 6612 5/3/1986 . 50 029 - 21562 - 00 - 00 4a. Location of Well (Governmental Section): 7. Date T.D. Reached: 14. Well Name and Number: Surface: 5/24/1986 . LGI -08 1188' FNL, 1668' FEL, Sec. 01, T11 N, R14E, UM • Top of Productive Horizon: 8. KB (ft above MSL): 52' 15. Field / Pool(s): 3876' FSL, 3575' FWL, Sec. 31, T12N, R15E, UM GL (ft above MSL): Prudhoe Bay / Lisburne - Total Depth: 9. Plug Back Depth (MD +TVD): 4505' FSL, 4389' FWL, Sec. 31, T12N, R15E, UM 9000' 6721' 4b. Location of Well (State Base Plane Coordinates, NAD 27): 10. Total Depth (MD +TVD): 16. Property Designation: Surface: x - 689674 ' y 5976472 • Zone ASP4 13423' ' 9409' • ADL 028302 & 034628 • TPI: x- 694806 y- 5981669 Zone ASP4 11. SSSV Depth (MD +TVD): 17. Land Use Permit: Total Depth: x- 695604 y 5982318 Zone- ASP4 2143' 2143' 18. Directional Surve : 19. Water depth, if offshore: 20. Thickness of Permafrost (TVD): Y ❑ Yes ®No (Submit electronic and printed information per 20 AAC 25.050) N/A ft MSL 1900' (Approx.) 21. Logs Obtained (List all logs here and submit electronic and printed information per 20 AAC 25.071): 22. Re -Drill /Lateral Top Window MD/TVD: DLUMLL /SL /GR, FDC /CNUGR /CAL /Acoustilog. Acoustilog/GR, GR /PCM /DIL, DLL /SDT /NGT, LDT /EPT /CNUGR/CAL, LSS /GR/WF, RFT, CET. N/A GCT, CBTNDL /GR /CCL 23. CASING, LINER AND CEMENTING RECORD SETTING DEPTH MD SETTING DEPTH TVD HOLE AMOUNT CASING WT. PER FT. GRADE TOP BOTTOM ToP BOTTOM SIZE CEMENTING RECORD PULLED 20" 91.5# H -40 Surface 120' Surface 120' 30" 1700# Poleset 13 -3/8" 68# / 72# K -55 / L -80 Surface 4361' Surface 3979' 17 -1/2" 2450 sx AS III, 600 sx Class 'G' 9 -5/8" 47# L -80 Surface 11966' Surface 8477' 12 -1/4" 1125 sx Class 'G', 300 sx CS I 7" 29# L -80 11767' 13422' 8363' 9408' 8-1/2" 600 sx Class 'G' 24. Open to production or injection? ❑ Yes ® No 25. TUBING RECORD If Yes, list each interval open SIZE DEPTH SET (MD) PACKER SET (MD / ND) (MD +TVD of Top & Bottom; Perforation Size and Number): 2 - 7/8 ", 6.5 #, L - 12408' 11708' / 8328', 12389' / 8730' MD TVD MD TVD 2 - 7/8 ", 6.5 #, L - 80 12590' - 12624' 12590' / 8854' MA 2 0 V3 26. ACID, FRACTURE, CEMENT SQUEEZE, ETC. SCANNED F11\ 0 DEPTH INTERVAL (MD) AMOUNT AND KIND OF MATERIAL USED 11700' WFD Cement Retainer • 11690' 20.8 Bbls Class 'G' . 9000' 186 Bbls Class 'G' . 27. PRODUCTION TEST Date First Production: Method of Operation (Flowing, Gas Lift, etc.): Not on Production N/A Date of Test: Hours Tested: Production For OIL -BBL: GAS -MCF: WATER -BBL: CHOKE SIZE: GAS -OIL RATIO: Test Period Flow Tubing Casing Press: Calculated OIL -BBL: GAS -MCF: WATER -BBL: OIL GRAVITY -API (CORR): Press. 24 -Hour Rate 28. CORE DATA Conventional Core(s) Acquired? ❑ Yes .1 No Sidewall Core(s) Acquired? ❑ Yes ® No If Yes to either question, list formations and intervals cored (MD +TVD of top and bottom of each), and summarize lithology and presence of oil, gas or water (submit separate sheets with this form, if needed). Submit detailed descriptions, core chips, photographs and laboratory analytical results per 20 AAC 250.071. None li %W AS SEP 26 201 -1 , "5 Form 10 -407 Revised 12/2009 CONTINUED ON REVERSE 3,144 Su , I ngtnal Only r 29. GEOLOGIC MARKERS (List all formations aearkers encountered): 30. FORMATION TESTS NAME MD TVD Well Tested Yes ® No Permafrost`Top If yes, list intervals and formations tested, briefly summarizing test Permafrost Base results. Attach separate sheets to this form, if needed, and submit detailed test information per 20 AAC 25.071. Top Wahoo Zone 7 Truncated None Top Wahoo Zone 6 12074' 8539' Top Wahoo Zone 5 12216' 8624' Top Wahoo Zone 4 12362' 8713' Top Wahoo Zone 3 12634' 8881' Top Wahoo Zone 2 12730' 8942' Top Wahoo Zone 1 12792' 8982' • Formation at Total Depth (Name): 31. List of Attachments: Summary of Daily Work History, Well Schematic Diagram 32. 1 hereby certify that th or oing i t e an . r ct to the best of my knowledge. Signed: Joe Lastufk tle: Drilling Technologist Date: al /24-1 )9. , LGI -08 186 -057 312 -087 Prepared By Name/Number. Joe Lastufka, 564 -4091 Well Number Permit No. / Approval No. Drilling Engineer: Todd Sidoti, 564 -5113 INSTRUCTIONS General: This form is designed for submitting a complete and correct well completion report and log on all types of lands and leases in Alaska. Submit a well schematic diagram with each 10 -407 well completion report and 10 -404 well sundry report when the downhole well design is changed. Item 1 a: Classification of Service Wells: Gas Injection, Water Injection, Water - Alternating -Gas Injection, Salt Water Disposal, Water Supply for Injection, Observation, or Other. Multiple completion is defined as a well producing from more than one pool with production from each pool completely segregated. Each segregated pool is a completion. Item 4b: TPI (Top of Producing Interval). Item 8: The Kelly Bushing and Ground Level elevation in feet above mean sea level. Use same as reference for depth measurements given in other spaces on this form and in any attachments. Item 13: The API number reported to AOGCC must be 14 digits (ex: 50- 029 - 20123- 00 -00). Item 20: Report true vertical thickness of permafrost in Box 20. Provide MD and TVD for the top and base of permafrost in Box 28. Item 23: Attached supplemental records for this well should show the details of any multiple stage cementing and the location of the cementing tool. Item 24: If this well is completed for separate production from more than one interval (multiple completion), so state in item 1, and in item 23 show the producing intervals for only the interval reported in item 26. (Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval). Item 27: Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water Injection, Gas Injection, Shut -In, or Other (explain). Item 28: Provide a listing of intervals cored and the corresponding formations, and a brief description in this box. Submit detailed description and analytical laboratory information required by 20 AAC 25.071. Item 30: Provide a listing of intervals tested and the corresponding formation, and a brief summary in this box. Submit detailed test and analytical laboratory information required by 20 AAC 25.071. Form 10-407 Revised 12/2009 Submit Original Only • • LGI -08, Well History Date Summary 05/27/12 (Plug and Abondonment - Reservoir). MADE VARIOUS RUNS TO VERIFY FLAPPER ON TRSSSV IS OPEN. RAN A 2.25" LIB TO TAG TOP OF THE WRP AND SAT DOWN HIGH @10,666' SLM. (lib impression had marks of possible fill/ sand). 05/28/12 (Plug and abandonment - Reservoir). RAN 9' x 2.25" PUMP BAILER 3 TIMES (recovered approx 1 gal of what appears to be asphaltines). RAN 3' 1 1/4" STEM, 2.20" CENT, 2.0" LIB (impression of what appears to be fill). 05/29/12 (plug and abandonment - reservoir). RAN 9' x 2.25" PUMP BAILER 5 TIMES (recovered approx 2.0 gal of what appears to be asphaltines). RAN 3' x 1 1/2" STEM, 2.20" CENT, 2.0" LIB TO 11,703' SLM (impression of shear stud). ATTEMPT TO EQUALIZE WRP W/ 3' x 1 1/2" STEM 2.20" CENT, 2.25" WRP PULLING TOOL (unpinned). ATTEMPT TO PULL 2.25" WRP FROM 11,704' SLM. LEFT @ 5,749' SLM. 05/30/12 (plug and abandonment - reservoir). PULLED 2.25" WRP FROM 5,749' SLM. (missing element, 1/2" X 1" piece of metal skirt, and nose section). RATTLED ALL GLM'S WITH A 3' x 1 1/2" STEM, KJ, KJ, 2" G- RING. SAT DOWN @11,687' SLM. (possibly element). DRIFTED WITH A 2.20" CENT, 3' x 1 1/4" STEM, 2.3" WIRE GRAB (2 prong, 4 barb) TO 11,794' SLM (recover nothing). RAN 2 7/8" GR, 2 7/8" BAIT SUB WITH 1.34" CENTER SPEAR, SD @11,931' SLM. (recovered nothing). RAN 3' OF 1 1/2" STEM, 2.20" CENT, 2.0" LIB. SD @11,929' SLM (small impression of nose cone). RAN 2 7/8" GR, 2 7/8" BAIT SUB WITH 1.34" CENTER SPEAR, SD @11,931' SLM (fished out nose cone). RAN A 9' x 2.25" P- BAILER TO 11,928'. (recovered approx. 1/2 gallon of asphaltines, plastic coating and small pieces of wrp elements). 06/02/12 T /I /O 1950/742/250 Temp= SI Injectivity test **Inconclusive** (pre E -line) Pump 5 bbls MEOH & a total of 14.77 bbls crude down TBG for INJ test. INJ rate — 8 GPM, see log. FWHP's= 1947/753/250 DSO notified upon departure of SWV,SSV,CV =S /I IAV,OAV =OTG. 07/05/12 (E -LINE: TUBING PUNCH). INITIAL T /I /O = 2000/800/300. RUN # 1 = 10' OF 1.56" MEDIUM TUBING PUNCHER. (SHOT TBG PUNCH INTERVAL @ 11895.6' - 11905,6') * *PLAN CHANGED TO PULL UP 20FT FROM PLUG RATHER THAN 5FT DUE TO CASING COLLAR LOCATION ** RUN #2 = 10' OF 1.56" MEDIUM TUBING PUNCHER (SHOT TBG PUNCH INTERVAL = 11720' - 11730'). LAYED EQUIPMENT DOWN FOR THE NIGHT & RETURN AFTER LRS PERFORMS INJECTIVITY TEST. 07/06/12 (ELINE TBG PUNCH). INITIAL T /I /O = 500 / 800 / 450. INJECTION CONFIRMED THRU TBG PUNCH'S BY LRS CREW DURING THE NIGHT. RUN #3 = 10' OF 1.56" MEDIUM TUBING PUNCHER (SHOT TBG PUNCH INTERVAL @ 11600' - 11610'). WELL SHUT IN ON DEPARTURE - NOTIFIED PAD OP OF WELL STATUS. FINAL T /I /O = 500/800/450. 07/07/12 CTU #3 w/ 1.75" OD CT. Job Scope: Reservoir Abandonment <> MIRU- Perform weekly BOPE test. 07/08/12 CTU #3 w/ 1.75" OD CT. Job Scope: Reservoir Abandonment. MU and RIH w/ 2.2" OD carrier w /PDS memory GR /CCL logging tools inside. RIH cleanly to 11850' ctmd. Log correlation pass, paint flag and begin POOH. POOH to 5900'. Injector chain kinks at lower sprocket, cannot POOH. Kill well and standby for mechanics to repair. Page 1 of 3 • • • LGI -08, Well History Date Summary 07/09/12 CTU #3 w/ 1.75" OD CT. Job Scope: Reservoir Abandonment. Dealing with jammed CT injector chain at 5900' ctmd. Killed well with KCL and rectified problem. Started OOH and found marks in pipe that were questionable. Ran through UTIM, calipered, and ultra sonic tested wall thickness. Ovality of 1.675" below min standard of 1.68" Wall thickness of .119" below min of .121" due to gash in pipe from chains and blown out bearing. Blow down CT string with N2 in preparation for spooling off and Butt - welding pipe in yard. Begin RD. 07/11/12 (Res P &A) Heat up right tanks #03 #H06 #H03 fresh H2o to 90* 07/12/12 CTU #3 w/ 1.75" OD CT. Job Scope: Reservoir Abandonment. MIRU and pump 1.25" ball to drift butt - weld @ 5900' in CT string. Recover ball. MU and RIH w/ PDS memory GR /CCL logging tools in 2.2" OD carrier. 07/13/12 CTU #3 w/ 1.75" OD CT. Job Scope: Reservoir Abandonment. Tag at 292' w/ memory logging tools. Getting sticky above this depth and unable to circulate. POOH. Swap nozzle to DJN, fill CT w/ meth /water. RIH with PDS memory logging GR /CCL in 2.2" OD carrier w/ DJN, jet through ice from 292' - 300' and from 1909' with several bridges to 2032' ctmd. Continued in hole to 11850' bottom of logging Of' interval. Log up at 40 fpm stopped @ 11650' and painted flag for depth corrolation. continued logging up hole at 40 fpm and stopped at 11500' ctmd POOH and recovered data indicating a plus 8' correction. RIH Cl‘ w/ WFD FH one trip retainer and set at 11700 corrected depth. SD 8k and establish circulation. Inject , 20 3 hhls 15 8 ppg class G cement below retainer w/ no bump in circ pressurg. Pull out of retainer at 4k over and lay -in 0.5 bbl cement above retainer. Cleanout w/ biozan and slick KCL down to 11690' and (leaving estimated TOC in well at 11690' md) and POOH chasing at 80 %. 07/14/12 CTU #3 w/ 1.75" OD CT. Objective: P &A. POOH chasing at 80% w/ Slick 1% KCL. Wash BOPE & Tree, RIH w/ 1.75" BDN while pumping fresh water down CT and CT x TBG annulas, Stop at 9000' ctm and oumo 186 bbls of 15.8 ppq class 'G' cement down CT taking returns from IA. Pumped 1.5# Biozan washing TBG and dressing top of cement at 9000' ctmd, POOH from 9000' @ 80% washing TBG w/ Slick 1% KCL freeze protecting from 2500' to surface with 50/50 Methanol. Job complete. Left the following fluids in TBG & IA: Stage 1: TBG = WFD FH1 Cement Retainer @ 11700' - 12384' 15.8 ppg Class 'G' Cement. Straddle PKR area behind TBG 11708' - 12389' 15.8 ppg Class 'G' Cement. Stage 2: TBG = Surf - 2500' 50/50 Methanol, 2500' - 9000' Slick 1% KCL, 9000'- 11700' 15.8 ppg Class 'G' Cement. IA = Surf - 1942' Diesel, 1942' - 3139' 50/50 Methanol, 3139' - 9000 Fresh Water, 9000' - 11700' 15.8 ppg Class 'G' Cement. 09/05/12 Slickline, E -Line And Ct Tags [TAG] -(PLUG & ABANDONMENT - RESERVOIR). TAG 2 -7/8" TRDP -1A • TRSSSV @ 2115' SLM / 2143' MD. RAN FLAPPER CHECKER TO TRSV @ 2115' SLM/ 2143' MD, FLAPPER IS OPEN. RAN 2.25" CENT & S.BA 09/05/12 (plug & abandonment - reservoir). TAG 2 -7/8" TRDP -1A TRSSSV @ 2115' SLM / 2143' MD RAN FLAPPER CHECKER TO TRSV @ 2115' SLM/ 2143' MD, FLAPPER IS OPEN. RAN 2.25" CENT & S.BAILER, TAG TOC @ 8967' SLM, RECOVERED SAMPLE OF CEMENT (AOGCC witness waived by John Crisp). LRS & DHD PERFORM PASSING CMIT -TxIA TO 2500 psi ON 3RD ATTEMPT. Page 2 of 3 • LGI -08, Well History Date Summary 09/05/12 T/I/O =25 /vac/vac Temp =SI Assist SLine (AOGCC State Witnessed waived by John Crisp) CMIT -TxIA to 2500 psi PASSED (PLUG AND ABANDONMENT) Pumped 9.2 bbls of 40* meth down IA to reach 2500 psi for CM IT TxIA 1st test 1st 15 min lost 14/36 psi 2nd 15 min lost 8/25 psi for a total of 22/61 psi in 30 , C min RE -PSI w /..2 2nd test 1st 15 min lost 11/23 psi 2nd 15 min lost 8/19 for a total of 19/42 psi in 30 min G% RE -PSI w /.1 3rd test 1st 15 min lost 8/21 psi 2nd 15 min lost 3/17 psi for a total of 11/38 psi in 30 min Bleed TxIAP down bleed back aprox. 9 bbls S -line on well on dep. Wing shut swab open ssv open master open casing valves open to gauges Final Whp's= 44/23/vac. Page 3 of 3 TREE= 5-1/8" FMC • WE LI-EAD = FMIC SA OTES: WELL REQUIRES A SSSV. ACTUATOR:- . AXELSON L U I _U KB_ B ..EV = 52.0' BF. aEV = NA I KOP= 2400' 20" CONDUCTOR -{ -120 I) 2143' H 2 -718" CAM- T11DP -1A TRSSSV, ID= 2.312" I Max Angle = 60° rg 9900' Datum MD= 12,745' 91.5#, H 40, C E7viCAL INJECTION MANDRELS DafumTVD= 8900' SS F) = 19.124" ® ST MD TV D DEV TYPE VLV LATCI PORT DATE 1 2199 2199 6 KBMG -L DMY BK -2 0 10/03/88 13 -3/8' CSG, 72#, L -80, ID =12.347' H 4361' GAS LET MANDREL Minimum ID = 2.312" i 2143' NP ST MD TND DEV! TYPE VLV LATCI- FORT DATE 2 2842 2823 21 TE/TD DMY BK 2 0 10/22/86 2 -7/8" CAMCO SSSV TRAP -1A 3 6164 5057 52 TEITMPD OW *BK -2 ••- 10/22/86 4 9074 6768 50 TOMS) DMY BK 2 0 11/23/92 TOC(07 /14/12) 9000' ' r V # F � �# 5 11134 7963 51 TEJTMPD CAW BK 2 0 10/22/86 tat : F � " 6 11614 8269 50 1 TEITM D ECI DMY RKP 0 07/05/93 TBG Ptt1 I (07/06/12) 11600' - 11610' ' * STA # 3= DMY HAS A BROKEN LATCH (TAGGED 12/04/87) 4010 Ill".4.4440,4 .4 Ih 12 -7/8' WFD CEMENT RETAN ER (07/13/12) -- 11700' = ► Sb. 1 11708' H9-5/8" X 2 -7/8' BOT F8 PKR, Co = 4.000' TBG FINCH (07/06/12) 1-- 11720' - 11730' j 11753' -I OF BOT TEBACK SLEEVE 1 4 # 4 11767• I- 19 -5/8" X 7' BOT LNR HANGER I ; ; . f ' -11925' - FLSH: 1!2" X 1" PIECE OF METAL SKIRT& TBG PUNCH (07/06/12) 1 11895' 11905' # ' -1- 112" WRP ELEMENT (05/30/12) # -..•- I. 1 11925' 1 D- COL STOP, G- PACKOFF W/ PX -PLUG 1 9 -5/8" CSG, 47 #, L -80, ID = 8.681' --1 11966' 1- A (01/10/94) - ( P-PRONG PULLED ON 08/24/01) Iv ovi 4001 *4 PERFORATION SUMMARY ## PRODUCTION MANDRELS REF LOG: LDT /ESL ON 05127/87' ## ST MD I TVD DEV TYPE VLV LATCH 'PORT DATE ANGLE AT TOP PE3RF: 52° et 12300' mil ' 1 7 12253 86471 52 TEITMPD DMY , BI-2 0 11/14/86 Note: Refer to Production DB for historical perf data VI BENT LATCH (TAGGED 04 /05/89)- DO NOT RERUN SIZE SPE INTERVAL Opn/Sqz DATE # 104 V 4" 4 12300 -12350 S 07/14/12 4+ 12323' I-i 60' OF BOT BLAST JTS, ID = 2.441" 1 2 -1/8' 4 12389 -12477 C 09/08/01 '40 0 o 2 -1/8' 4 12506 -12550 C 09/08/01 404 • E • # _ 1 12334 sim H FISH - ECIOGLV AND BROKEN LATCH (09/26/88)1 4" 1 12640 -12670 C 11/26/86 4 # 4" 1 12688 -12704 C 11/26/86 k 40 # ♦ 12384' - 2-7/8' AVA BPL NP, D = 2.25" / 1.875" W/ SLV 4" 1 12748 -12772 C 11/26/86 # l k * BP & 2 Maul. GAUGES RU I ON 11/29/87 4" 1 12792 -12816 C 11/26/86 ,'# i F� 4" 1 12840 -12876 C 11/26/86 �� 1 12389' I- 7' X 2 -7/8" BOT I-B PKR, D= 3350" 1 4" 1 12920 12930 C 11/26/86 1 12403' H 2 -7/8 "AVA BNG NIP W/ REDUCER, 13 =1.812' 1 2 -7/8" TBG -PC, 8.5#, L -80, .0058 bpf, ID = 2.441' 12407' 12408' -f 2-7/8" BOT WLEG, ID = 2.441' 1 >-. ►�. I 12590'elm H 7' X 2 -7/8" BOT I-B PKR, D = 3.750" 1 , 12611' - 2- 7 /8 " CAMCO D NP, U= 1.813" WI CA -2 PLUG ( 11/26/86) 2 -718" TBG -PC, 6.5#, L -80, ,0058 bpf, ID = 2.441' H 12623' I I 12624' H2-7/8* SOT TTUSOS, ID = 2.56' 1 I MOD 1 13375' WO•PA•i'et 1 7 "LNR, 29#, L -80, .0371 bpf, N) = 6.184' H 13422' • • • • • • • DATE I REV BY COM' u:NTS DATE REV BY 1 COMMENTS I FRUDHOE BAY UNIT j 10/23/86 N1 ES INITIAL COMPLETION 07/30/12 RMYJM D SEE Gull RET IIR & CMT (07/13- 14/12) WELL: LGI-08 . 02/11/11 MB/JM) S S S V S A F E T Y NOTE 08/09/12 P J C PEE T / S A F E T Y NOTE CORRECTION F T No: r 1860570 06/04/12 GJF /JMM) FULLED WFD WRP (05/30/12) API No: 50- 029 - 21562 -00 06/04/12 GJF /JM) FISR JUNK ON "D^ COLLAR (05/30/12) Sec. 01, T11N, R14E, 1188' FIB & 1669' FE- ", 06/17/12 PJC' DRAWNG CORRECTION 07/10/12 SET/JMD TBG RJ (07/06/12) BP Exploration (Alaska) i • Page 1 of 1 Schwartz, Guy L (DOA) From: Schwartz, Guy L (DOA) Sent: Tuesday, June 12, 2012 2:46 PM To: 'Sidoti, Todd' Subject: RE: Sundry to Suspend Well LGI -08: 312 -087 (PTD 186 -057) Todd, You have approval to make the change in the cementing depth in the tubing. The well will still be secured properly and prevent the movement of fluid out of zone. Guy Schwartz Senior Petroleum Engineer AOGCC 793 -1226 (office) 444 -3433 (cell) From: Sidoti, Todd [mailto:Todd.Sidoti @bp.com] Sent: Monday, June 04, 2012 1:39 PM To: Schwartz, Guy L (DOA) Subject: Sundry to Suspend Well LGI -08: 312 -087 JUL z MitiNED 2012 Hello Guy, I am the intervention engineer working toward the suspension of well LGI -08. We ran into an issue while working on this well, we are not able to inject down the tubing through the G- packoff which is stuck in the hole at 11925'. As a result of this we will only be able to fill up the tubing with cement to 11925' versus the proposed depth of 12253'. I have attached schematics of the original versus new proposed wellbore status. I am seeking approval to continue with the program using the newly proposed cement depth in the tubing. I hope that this was clear, please let me know if you have any questions. Thanks, Todd Todd Sidoti I BPXA Well Intervention Engineer I Dir 907 - 564 -5113 I Cell 907 - 632 -4113 I todd.sidoti@bp.com 6/12/2012 TREE= 5- 1 /8 " FMC 10M • i py WELLHEAD - FMC NOTES: WELL REQUIRES A SSSV. FISH IN ACTUATOR - AXE SON LGI-08 @ 12334' SLM (EDGLV & BROKEN LATCH). KB. ELEV 52.0' 4 -JUN -2012 BF. ELEV - NA 'KOP= 2401' Proposed Max Angle = 60 @ 9900' , 2 143' H 2 -7/8" CAM- TRDR1A TRSSSV. D= 2.312" Datum MD= 12.745 Datum TV = 8900 SS II NJECTKON MANDRELS IF 1 1ST! 2MD 2 D D0 I GAS K L VLV ( BKt2H ( PORT DATE S LFT MANDRELS 13 -3l8" CSG. 72 #. L -80. D = 12 -347" H 4361' f ST MD ND DEV TYPE VLV LATCH PORT DATE II 1 2842 2822 19 TBTMPD BK -2 TOC 9180' 2 6164 5057 52 TBTMPD BROKEN �•iii��•iii'iiii� 3 9074 6768 50 TBTMPD BK -2 ••:•: ri : *. *..� 4 11134 7963 51 TBTMPD BK -2 Minimum ID = 2.312" @2143' 5 11614 8269 50 TBTMPD RKP 2-7/8" CAMCO SSSV TRDP -1A •••••••i •••' �. �_.t o• -• -• ...v.v. 11708 9 -5/8" X 2 -718" BOT HB PtCR D = 4.000" V n..'l....... 1 1753 HTOP OF BOT TEBACK SLEEVE I::: 11767' 9 -558 X 7" BOT LNR HANGER •• ; °� 11925 '.•.' ;:::1 D- COLLAR STOP. G- PACKOFF W! PX -PLUG 9 -5!8' CSG. 47 #. L -80. ID= 8.681" 11966' i ❖ i �:•:' " P -PRONG PULLED ON 08/24/01 6 ��a I;1 PERFORATION SLMMARY REF LOG: LDT /CNL ON 05/27/87 PRODUCTION MANDRELS ANGLE AT TOP FERF: 52 @ 12300' $. :+ :_ :! � c . � ST MD ND DEV TYPE VLV LATCH PORT DATE � . Note: Refer to Production DB for historical perf data W % :�i 1 12253 8592 52 TEMPI) BK -2 SOLE SPF INTERVAL Opn/Sgz DATE % :� :O.i 4" 4 12300 - 12350 C 09/08/01 p: I 2 -1/8" 4 123$9 - 124T7 C 09/08101 12323' 60' OF BOT BLAST ITS. D = 2.441" I 2 -118" 4 12506 - 12550 C 09/08/01 ,..i, , •� 4" 1 12640 - 12670 C 11/26/86 i❖ 110 12334'slm FISH - EDGLV AND BROKEN LATCH (09/26/88)' 4" 1 12688 - 12704 C 11126/86 ':• :• i• :'i 4" 1 12748 -12772 C 11126/86 ��:* ,' 12384' 2 -7/8" AVA BPL NP. D = 2.25" 1 1,875° W/ SLV 4" 1 12792 - 12816 C 11/26/86 '.•••: , I k:$ .. .. BP& 2 MBA GAUGES RUN ON 11/29/87 4" 1 12840 - 12876 C 11/26/86 ►, / 12389' H r x 2 -7/8" BOT I-B FKR. D = 3.750" 4" _ 1 12920 - 12930 C 11/26/86 ' 12403' H 2 -7/8 "AVA BING NP W/ REDUCER. D = 1.812" 12- 7/8" TBG -PC. 6.5#. L- 80..0058 bpf. D = 2.441" H 12407' { I 12408' 2 -7/8" BOT GG. D = 2.441" I OM CI 12590'e I m H 7" X 2 -7/8" BOT I-B PKR D = 3.750" I ,� I 12611' 2 -7/8" CAMCO D NIP D = 1.813" I W/ CA -2 PLUG (11/26/86) 2 -7/8" TBG -PC. 6.5#, L- 80..0058 bpf. D = 2.441" 12623' 12624' -- 1 2-7/8" BOT TTUSOS. ID = 2.56" I P8TD 13375' VPf1'ef1'1 1 7"LNR. 29 #. L-80..0371 bpf. D = 6.184" H 13422' 1�•�•�•�•� DATE REV BY COMMENTS DATE REV BY COMMENTS PRUDHOE BAY UNfl 10/23/86 ORIGINAL COMPLETION WELL: LGI-08 12/30/01 CI- KAK CORRECTIONS PERMIT No: 186-0570 12/ 19103 CAO /TLH FULL & RESET BP AR No: 50- 02921562 -00 10/28/06 CJ■/PAG PULL BKR BPISET WFD @ 11731' 1188' FNL & 1668' FEL. Sec. 01. T11 N. R14E 03/01107 RL DATUM MD 02/11/11 MB'JMD ADDED SSSV SAFETY NOTE EP Exploration (Alaska) TREE = 5-1/8" FMC 10M • S NOTES: WELL REQUIRES A SSSV. FISH IN WELLHEAD = FMC V11e @ 12334' SLM (BDGLV & BROKEN LATCH). ACTUATOR = AX8_SON L G I -O 8 B.ELEV 52.0' - NA BF. EL Original E�J KOP = 2400' Proposal Max AnuL - 60 @ 9900' 2143' 2-7/8" CAM- TRDRIA TRSSSV. D = 2.312" L;��ruf °, MD -- ' 2 =45 • 0 I H 1 Datum TV D = 8900' SS CHEMICAL NJB TOON MANDRELS I j I ST 21 9 1214771 D 0 + KBMG -L ( VLV LATCH I PORT( D ATE G AS LIFT MANDRELS L 13 "3/8' CSG. 72 #. L -80. D = 12.347" H 4361' : k ST MD TVD DEV TYPE VLV LATCH PORT DATE 2842 2822 19 TBTMPD BK -2 19180' - TOC � •O•••�.•O••: r••Op• 2 6164 5057 52 T6'TMP'D BROKEN ••••••• r.... :MAO eii•APii••ii 3 9074 6768 50 TE/TTvPD BK -2 ' Wi rr r �iiii ii � iiii� 4 11134 7963 51 TEMPO BK -2 Minimum ID = 2.312" @ 2143 ��_ rp• 5 11614 8269 50 TBTMPD RKP 2-7/8" CAMCO SSSV TRDP -1A .4.woo • •...■..►.- .....w..• 11708' H9 -518" x 2-718" BOT NB FKR. D = 4.000" ►��►�►1 •• ►•••••►•••••!r• :441 11753' ' - ' TOP OF BOT TEBACK SLEEVE I .•.�► .. f ►ii!►•i 11767' H9- 5/8"X7" BOT LNR HANGER ►i�►O•iir�•i! :i$0iii'i* : o.. ' 9 CSG, 47 #. L - 80. ID= 8.681" 11966' ►• : !r•O� .. ► ❖i ►. ❖.!r❖i ► ❖i :• :•:4 ❖i ► ► 1 . 1 . 1 ! 1.1.1 ► ❖i�. ❖.•r ❖i PERFORATION SUVA/ARV O.Oo•. *.ir..•C REF LOG: LDT /CNL ON 05/27/87 ►•!00•.!r•••i PRODUCTION MANDRELS ANGLE AT TOP FERF: 52 @ 12300' ►ii y� ; 0 ST MD ND DEV TYPE VLV LATCH PORT DATE Note: Ref er to Production DB for historical pert data ►.�.�- �,• -�: r 4 i 1 12253 8592 52 Tf3TA4PD BK -2 SIZE SPF INTERVAL Opn /Sgz DATE ►:•: i ❖:•::•:, 4" 4 12300 - 12350 C 09/08/01 :•:* ►ii! ':•:•: Oi O.. <►O i'�•1 2 -1/8" 4 12389 - 12477 C 09108/01 ►.•.4 :•�� iii ►••; 12323' 60' OF BOT BLAST JIB. D = 2 -441" I 2 -1/8" 4 12506 - 12550 C 09/08/01 :;4 'tt•% iii '•••' 1l• �' 12334'sim FlSH - EDGLV AND BROKEN LATCH {09!26/88)( 4" 1 12640 12670 C 11/26/86 %v. -�.�! 4° 1 12688 - 12704 C 11/26/86 %%i %4 ► : . . • �.. 4" 1 12748 - 12772 C 11/26/86 0•�. �, 1 ;.7i, 1 2384' 2 -7/8" AVA BPL NP. D = 2.25"i 1.875" W/ SLV 4" 1 12792 - 12816 C 11/26/86 ►•ii 1 iii ' BP& 2 MEM. GAUGES RUN ON 11/29/87 4" 1 12840 - 12876 C 11/26/86 a a 4" 1 12920 - 12930 C 11/26/86 12389' H 7" X 2 -718" BOT I-8 FKR D = 3.750' I 12403' h 2 -7/8 "AVA BNG NP W/ REDUCER D = 1.812" ' 2- 718" TBG -PC. 6.5#. L- 80..0058 bpf. ID. 2.441" H 12407' I 12408 ' W LEG. D = 2.441" z It�� 112590'e l m H r X 2-7/8" BOT I-B FKR D =3.750" I IN L 12611' 2 -7/8" CAMCO D NIP. D= 1.813" I WI CA -2 PLUG (11/26/86) 2 -7/8" TBG -PC. 6.5#. L- 80..0058 bpf. ID = 2.441" 12623' / 12624' H 2 -7/8" BOT TTUSOS. ID .2.56" I PBTD 13375' wog v 71LNR. 29 #. L- 80..0371 bpf. D .6.184" H 13422' ►��+ DATE REV BY COMMENTS DATE REV BY COMMENTS PRUDHOE BAY UNIT 10/23)86 ORIGINAL COM PLETION WELL: LGb08 12130 /01 CH`KAK CORRECTIONS PERMIT No: 186-0570 12/19/03 CAO ITCH RJLL & RESET BP AR No: 50 -029- 21562 -00 10/28/06 CJNJPAG FULL BKR BP,SET WFD @ 11731' 1188' FNL & 1666 FEL. Sec. 01. T11N. R14E 03/01/07 RL DATUM MD 02/11/11 MB /JMD ADDED SSSV SAFETY NOTE BP Exploration (Alaska) • • 52 I � R a , 1 EANPARNELL, GOVERNOR " S „ ALASKA OIL AND GAS 333 W. 7th AVENUE, SUITE 100 CONSERVATION COMMISSION ANCHORAGE, ALASKA 99501 -3539 PHONE (907) 279 -1433 FAX (907) 276 -7542 Clint Spence Petroleum Engineer . .` - '' , tli}i 'i 2 ZW2 BP Exploration (Alaska), Inc. P.O. Box 196612 Anchorage, AK 99519 -6612 6 1 () � — o g7 Re: Prudhoe Bay Field, Lisburne Oil Pool, LGI -08 — -- Sundry Number: 312 -087 Dear Mr. Spence: Enclosed is the approved Application for Sundry Approval relating to the above referenced well. Please note the conditions of approval set out in the enclosed form. As provided in AS 31.05.080, within 20 days after written notice of this decision, or such further time as the Commission grants for good cause shown, a person affected by it may file with the Commission an application for reconsideration. A request for reconsideration is considered timely if it is received by 4:30 PM on the 23rd day following the date of this letter, or the next working day if the 23rd day falls on a holiday or weekend. Sincerely, Cath P2Ve,,e,,94 Foerster Chair 6DATED this day of March, 2012. Encl. P D-S 3141 Z F .-- -• STATE OF ALASKA ALMA OIL AND GAS CONSERVATION COMMI•ON I RECEIVEDs›wa • APPLICATION FOR SUNDRY APPROVALS1 20 AAC 25.280 { MA+ ; 9 1. Type of Request: Abandon ❑ Plug for Redrill ❑ Perforate New Pool Ill Repair Well ❑ I Change Ap oved� III Suspend 0 - Plug Perforations ❑ Perforate Ill Pull Tubing ❑ 1 Time Extension ❑ i Operation Shutdown ❑ Re -enter Susp. Well ❑ Stimulate ❑ Alter Casing ❑ i Other: her !t` OI! & Gas Cons. LORlf;11aj(I'I ' f, 2. Operator Name: 4. Current Well Class: ' 5. Permit to Drill t ith &f:ciYU BP Exploration (Alaska), Inc. Development ❑ Exploratory ❑ '- f86- X3570;"" ----- 3. Address: P.O. Box 196612 Stratigraphic ❑ Service o . 6. API Number: Anchorage, AK 99519 -6612 50- 029 - 21562 -00 -00 7. If perforating, closest approach in pool(s) opened by this operation to nearest 8. Well Name and Number: property line where ownership or landownership changes: 111 LGI -08 ' Spacing Exception Required? Yes III No 9. Property Designation (Lease Number): 10. Field / Pool(s): ADLO - 034628 ' PRUDHOE BAY Field / LISBURNE OIL Pool - 11. PRESENT WELL CONDITION SUMMARY Total Depth MD (ft): Total Depth TVD (ft): Effective Depth MD (ft): Effective Depth TVD (ft): Plugs (measured): Junk (measured): 13423 - 9409 • 13375^ 9375 11730, 11925, 12611 12334 Casing Length Size MD TVD Burst Collapse Structural Conductor 80' 20" 91.5# H -40 37 117 37 117 1490 470 Surface 4325' 13 -3/8" 72# L -80 36 4361 36 3980 4930 2670 Production 11931' 9 -5/8" 47# L -80 35 11966 35 8477 6870 4760 Liner 1669' 7" 29# L -80 11753 13422 8355 9408 8160 7020 Liner 34' 2 -7/8" 6.5# L -80 12590 12624 8854 8875 10570 11160 Perforation Depth MD (ft): Perforation Depth TVD (ft): Tubing Size: Tubing Grade: Tubing MD (ft): SEE ATTACHED - - 2 -7/8" 6.5# L -80 33 12408 Packers and SSSV Tvoe: 2 -7/8" BOT HB Packer Packers and SSSV MD and TVD (ft): 11708 8328 2 -7/8" BOT I -B Packer 12389 8730 2 -7/8" BOT I -B Packer 12590 8854 12. Attachments: Description Summary of Proposal ❑ 13. Well Class after proposed work: Detailed Operations Program ❑ BOP Sketch ❑ Exploratory ❑ Development ❑ Service El - 14. Estimated Date for 15. Well Status after proposed work: Commencing Operations: 3/13/2012 Oil ❑ Gas ❑ WDSPL ❑ Suspended - 0 16. Verbal Approval: Date: WINJ ❑ GINJ ❑ WAG ❑ Abandoned ❑ Commission Representative: GSTOR ❑ SPLUG ❑ 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. Contact Clint Spence Printed Name Title t Sp ce Title PE Signature / 0 ■ Phone Date l 564 -5709 2/28/2012 Prepared by Nita Summerhays 564 -4035 COMMISSION USE ONLY -oh Conditions of approval: Notify Commission so that a representative may witness Sundry Number: �` — V Plug Integrity i BOP Test ❑ Mechanical Integrity Test 111 Location Clearance r] Other: .� A 14. r / / P /4/.. / ara & C..1J / / ° ` b•-) At a f7 -i si°G . Subsequent Form Required: 1 4 /07 APPROVED BY Approved by: _ +.,,, ._ � 4 COMMISSIONER THE COMMISSION Date: 3 - - MAR o 7101. "` ORIGINAL � 7 ;7 0 - Submit in Duplicate Form 10-403 Revised 1/2010 ;/ 3- 57 z LGI -08 186 -057 PERF ATTACHMENT Sw Name Operation Date Perf Operation Code Meas Depth Top Meas Depth Base Tvd Depth Tor Tvd Depth Base LGI -08 6/1/86 PER 12,300. 12,350. 8,675.49 8,706.13 LGI -08 6/1/86 PER 12,920. 12,930. 9,064.87 9,071.4 LGI -08 6/1/86 PER 12,792. 12,816. 8,981.83 8,997.3 LGI -08 6/1/86 PER 12,748. 12,772. 8,953.62 8,968.98 LGI -08 6/1/86 PER 12,840. 12,876. 9,012.82 9,036.18 LGI -08 6/1/86 PER 12,640. 12,670. 8,885.22 8,904.11 LGI -08 6/1/86 PER 12,506. 12,550. 8,801.8 8,829.01 LGI -08 6/1/86 PER 12,389. 12,477. 8,730. 8,783.95 LGI -08 6/1/86 PER 12,688. 12,704. 8,915.48 8,925.62 LGI -08 11/26/86 BPS 12,611. 12,640. 8,867.03 8,885.22 • LGI -08 8/24/01 BPS 11,925. 12,300. 8,453.99 8,675.49 LGI -08 9/8/01 BPS 9,355. 12,930. 6,947.17 9,071.4 LGI -08 12/9/03 BPP 12,300. 13,423. 8,675.49 9,409.15 LGI -08 12/19/03 BPS 11,730. 12,930. 8,340.93 9,071.4 LGI -08 10/27/06 BPP 11,730. 12,930. 8,340.93 9,071.4 AB ABANDONED PER PERF APF ADD PERF RPF REPERF BPP BRIDGE PLUG PULLED SL SLOTTED LINER BPS BRIDGE PLUG SET SPR SAND PLUG REMOVED FCO FILL CLEAN OUT SPS SAND PLUG SET FIL FILL SQF SQUEEZE FAILED MIR MECHANICAL ISOLATED REMOVED SQZ SQUEEZE MIS MECHANICAL ISOLATED STC STRADDLE PACK, CLOSED MLK MECHANICAL LEAK STO STRADDLE PACK, OPEN OH OPEN HOLE 411 TREE = 5 -118" FMC 10M • SAF•NOTES: WELL REQUIRES A SSSV. FISH IN WELLHEAD = FMC ACTUATOR = AXELSON L G 1 • 0 8 WELL @ 12334' SLM (EDGLV & BROKEN LATCH). KB. ELEV = 52.0' BF. ELEV = NA KOP = 2400' Max Angle = 60 @ 9900' 1 2143' H 2 -7/8" CAM - TRDP -1A TRSSSV, 0 = 2.312" 1 Datum MD = 12,745' Datum TVD = 8900' SS CHEMICAL INJECTION MANDRELS ll ST MD TVD DEV TYPE IVLV LATCH PORT DATE 1 2199 2147 0 KBMG -L BK -2 GAS LIFT MANDRELS 1 13 -3/8" CSG, 72 #, L -80, ID = 12.347" H 4361' HA GE ' ST MD TV D DEV TYPE VLV LATCH PORT DATE 1 2842 2822 19 TE/TMPD BK -2 2 6164 5057 52 TE/TMPD BROKEN 3 9074 6768 50 TE/TMPD BK -2 4 11134 7963 51 TE/TMPD BK -2 Minimum ID = 2.312" @ 2143' 5 11614 8269 50 TFJTMPD RKP 2 -7/8" CAMCO SSSV TRDP -1A 11708' 1---1 -5/8" X 2 -7/8" BOT HB PKR, ID = 4.000" 1 11731' 1 - 14 - 1/2" WFD PLUG SET (10 /28/06) 1 l 11753' 1 - 1 TOP OF BOT TIEBACK SLEEVE 1 1 11767' H 9 -5/8" X 7" BOT LNR HANGER 1 07 3z /MVO ■ 1 11925' 1 — D-COLLAR STOP, G- PACKOFF W/ PX -PLUG 1 9 -5/8" CSG, 47 #, L -80, ID = 8.681" 1--I 11966' A " P -PRONG PULLED ON 08/24/01 PERFORATION SUMMARY REF LOG: LDT /CNL ON 05/27/87 PRODUCTION MANDRELS ANGLEATTOPPERF: 52 @ 12300' In ST MD I TVD DEVI TYPE VLV LATCH PORT DATE Note: Refer to Production DB for historical perf data 1 _ 12253 8592 52 TE/TMPD_ _ BK -2 SIZE SPF INTERVAL Opn /Sqz DATE II 4" 4 12300 - 12350 C 09/08/01 2 -1/8" 4 12389 - 12477 C 09/08/01 . 12323' 1 - 1 60' OF BOT BLAST JTS, ID = 2.441" 1 2-1/8" 4 12506 - 12550 C 09/08/01 4" 1 12640 - 12670 C 11/26/86 1 12334'slm H FISH - EDGLV AND BROKEN LATCH (09/26/88)1 4" 1 12688 - 12704 C 11/26/86 4" 1 12748 - 12772 C 11/26/86 L 12384' 1 — 2 -7/8" AVA BPL NIP, ID = 2.25" / 1.875" W/ SLV 4" 1 12792 - 12816 C 11/26/86 1 * BIP & 2 MEM. GAUGES RUN ON 11/29/87 1 4" 1 12840 - 12876 C 11/26/86 Z21 ►C41 1 12389' 1 - 1 7" X 2 -7/8" BOT I-B PKR, ID = 3.750" 1 4" 1 12920 - 12930 C 11/26/86 1 12403' J - 1 2-7/8"AVA BNG NIP W/ REDUCER, 0 = 1.812" 1 1 2 -7/8" TBG -IPC, 6.5 #, L -80, .0058 bpf, 0 = 2.441" 1-I 12407' 1 12408' -1 2-7/8" BOT WLEG, ID = 2.441" 1 z ko 12590'eIml - 1 7" X 2 -7/8" BOT I-B PKR, 0 = 3.750" 1 = 1 12611' 1 2 -7 /8" CAMCO D NIP, ID = 1.813" 1 W/ CA -2 PLUG (11/26/86) 1 2 -7/8" TBG -IPC, 6,5 #, L -80, .0058 bpf, ID = 2.441" 1-L 12623' 1 i 12624' J BOT TTL /SOS, ID = 2.56" 1 (PBTD 1-1 13375' *WOW 1 1 7 "LNR, 29 #, L -80, .0371 bpf, ID = 6.184" 1 13422' .1.1.1.x.1.1,1. / DATE REV BY COMMENTS DATE REV BY COMMENTS PRUDHOE BAY UNIT 10/23/86 ORIGINAL COMPLETION WELL: LGI-08 12/30/01 CH/KAK CORRECTIONS PERMIT No: 186 -0570 12/19/03 CAO /TLH PULL & RESET IBP AR No: 50- 029 - 21562 -00 10/28/06 CJN/PAG PULL BKR IBP /SET WFD @ 11731' 1188' FNL & 1668' FEL, Sec. 01, T11N, R14E 03/01/07 RL DATUM MD 02/11/11 MB /JMD ADDED SSSV SAFETY NOTE BP Exploration (Alaska) • • Summary of Proposed Work BP Exploration Alaska Inc (BPXA) Reservoir Abandonment Well LGI -08 PTD: 86 -57 API: 50- 029 -21562 As part of BP's risk mitigation program to minimize the number of unsecured non- 0V- operable wells across its area of operation, well LGI -08 has been targeted for reservoir abandonment. As per AOGCC definitions, the proposed work will be for suspending the well. This will isolate the reservoir but still allow access to the welibore for re -entry or sidetrack in the future. LGI-08 has been shut in since July 1994 due to T x IA communication, there is a hole in the tubing at 9,266' MD. There is junk in the well at 12,334', multiple fishing attempts ✓ have been made to recover the fish but all have been unsuccessful. The abandonment will require cement to be pumped in two stages. For the first stage, coil tubing will stab into a cement retainer placed at 11,700' and downsqueeze cement. This will leave cement in the tubing from the packer at 11,708' to the production mandrel at 12,253'. Holes previously shot below the cement retainer will allow the 2- 7/8" x 7" annulus to fill with cement from 11,708'- 12,389'. For the next stage we will unsting from the cement retainer and lay in a plug filling the tubing and 2 -7/8" x 9 -5/8" annulus with cement from 9,180'- 11,708'. Geologic Tops: Ivishak 11,260' MD (7,990' TVD); Lisburne Wahoo: 12,075' MD (8,488' TVD) Well History LGI -08 is a conventional Lisburne oil producer drilled in 1986. • 17 -1/2" hole drilled to 4,361' o 13 -3/8" 68 & 72# casing cemented with 4,753 ft ASIII & 690 ft Class G • Cement job went as planned with full returns • 12.25" hole drilled to 11,966' o 9 -5/8" 47# casing cemented with 1121 ft Class 'G' & 320 ft 50/50 Pozzalow Class 'G' • CBL ran 5/28/96 shows TOC at 9,180' • 8.5" hole drilled to 13,422' o 7" 29# casing cemented with 822 ft 35/65 Pozzalow Class 'G' • CBL ran 6/3/86 shows fair cement throughout 7" section • Firm cement tagged at 11,377' (375' above liner top) after cement job For questions or comments: Contact Office Cell Todd Sidoti 907 564 -5113 907 632 -4113 • • w /a: Well File Volumes Tubing OD ID bbl /ft 2 -7/8 ", 6.5# 2 -7/8" 2.441" 0.0058 Casing OD ID bbl /ft 7" 29# 7" 6.184" 0.371 9 -5/8 ", 47# 9 -5/8" 8.681" 0.0732 Annular Capacity 2 -7/8" x 7" 0.0291 Annular Capacity 2 -7/8" x 9 -5/8" 0.0652 First Cement Plug: Tbg volume from packer (11708') to production mandrel (12253') 3.2 bbl / Annular volume from packer (11708') to packer (12389') 19.8 bbl Total Cement Volume 23 bbl Second Cement Plug: Tbg volume from 9180'- 11708' 14.7 bbl IA volume from 9180' - 11708' 164.8 bbl Total Cement Volume 179.5 bbl Estimated Cost: $200k 1. 0 Service tree valves and annular valves. PT all valves. PPPOT -T and IC. Shoot fluid levels in Tubing, IA, and OA 2. S Pull WRP. Drift & tag with 2" s- bailer 3. F Injectivity Test / 4. E Punch tubing below 9 -5/8" packer at 11716' ELMD. Set cement retainer at 11700'` ELMD. Pun Qi tubing above 9 -5/8" packer at 11638' ELMD and from 9180' -9200' ELMD 5. F CMIT TxIA to 2500 psi 6. C Sting in to retainer and downsqueeze 23 bbls cement into the tubing and IA. Unsting and lay in 180 bbls cement up to 9180'. 7. S WOC 3 Days Tag TOC ( AOGCC 24 -hr notification to witness required) 8. F PT cement plug (Tbg and IA) to 2500 psi & chart results (AOGCC 24 -hr notification to witness required) 2 IIII • 1REE = 5-1/8' ROC 10M SAFETY NOTES: WaL REQUIRESA SS6V. FISH IN ViELLI-EA D = FNC 'Aetai.60-=—AT*1071 Current L G 1 -0 8 WaL 0 12334' SIM pow/ & BROKEN LATCH). KB. a2/ = 521 NA - K - 60 - =: .-- - - - 2406 /Au Argle = 60 @ 9900 p.m 2143 H 2-7;8' CA M-TRDP-1A TRSSSV, D =2.312' 1 Datum AC = — 12,745: LI CaturnIVD = 8100' Se CHEMICAL INJECTION MANDRELS I ST 1 MD I WD I DEVI TYPE IVLV I LATCH PORT DAM 1 1 2199 121471 0 1 KBMG-L GAS LIFT MANDRELS 13-3/8' CSG 724, L-80, D =12.34r H 4361' 1 - 1 GP I i ST MD TVD DEV TYPE V LV LATCH PORT DATE I 1 2842 2822 19 TETMPO 2 6164 5057 52 TETMPD BROKEN 3 9074 6768 50 TEJTIMPD BK-2 BK-2 4 11134 7963 51 TE(I Minimum ID = 2.312" © 2143' il TE(TWV BK-2 5 11614 8269 50 TEITIAPD FtKP 2-718" CAMCO SSSV TRDP-1A 11708' 9-5/8' X 2-7/8" BOY HS PKR, 0 = 4.000' I - ...7.7.111 OMNI , I.." 11731' 4-1/2" WFD PL LC SET (10/2606) 1 A 11753' FITOP OF BOT TIEBACK SLEEVE 1 N 1 11767' H9-518' X r BOT LNR HANGER 1 119 9-93' CSG, 470, L-60, ID = 8,681' H 11066' 1 - 4 25 D-COLLAR STCP, G-PACKOFF W/ PX-RUG '1 PU_LED ON 08/2401 PERFORATION SUMMARY FEf Loa LDTCHL ON 0527187 PRODUCTION MANDRELS ANGLE AT TOP FERF: 52 4)? 12300' IP sr l '4' ND 'XVI 'TYPE I VLV I LATCH I PORT DATE Not: Refer to Production DB for histortal perf data 1 12253 8592 52 TEMMPO 1 1 BK-2 SVE, SPF INTERVAL Opn/Sqz DATE II 4' 4 12360 - 12350 C 0908/01 2-1/8" 4 12389 - 12477 C 094)8101 III 12323' H 60' OF BOT BLAST JTS. ID = 2.441' 1 2-1/8 4 12506 - 12550 C 0908/01 4' 1 12840 - 12670 C 1126/86 Air 112334'81m H FGH. EDGLV AND BROKEN LA704(0926/88)1 4' 1 12688 - 12704 C 11126/86 V 1 12748- 12772 C 1126186 s 12364' 2-7/8 AVA BR NP, 0= 2.25'11.875' W/ SLV . I • 4' 1 12792 - 12316 C 11126/86 BP & 2 NEW. GA UGES RUN C81 112987 4' 1 4' 1 12840 - 12876 C C 1126/86 11/26/86 1 12389' H r X2-7/81307143 R(R, ) =3.750' 1 , _ 1 _ 12920 - 12430 _ 1 12403' H 2-7/8•AVA BiNG NPW/ REDLCER, 0= 1.812' 1 12-7/8 7BG-PC, 6.54, L-ao, .0058 60, D = 2.441' H 12407' 1-- 124013' 2 EG, ID =2,441' 1.4 12590e Im1 7' X2-7/8" BOT 1- B FKR D =3.750' 1 114 ,.... 12611' 2-7/8' CAW° D NP, ID= 1.813' 1 W/ CA-2 PLUG (11/2666) 2-7/8' TBC,PC, 6.54, L-80, .0058 bpf , ID = 2.441" 12623' , 1 12624' 112-7/8 BOT TTUSOS, D = 2,56' I 1 FBTD 13375' efee• WI ITLNR, 2E0, L .0371 Cpf, , 0 =6.184' H 13422' 4444 41 .14.0.4.4-4,4,1 DATE REV BY COMMENTS DATE ITV BY COAMENTS PRUCHOE BAY umn 10/23016 ORIGINAL COMPLETION WELL: LG1-08 12/3401 CHKAK CORRECTIONS PERMIT No. 186-0570 12/11003 CAORLH FULL & FESET EP API Kt: 50•29-21932-00 10/2806 EINPAG FULL BK14 ERSET WFD a 1173I 11881 FP& & 1666 Fa, Sec. 01, T11N, R14E 0301/07 RL WIN AC 02/11/11 MEIUMID ADDED SSSV SAFETY NOTE BP Exploration (Alaska) 3 , . • 0 TREE = 5-1/8 FMC 10M SAFETY NOTES: WELL REQUIRES A SSW. FISH IN 1NBIFIEAD = FMC ACTUATOR = AXIISON Proposed I_GI-08 , WELL (0) 12334' SLM (0)GLV & BROKEN LATCH). KB. ELEV = 520 NA KOP = 2400 Max Angie = 60 @ 9900 2143' H 2-718" CAM-TROP.1A TRESSV, D = 2.31T I Daturn MD = 12,745' EaruirCTV.ii:Y= -- 890 - 0 - S§ ICI CHEW-A N J ECTON MANDRELS Eli LA Lajl WA TYPE giummraba DA In LikalliiiMIKMILZMIMMIIKM11■■ GAS LFT MANDRELS 13-3/8' CSG, 72*. L-80, D = 12.347" H 4361' 1- iir ■ ST MD TV D I DEV TYPE VLV LATCH PORT DATE I'1 111 .x.:.:44.:,..,:::.;.: 1 2842 2822 19 TEITMPO EiTW BK-2 TO C - 9180 2 6164 5057 52 T O BROKEN 6788 50 TETMPD BK-2 4 11134 7963 51 TETP.00 BK-2 Minimum ID = 2.312" © 2143' 160.0.•01 1....0.0. WA, :; ■••••••• 5 1 16 14 8269 _ 50 TEMPO RKP :•::::";!*.:*:••:* 2-7/8" CAMCO SSSV TRDP &V -1A "... • •••••••• NI OA.' • 4% 1:04:411‘17"....:441: 11708' 9-5/8' X 2-7/8' BOT I- FKR D = 4 COO" I teat..---. Ilgrea WI Plini, ■nreve.to. eve.. C070°1 ■ AA. .....W.W. 117V TOP OF BOT TEBACK SLEEVE ■■•.%•••••••&t. .70,1n.:,,,:.:■:.:. 11767' H9-5/8" X T BOT LNR HANGER 1 0•11 ••• ••• •••••• •• ••••• ••••••• Pee : I 1:4 4• ',O • 0 ...jig: VG' . .p . 4 . 11925' D-COLLAR STOP, G-PAO(OFF W/ F8(-FLUG 9-5/8' GSG, 47, L-80, ID = 8.: :1" 11966' .**.....VONAI .W.V.W. ' P- FRONG RA_LED ON 08/24/01 AMOVAnte. .......m.... FERFORATAON SUIAVARY .0...........,... ................. REF LOG: LOT/O ON 05/27787 X': 'M.:* :•:*: PRODUCTION MANDRELS 4V-•-•-• 4.7,4 ANGLE AT TCP FERF: 52 @ 12300 ...... 1111 ove ST MD TV DI DEV TYPE VLV I LATCH 1 FORTI DATE %V ve Note Ref er to Production Ce for historical parr data I 1I. 4 M WO 1 12253 8592 1 52 TOTMFO I BK-2 SIZE SPF INTERVAL OpniSqz DATE ::::;I:.:•: 4' 4 12300 - 12350 C Oild08/0 1 • PA ••■ ■• 2-1/8' 4 12389 - 12477 C 0608/01 :K: 1 12323' BO' OF BOT BLAST JTS, D = 2,441' 1 2-1/8' 4 12506 • 12550 C 09/08/01 •.■ I 11, ••••• 1■ _IV. • • 12334'91 m FISH - E)GIV AND BROKEN LATCH (09/26/88)1 4' 1 12640 - 12670 C 11/26/86 •,.. Y 0...11 11• 4" 1 12688 - 12704 C 11726/86 :•■■•: :',:.: 4' 1 12748 • 12772 C 11/26/86 •:" ■ ......, ,...: ....0. 12384' 2-7/8' AVA BR. NP, D = 2.25'! 1.875' W/ SLV .4.0 1 IVO • BP& 2 MEM, GAUGES RIJN ON 11,29/87 4' 1 12792 - 1 28 16 C 11126/86 %to . V., 11.0.1 I 1.„•;41 4' 1 1284 - 1 2876 C 11/26/86 III :21 12389' H 7' X 2-718" BOT AB FKR ID = 3.750' I 4' 1 12920 - 12930 C 11/26/86 1 12403' h 2-7/8"AVA BIG NPW/ REDUCER, D= 1.812' I TBG- PC, 6.5#, L-80, .0058 bpf, D = 2.44r H 1240T 1 12401 2- ulr'lleso WLEG, D = 2.441' I 12590'e I m H r X 2-718" BOT 1-6 FKR, D .= 3 750" 1 pc. 0 1 i 2ei 1. 2-7/8' CAMCO D MP, D . 1.813" 1 W/ CA-2 PLUG (11/26/86) 2-7/8' TBG-PC, 6.5#, L-80, .0058 bpf, D = 2.441' 12623' 12624' 2-7/8' BOT TTL/SOS, ID = 2.56' 1 PBTD 13375' v 11.4 I 7 29t, L-80, .0371 bpf, D = 8.184' H 13422' .•.t.4.......t4 DATE REV BY COMMENTS DATE REV BY COOAMINTS PRUDHOE BAY MT 10/23#36 ORIGINAL COMPLETION WELL: LG1-08 12 CHKAK CORRECTIOP4S PERMIT No: 186-0570 1 12/19/03 CA0/11.+1 FULL & RESET BP AR No: 50-029-21562.00 1028/C6 CIMPAG FULL BKR IIPSET WED@ 11731' 1188' FNL & 1668 Fa, S. 01, T11t'4 RUE 03/01/07 RL DATUM MD 02/11/11 A/B/Jk13 ADDED SSSV SA FETY NOTE BP Exploration (Alaska) 4 2Q2011 Not Operable Injector R,rt Page 1 of Maunder, Thomas E (DOA) From: AK, D &C Well Integrity Coordinator [AKDCWeII1ntegrityCoordinator @bp.com] Sent: Monday, July 04, 2011 4:44 PM To: AK, D &C Well Integrity Coordinator; Maunder, Thomas E (DOA); Regg, James B (DOA); Schwartz, Guy L (DOA); Brooks, Phoebe L (DOA) Cc: AK, OPS GC1 OSM; AK, OPS FS1 OSM; AK, OPS Area Mgr North (Gas Plants GPMA); AK, OPS GC2 OSM; AK, OPS FS1 DS Ops Lead; AK, OPS FS1 Facility OTL; AK, OPS FS2 DS Ops Lead; AK, OPS FS2 Facility OTL; AK, OPS FS3 DS Ops Lead; AK, OPS FS3 Facility OTL; AK, OPS GC1 Facility OTL; AK, OPS GC1 Wellpad Lead; AK, OPS GC2 Facility OTL; AK, OPS GC2 Wellpad Lead; AK, OPS GC3 Facility & Field OTL; AK, OPS GC3 Wellpad Lead; AK, OPS GPMA Facility OTL; AK, OPS LPC DS Ops Lead; AK, OPS Ops Supt; Kurz, John; AK, OPS MPU OSM; AK, OPS MPU Field Lead Tech; AK, OPS MPU Field Ops TL; AK, OPS MPU Well Ops Coord; AK, OPS MPU Wells Ops Coord 2; AK, OPS Nstar Lead Tech; AK, OPS Nstar OIM; AK, OPS Nstar O &M TL; AK, RES END Production Optimization Engineer; Kruger, Dale 0 Subject: 2Q2011 Not Operable Injector Report Attachments: Not Operable Injector Report 2Q2011.zip Tom, Jim, Phoebe and Guy, Attached is the 2Q 2011 Injection Report for GPB, GPMA, Northstar, Milne Point and Endicott injectors classified as Not Operable. «Not Operable Injector Report 202011.zip» JUL_ 1. Zn Notes on wells: Removed from Quarterly Injection Report: 13 -09 (PTD #1811580): RWO repaired TxIA comm. On 04/30/11 END 3- 43/P -36 PT D • 1931700): Surface casing leak repaired with Brink platelets on 05/17/11 GI -08 PTD #1860570): of Operable Producer that had been mismarked in BP system as a not operable injector thereby being generated to report MPF -92 (PTD #1981930): SI waiting for AOGCC MIT -IA that passed an AOGCC MIT -IA on 04/17/11 MPF -95 (PTD #1981790): SI waiting for AOGCC MIT -IA that passed an AOGCC MIT -IA on 04/17/11 P2 -16 (PTD #1931230): RWO repaired PC leak and TxIA comm. On 04/15/11 U -10 (PTD #1851970): TxIA comm. That was repaired with a tubing patch on 06/05/2011. Moved to Monthly Injector report pending AOGCC witnessed test WGI -06 (PTD #1900300): RWO repaired TxIA comm. Well moved to Monthly Injector report pending AA cancellation Z -12 (PTD #1891020): TxIA communication repaired with cement packer on 05/24/11. Added to Quarterly Injection Report: L -223 (PTD #2090990): MIT -IA failed on 05/01/11. MPS -07 (PTD #2020720): MIT -IA failed on 04/09/11 MPS -13 (PTD #2021140): Passed MIT -IA on 04/11/11. LTSI that requires AOGCC MIT -IA when put on production. V -227 (PTD #2091160): Exhibiting rapid IA repressurization. Classified as Not Operable on 06/20/11. 7/5/2011 ! -, r---- r"\ .fI STATE OF ALASKA ALASKA OIL AND GAS CONSERVATION COMMISSION REPORT OF SUNDRY WELL OPERATIONS 1. Operations Performed: AbandonD Alter CasingD Change Approved ProgramD 2. Operator SuspendD RepairWeliD Pull TubingD Operation Shutdown D Plug Perforations I]] Perforate New Pool D 4. Current Well Class: Perforate D WaiverD Stimulate D Time ExtensionO Re-enter Suspended Well 0 5. Permit to Drill Number: 186-0570 OtherD Name: BP Exploration (Alaska), Inc. Development I]] Stratigraphic D 9. Well Name and Number: LGI-08 10. Field/Pool(s): Prudhoe Bay Field / Lisburne Oil Pool ExploratoryD ServiceD 6. API Number 50-029.21562-00-00 3. Address: P.O. Box 196612 Anchorage, Ak 99519-6612 7. KB Elevation (ft): 52.00 8. Property Designation: ADL-0034628 11. Present Well Condition Summary: Total Depth measured 13422 feet true vertical 9408.4 feet Effective Depth measured 11730 feet true vertical 8340.9 feet Plugs (measured) Junk (measured) 11730,11925,12611 12334 Casing Length Size MD TVD Burst Collapse Conductor 80 20" 91.5# H-40 37 117 37.0 - 117.0 1490 470 Liner 1669 7" 29# L-80 11753 - 13422 8354.8 . 9408.4 8160 7020 Liner 34 2-7/8" 6.5# L-80 12590 - 12624 8853.9 - 8875.2 10570 11160 Production 11931 9-5/8" 47# L-80 35 - 11966 35.0 - 8477.1 6870 4760 Surface 4325 13-3/8" 72# L-80 36 - 4361 36.0 . 3979.5 4930 2670 Perforation depth: Measured depth: All below Plugs -"",~, í".? ;,.... {' L,- " "V',!!"-" ,"'\ 'f......vr "'-". =- !i...c. ~~ ,; True vertical depth: All below Plugs Tubing ( size, grade, and measured depth): 2-7/8" 6.5# L-80 @ 33 12408 MAR 1 5 200( Packers & SSSV (type & measured depth): 2-7/8" BOT HB Packer 2-7/8" BOT I-B Packer 2-7/8" BOT I-B Packer @ 11708 @ 12389 @ 12590 "!~::kp, n,l -, r" r',., -', , ,~r .'. ,..S..t"., /"fl:,"'('II':1iOO /1 '¡rhor"n' , .. '", u~': 12. Stimulation or cement squeeze summary: Intervals treated (measured): Treatment descriptions including volumes used and final pressure: Oil.Bbl Representative Daily Averaae Production or Iniection Data Gas-Met I Water-Bbl Casing Pressure Long Term Shut-In 1740 13 Prior to well operation: Subsequent to operation: Long Term Shut-In 1750 Tubing Pressure 1300 1600 14. Attachments: 15. Well Class after proposed work: ExploratoryD DevelopmentŒ ServiceD Daily Report of Well Operations. ! 17. I hereby certify that the foregoing is true and correct to the best of my knowledge. Garry Catron 5C:4NNi=n MAR 1 62001 Printed Name Garry Catron }f~ r~ Form 10-404 Revised 12/2003 Contact 16. Well Status after proposed work: Operational Shutdown D Oil 00 GasD WAG D GINJD WINJD WMPLD Prepared by Garry Catron (907) 564-4657. SUndry Number or N/A if C.O. Exempt: N/A Title Production Technical Assistant Copies of Logs and Surveys run - Signature 0 R I C I NÄet.:64-4657 ŒOM~BFL. Date 3/11/04 WIlt) 2M ~ r"\ ~ LGI-O8 DESCRIPTION OF WORK COMPLETED NRWO OPERATIONS EVENT SUMMARY 12/09/03 DRIFT WI 2.25 CENT 3' 1 1/4" STEM 2.30 GR SD 9327' SLM PULLED BAKER 2" IBP FROM 9331' SLM DRIFTED TO 11,909 SLM. WITH 2.230" CENT. JOB IS COMPLETE 12/09/03 Remove IBP @ 12300' 12/17/03 T/I/O=1800/176010. PRESSURED UP TBG TO 3000PSI WITH 11 BBLS 60/40 METHANOL. SQUEEZED IN ANOTHER 3BBLS. BLED BACK TBG TO STARTING PRESSURE. FINAL WHP; T/I/O= 18001176010. 12/17/03 T/I/O=1820/1820/80. TEMP=SI. TBG FL @ 2691' OR 13 BBLS BETWEEN CHEM. INJECTION STA AND 1ST GASLIFT STA (FOR E- LINE). 12/19/03 Set IBP @ 11730' FLUIDS PUMPED BBLS 14 14 60/40 Methonal TOTAL Page 1 I"""' .. TREE = 5-1/8" FMC 10M W8.LHEAD = FMC ACTUATOR = AX8.S0N KB. 8..EV = 52.0' BF. 8..EV = NA KOP= 2400' Max Angle = 60 @ 9900' Datum MD = 12587' DatumTVD= 8800' SS 113-3/8" CSG, 72#. L-80, ID= 12.347" H 4361' Minimum ID = 2,312" @ 2143' 2-7/8" CAMCO SSSV TRDP-1A 19-5/8" CSG, 47#. L-80, ID = 8.681" I~ 11966' I---- PERFORATION SUMMARY REF LOG: LDT/CNL ON OS/27/87 ANGLE AT TOP PERF: 52 @ 12300' Note: Reter to Production DB for historical perf data SIZE SPF INTERV AL Opn/Sqz DATE 4" 4 12300 - 12350 C 09/08/01 2-1/8" 4 12389 - 12477 C 09/08/01 2-1/8" 4 12506 - 12550 C 09/08/01 4" 1 12640 -12670 C 11/26/86 4" 1 12688 - 12704 C 11/26/86 4" 1 12748 - 12772 C 11/26/86 4" 1 12792 - 12816 C 11/26/86 4" 1 12840-12876 C 11/26/86 4" 1 12920 - 12930 C 11/26/86 12-7/8" lEG-lPG, 6.5#, L-80. .0058 bpf, ID = 2.441" H 12407' 1 12-7/8" TBG-IPG, 6.5#. L-80, .0058 bpf, ID = 2.441" H 12623' I ¡pam H 13375' I 17"LNR, 29#, L-80, .0371 bpf, ID = 6.184" H 13422' I DATE 10/23/86 02/23/01 12/30/01 12/19/03 COMMENTS ORIGINAL COMPLETION SIS-LG FINAL CH/KAK CORRECTIONS CAO/TLH PULL & RESET IBP DATE REV BY t-- ~ 12323' I~ 60' OF BOT BLAST JTS, ID=2.441" 1 ... 12334'slm H FISH - EDGLV AND BROK8'J LATCH (09/26/88)1 ,- 1 12384' :8 :8~ I I LGI-O8 . CL - L x~~ ~ ~ I D I; - ~ REV BY ~ SAFETY NOTES: FISH IN W8.L @ 12334' SLM (EDGLV & BROKEN LATCH). 2143' H 2-7/8"CAM-TRDP-1A TRSSSV, ID=2.312" I CHEMICAL INJECTION MANDR8.S ISTI MD TVD DEVI TYÆ IVLV LATCH PORTI DATE I 1 2199 2147 0 KBMG-L BK-2 . GAS LIFT MANDR8.S ST MD TVD DEV TYÆ VLV LATCH PORT DATE 1 2842 2822 19 TElTMPD BK-2 2 6164 5057 52 TElTMPD BROK8'J 3 9074 6768 50 TElTMPD BK-2 4 11134 7963 51 TElTMPD BK-2 5 11614 8269 50 TElTMPD RKP 11708' 11730' 11753' 11767' H9-5/8" X 2-7/8" BOT HB PKR ID = 4.000" I H2-1I8" IBP(12/19/03) I I-tTOP OF BOTTIEBACK SLEEVE 1 H9-5/8" X 7" BOTLNR HANGER I ~ 11925' 11D-COLLARSTOP, G-PACKOFFW/ PX-PLUG I * P-PRONG PULLED ON 08/24/01 PRODUCTION MANDR8.S IST MD TVD DEVI TYÆ VLV LATCH PORTI DATE I 1 12253 8592 52 TElTMPD BK-2 .. 0 112-7/8" AVA BPL NP, ID = 2.25" /1.875" W/ SLV I * BIP& 2 MEM. GAUGES RUN ON 11/29/87 7" X 2-7/8" BOT I-B PKR ID = 3.750" I 2-7/8"AVA BNG NIPW/ REDUCER, ID= 1.812" I 2-7/8" BOT WLEG, ID = 2.441" I 12389' H 12403' l-t 12408' H 12590'elmH 7" X 2-7/8" BOT I-B PKR, ID = 3.750" I 1 12611' '12-7/8"CAMCODNIP,ID=1.813" I W/ CA-2 PLUG (11/26/86) 1 12624' H2-7/8" BOTTTL/SOS, ID = 2.56" 1 COMMENTS PRUDHOE BAY UNIT W8.L: LGI-08 PERMIT No: 186-0570 API No: 50-029-21562-00 1188' FNL & 1668' F8., See. 01, T11N, R14E BP Exploration (Alaska) ". -~ ARca Alaska, Inc. Lisburne/Point McIntyre Engineering Date: October 13, 1993 Subject: Transmittal #679 -LPC-02/LGI-08 From: ARCO Alaska Inc. To: Bob Crandall AOGCC 3001 Porcupine Drive Anchorage, AI< 99501 Enclosed is the following data for Lisburne Log ~Iuelin~ Well Title 3(0- 57 LGI-8 Leak Detection Log Spin-Temp-Press-Gradio CH If .,O-I'2...~'1 S 'LPC-2 Dual Propagation Resi~tjy~ty, GR -MD 4 (}3 )S ~\ ..21?11 L40?i5-79<cq 1 - LPC-2 Dual Propagation Resistivity, GR - TVD ~ J .21-5u¡ t.fo3C; - 7q~cf I R un Run Date 1 8/28/93 3-4 5/9-13/93 3-4 5/9-13/93 Company Schl umberger Baker Hughes Baker Hughes Tape w/verification. Well Title , LPC-2 BCS/DTE (OH Edit) * ?8"Dq ~3-..25 ,LPC-2 Final MDW w/Listing ~ ~ 5L{ l3-7~lDq. 5 Run Run Date Company 1 5/13/93 Schlumberger 1 5/13/93 Baker Hughes Please sign and return to Laura S. Lahrson, A T0-409 ARCO Alaska, Inc. P.O. BOX 100360 Anchorage, Alaska 99510-0360 Transmittal #679 ~£(!ll/l. .Q('~ , 'f b .~,. If /7 iJ. -~i:i/(¡Jl1)II~( '-., /~ß ..G~~A ~.~! W,/t,. . .' " 1,~.rJ;o. J 'J ~'-"!~~!9n. PLEASE SIGN ONE COpy AND RETURN Date: Subject: From: To: : " ARCO Alaska, Inc. Lisburne/Point McIntyre Engineering NOvember 17, 1993 Transmittal #681 -LPC-02/LGI-08 ARCO Alaska Inc. Bob Crandall AOC~C 3001 Porcupine Drive Anchorage, AK 99501 Enclosed are sepias for the following Lisburne logs. These sepias were erroneously omitted from Transmittal #679, sent 10/13/93. Well. Title Run Leak Detection Log ~pin-'remp-Press-Gradio 1 Dual Propagation Resistivity, GR -MD ~s", 34 Dual Propagation Resistivity, GR-TVD~6,,~ Run Date 8/28/93 5/9-13/93 5/9-13/93 Company Schlumberger Baker Hughes Baker Hughes ~ape ~d~verificat~n /~ Well [ T~itle [ \ Run Run Date Company ~P~-21 B~S/D~E(~F 1 5/13/93 Schlumberger LPt~ F'~DW ~ 1 5/13/93 B~er Hughes Please sign and return to ~~,1~ F~~. / 0 ...... La~. La~son, AT~409 ~CO Alaska, ~c. P.O. BOX 100S60 ~orage, ~aska 99510-0S60 Transmittal #681 DATE: . l?-lq-SR_ FROM: PAM LAMBERT ENCLOSED IS THE FOLLOWING DATA FOR LISBURNE: L5-15 Magnetic Tape OH LIS LGI-8 Magnetic Tape OH LIS It~7-88 Sch 5-27-86 Sch RECEIVED BY: PLEASE SIGN AND RETURN TO: PAM LAMBERT ARCO ALASKA INC, 700 G STREET ATO 477 ANCHORAGE, AK. 99510 ' CEN-t~AL FILES D&M PLANO STANI~ARD ''' TRANSMITTIAL # 597 -~' ~-' STATE OF ALASKA AL! .v,x,. OIL AND GAS CONSERVATION CO,,,,¢.. SION REPORT OF SUNDRY WELL OPERATIONS 1. Operations performed: Alter Casing [] Other [] Operation shutdown [] StimulateX~] Plugging [] Perforate [ZI Pull tubing F~ 2. Name of Operator 5. Datum elevation (DF or KB) ARCO Alaska Inc. RKB 52' Feet 3. Address 6. Unit or Property name P.O. Box 100360 Anchorage, Alaska 99510 Prudhoe Bay/Lisburne 4. Location of well at surface 1188' FNL, 1668' FEL, Sec. 1, TllN, R14E, UM At top of productive interval 1320' FNL, 1215' FEL, Sec. 31, T12N, R15E, UM At effective depth 704' FNL, 4328' FWL, Sec. 31, T12N, R15E, UM At total depth 679' FNL, 4357' FWL, Sec. 31, T12N, R15E, UM 11. Present well condition summary Total depth' measured true vertical 7. Well number f,GI-8 8. Approval number 7-853 9. APl number 50-- 029-21562 10. Pool Lisburne Oil Pool 13423' feet 9364 ' feet Effective depth: measured 11931 feet true vertical 9334 feet Casing Length Size Structural Conductor 80' 20" Surface 4322 ' 13-3/8" Intermediate Production 11931 ' 9-5/8" 1655' 7" Liner Perforation depth: measured Plugs (measured) NONS Junk (measured) NONS Cemented Measured depth True Vertical depth 1700 # ?oleset 2450 sx AS III & 600 sx Class G 1125 sx Class G 600 sx Class G 120' 4361 11966' 11767'-13422' 120 3988 8483 8362'-9363 12300'-12350', 12640'-12670', 12688'-12704', 12748'-12772' true vertical 8684'-8715' 8890'-8908' 8919'-8929' 8955'-8970' ~bing(size, grade and measured depth) " 4 ' p~.~-k?e~r~a~dI$-~,(ty~ aOnS~ r~bsiu~I o~e~ @ 12611' 5" 9-5/8" & OD Brown 11753' & 12389', Borwn Isolati¢ 5" @ 12590' SS?!- C_~_.mc._o TRDP-!A 2_3!2" @ 2143' 12. Stimulation or cement squeeze summary Intervals treated (measured) WAHOO 5 Treatment description including volumes used and final pressure 13. Representative Daily Average Production or Injection Data Cl f'l OiI-Bbl Gas-Mci Water-Bbl P--' essu re Tu Prior to well operation 600 1500 0 Subsequent to operation ~15 14. Attachments Daily Report of Well Operations 1000 5 Copies of Logs and Surveys Run E3 15. I hereby certify that the foregoing is true and correct to the best of my knowledge Form 10-404 Rev. 12-1-85 Title Technical Aide Date 12-11-87 Submit in Duplicate 11/29/87 1 1/30/87 LGI-8 WAHOO 5 STIMULATION SUMMARY OF EVENTS PULLED EQ DUMMY @ 12228'. RAN ORIFICE W/O CHECK. PULLED'BPC' COMMINGLING SLEEVE. RAN 'BIP' (BCP W/ISOLATION PLUG) W/2 TANDEM MEMORY GUAGES (FLOPETROL). SAMPLE RECORDING SET AT 2 MINUTE INTERVALS. BOMBS HUNG FROM LOCKING MECHANISM OFF BOTTOM OF BIP. PUMPED ACID DOWN 2-7/8" TUBING THROUGH ORIFICE VALVE. PUMPED TREATMENT AS FOLLOWS: 5 BBLS DIESEL W/20% MUSOL 35 BBLS 15% HCL 75 BBL DIESEL COMMINGLED WITH 300 SCF/BBL OF NITROGEN DISPLACED ACID AT A RATE OF 1 BPM AT AN AVERAGE TREATING PRESSURE OF 540 PSI. WELL ON LINE @ 1315 ON 11/30/87. STATE OF ALASKA -' · AL/ ~ OIL AND GAS CONSERVATION CO' SSION APPLICATION FOR SUNDRY APPROVALS 1. Type of Request: Abandon E] Suspend E] Operation Shutdown [] Re-enter suspended well ~ Alter casing IiJ Time extension [] Change approved program [] Plugging [] Stimulate [~ Pull tubing ~ Amend order ~ Perforate f i Other 2. Name of Operator ARCO Alaska Inc. 3. Address P.O. Box 10C26C; Anchora§e, /~ (.19510 4. Location of well at surface 1188' FNL, 166E,' FEL, Sec. 1, T11N, R14E, UM At top of productive interval 1320' FNL, 1215' FEL, Sec. 31, T12N, R15E, UM At effective depth 704.' FNL, 4328' FWL, Sec. 31, T12N, R15E, UM At total depth 679' FNL, 4357' FWL, Sec. 31, T12N; R15E. UM 11. Present well condition summary Total depth: measured 13423 feet Plugs (measured) true vertical 9364 feet 5. Datum elevation (DF or KB) I~,,B 52' 6~ Uni,t, or Pr..oper~.y p~me rucnoe I~ay/L1 sPur'nE 7. Well number LGI-8 8. Permit number 85-57 9. APl number 50-- 029-2!562 10. Pool Lisburne Oil Pool NONE feet Effective depth: measured 11931 feet Junk (measured) NONE true vertical feet 9334 Casing Length Size Cemented Measured depth True Vertical depth Structural Conductor 80' 20" 1700 # Poleset 120 120 Surface 4322' 13-3/8" 2450 sx AS III & 4361 3988 Intermediate 600 sx class G 11931' 9-5/8" 1125 sx class G 11966 8483 Production 1655' 7" 600 sx class G 11767'-13422' 8362'-9363' Liner Perforation depth: measured R ~ C E ~ VE D 12300'-12250' 12640'-12670' ]268.8'-12704' 12748'-12772' true vertical 8684.'-8715' 8890'-8908' 8919'-8929' 8955'-8970' Tubing (size, grade and measured depth) Alask3 0i! & Gas Cons. C0mmissi0r~ 2-7/8", L-80 , 12408' Tubing Tail @ 12611' Anchorage Packers and SSSV (typo and measured depth) 9-5/8" & 5" OD Brown 11753' & 12389', Brown Isolatio~ ' , 12.Attachments Description summary of proposal ~ Detailed operations program ~ [tOP sketch [] 13. Estimated date for commencing operation November 9, 1987 14. If proposal was verbally approved Name of approver Date approved 15. I her~,J~certify that the foregoing is true and correct to the best of my knowledge Signed ~(/ZJr¥-] L__,C[,~'~ t,~-__~ h~['-~ Title Te(;hnic~l Aide Commission Use Only Conditions of approval Notify commission so representative may witness [] Plug integrity Approved by Form 10-403 Rev 12-1-85 Date 1 o- 27-~.7 I Approval No.] [] BOP Test [] Location clearance '_ .-- by order of Commissioner the commission Date Submit in triplicate ATTACHMENT 1 WELL LGI-8 ARCO ALASKA INC. PROPOSES TO CONDUCT THE FOLLOWING ON LISBURNE WELL LGI-8. 1. ISOLATE WAHOO ZONE 5 2. CONDUCT PRE-STIMULATION FLOW TEST 3. ACID WASH WAHOO 5 PERFORATIONS WITH 20 BBLS OF 15% HCL. ACID WILL BE PUMPED THROUGH COILED TUBING 4. CONDUCT A POST-STIMULATION TEST OF WAHOO ZONE 5 5. COMMINGLE PRODUCTION FROM WAHOO 5 AND WAHOO 4 ALL FLOW TESTING WILL BE DONE USING THE L1 DRILLSITE FACILITIES. DATE: 10-3-88 FROM: PAM LAMBERT ENCLOSED IS THE FOLLOWING DATA FOR LISBURNE: Magneti~c Tapes L5-8 OH LIS Precna and Presnt Enviromental Corrections Sch ~ ~ ~ L4-18 Array Sonic Waveform Reel 1 of 3 to 3 of 3 Sch ~~~ OH LIS Precna and Presnt Enviromental Corrections Sch CENTRAL FILES PLANO D & M STANDARD EXXON STATE OF ALASKA TRANSMITTIAL # 570 STATE OF ALASKA --~ AL/-. ,A OIL AND GAS CONSERVATION CO, ,ISSION REPORT OF SUNDRY WELL OPERATIONS 1. Operations performed: Operation shutdown [] StimulateXl] Plugging [] Perforate [] Pull tubing Alter Casing [] Other [] 2. Name of Operator 5. Datum elevation (DF or KB) ARCO ALASKA INC. RKB 52 Feet 3. Address 6., Unit or Pr. oper, t,v .name P.O. Box 100360 ANCHORAGE, ALASKA 99510 ~'ruartoe t~ay/r.lsburne 4. Location of well at surface 1188' FNL, 1660' FEL, Sec. 1, TllN, R14E, UM At top of productive interval 1320' FNL, 1215' FEL, Sec. 31, T12N, R15E, UM At effective depth 704' FNL, 4328' FWL, Sec. 31, T12N, R15E, UM At total depth ' 679' FNL, 4357' FWL, Sec. 31, T12N, R15E, UM 7. Well number 1,GT-R 8. Approval number 7-234 9. APl number 50-829-21562 10. Pool Lisburne Oil Pool 11. Present well condition summary Total depth: measured true vertical 13423 ' feet 9364 ' feet Plugs (measured) NONE Effective depth: measured 11931 ' feet true vertical 9334 ' feet Junk (measured) NONE 12. 13. Casing Length Size Structural 80 ' 20" Conductor 4322' 13-3/8" Surface Intermediate 11931 ' 9-5/8" Production Liner 1655' 7" Cemented Measured depth 1700# POLESET 120' 2450 sx AS III & 600 sx class G 1125 sx class G 600 sx class 4361' 11966' ~ue Verticaldepth 120' 11767-13422' Perforation depth: measured 12640'-12670', 12688'--12704, 12748'~12772' 12300'-12350'' true vertical 8664'-8715', 8890'-8908', 8919'-8929', 8955'~8970' ~bing(size, grade and measured depth) 2-7/8", L80, 12408' MD, 12611' (Tubing Tail) Packers and iSSV(type and measured depth)Packers: Brown Isolation, 5" OD @ 12590' SSSV: Camco TRDP-1A, 2.312 @ 2143MD Stimulation orcementsqueeze summary Intervals treated (measured) Wahoo 4 Treatment description including volumes used and final pressure Prior to well operation 3988' 8483' 8362-9363' 9~5/8" & 5" OD Brown 11753 & 12389' RECEIVE1) SEP o 8 ,,..~,~ n;~ ~, G~s Cons. Commissiol Representative Daily Average Production or Injection Data ~,o,~ ........ A. chorage OiI-Bbl Gas-Mcf Water-Bbl Casing Pressure Tubing Pressure 434 627 13 300 471 Subsequent to operation 449 552 1.3 300 433 14. Attachments Daily Report of Well Operations Copies of Logs and Surveys Run Iq 15. I hereby certify that the foregoing is true and correct to the best of my knowledge Signed~ Form .+OiY'04 Rev. 12-1-85 Title Senior Engineer Date 9-4-87 Submit in Duplicate~ ATTACHMENT 4 LGI-8 WAHOO 4 RESTIMULAT!ON SEQUENCE OF EVENTS Perforations: 12,389 - 12,477' MD 12,506 - 12,550' MD DATE TIME ,, , 05/01/87 05/02/87 05/03/87 1230 05/05/87 --- 05/06/87 0700 0735 1020 1100 1105 1108 1111 1122 EVENT Isolated Wahoo 5 in preparation for Wahoo 4 stimulation. Pumped 50 bbls hot oil down well prior to slickline work. Isolated Wahoo 4 test. Zone tested at initial rates of 1278 BOPD, 39 BW, and 1486 MSCFG. Rate declined to ±500 BFPD within 24 hours. Ran pre-stimulation GR/Temp/Spinner/HP logs. Pumped 50 bbls hot diesel down tubing and 20 bbls down flowline. Minimal response. Rig up BJ to wing valve to pump W-4 acid treatment down 2 7/8" tubing· Rig up Camco to run post-stimulation GR/Temp logs. Pressure test Camco BOPs to 4000 psi. Pressure test BJ to 5000 psi. Repair suction hose leak. Retest. Held safety meeting. Pump 11 bbls diesel pre-flush. Start injecting 15% gelled HCL. Shutdown. Blender discharge hose leaking. 16 bbls of acid pumped. Flush hose and replace. R~[EIVED Restart injection· Injected additiona_~l~~ bbls (28 total) of 15% gelled HCL witM~~ !~ RA tracer at average rate of 6 BPM and 5Q0 psi injection pressure NaskaOil&~asCons. C°mmi~[~ · 'Anchorage DATE TIME 05/06/87 1124 1129 1142 05/06/87 1150 05/07/87 05/07/87 1226 1348 1900 0130 EVENT Started first Unibead* diverter stage. Injected 35 bbls of 15% gelled HCL w/1000 # diverter at an average rate of 8 BPM and 2000 psi. Cut Unibead diverter and injected an addi- tional 50 bbls of 15% gelled HCL with RA tracer followed by 50 bbls of 2% KCL spacer. Average injection rate was 7 BPM. Injection pressure increased from 1470 to 1720 psi during KCL stage with first Unibead stage at perfs. Started second Unibead diverter stage. Injected 49 bbls of 15% gelled HCL with 2000 $ diverter at an average rate of 6 BPM @ 1000 psi. Cut Unibeads and pumped additional 40 bbls of gelled 15% HCL followed by 180 bbls of slicked diesel. Average injection rate of 6 BPM @ 1000 psi. Shutdown. Monitor WHP (0 psi). Well on vacuum. TOTAL LOAD: 443 BBLS Ran post-stimulation GR/CCL/TEMP logs. Open well to tank. Slight blow. Well started flowing. Post-stimulation test. 395 BOPD, 12 BWPD, and 415 MMSFGPD. * OS-90 Unibeads; 1/2 buttons (3/8" dia.) and 1/2 wide range material. INC. 6-4-87 Date: From: Para Lambert Enclosed are the following:~ CH Finals for Lisburne Wells L2-26 Flopetrol Production Logging 3-11-87 Run 1 5" Sch L3-19 Temp Fluid Density Flowmeter Log 5-7-87 Run 1 5" Camco L3-30 Collar Perforating Log 4-30-87 Run 1 5"_ ~-.GO L5-28 GCT Directional Survey 5-6-87 RUn 1 5" Sch~~,~ L5-28 CBT (CBT) 5-6-87 Run 1 5" Sch GR Log 5-3-87 Run 1 5" Camco -~~-- LGI-8 Flowmeter Temperature LGI-8 Post Acid Stimulation Temp GR Log 5-6-87 Run 1 5" Camco L2-30 Temp Injection Profile 5-17-87 Run 1 5" Sch / 5-26-87 Run 2 5" Sch L5-8 CBL(CBT) after s~ueeze L3-18 Packer Record 5-24-87 Run 1 Sch L2-26 Temp GR Log 5-20-87 Run 1 5" Camco '× Receivel'~'\~ " '~ ~-~i~z~6/' V Please ~~~~C~'i~,~ ~'L ~i~bert~ Anchorage, AK. 99510 EXXON STANDARD FILE ROOM CENTRAL FILES TRANSMITTAL # 243 ARCO Alaska, Inc. Post Office E~,..^ 100360 Anchorage, Alaska 99510 Telephone 907 276 1215 APRIL 3, 1987 Mr. L. C. Smith - Commissioner Alaska Oil and Gas Conservation Commission 3001 Porcupine Drive Anchorage, Alaska 99501-3192 Dear Mr. Smith Attached is the Application for Sundry Approvals for the program which ARCO Alaska, Inc. proposes to conduct on Lisburne well LGI-8. B. T. Kawakami Lisburne Operations Coordinator ARCO Alaska, inc. is a Subsidiary of AtlanticRichfieldCompany ALASKA OIL AND GAS CONSERVATION COMMLSSlON APPLICA' ON FOR SUNDRY Al: 'ROVALS 1. 'lype of Request: Abandon r~ Suspend ~ Operation Shutdown ~ Re-enter suspended well -- Alter casing ~ Time extension ~ Change approved program [3 Plugging [3 Stimulate ~ Pull tubing [] Amend order ~ Perforate [] Other ~2. Name of Operator ARCO ALASKA, INC. 3. Add'ress ' P. O.B. 100360, ANCHORAGE, AK. 99510 4. Location of Well at surface 1188' FNL, 1668' FEL, Sec. 1, TllN, R14E, UM At top of productive interval 1320' FNL, 1215' FEL. Sec. 31, TI2N, R15E, UM(app) At effective depth 704' FNL, 4328' FWL, Sec. 31, T12N, RIDE, UM(app). At total depth 679' FNL, 4357' FWL, Sec. 31, T12N, RI5E, UM(app) 5. Datum elevation (DF or KB) RKB 52 feet 7. Well number LG I - 8 8. Permit number 86-57 9. APl number 50-- 029-21562 lO. Pool 'LISBURNE OIL POOL 11. Present well condition summa.ry Total depth: measured 1'34~_~' true vertical 9364 ' feet Plugs (measured) feet NONE Effective depth: measured 11931 ' feet true vertical9334 ' feet Junk (measured) NONE Casing Length Size Structural Conductor 80 ' 20" Surface 4322' 13-3/8" Intermediate 11931 ' 9-5/8" Production 1655 ' 7" Liner Perforation depth: measured Cemented Measured depth True Vertical depth 1700# POLESET 2450 sx AS III 600 sx class G 1125 sx class G 600 sx class G 120' 120' & 4361' 3988' 11966' 8483' 11767-13422' 8362-9363' 12300'-12350', 12640'-12670',12688'-12704', 12748'-12772!':' ~' 86t~u~'v-e~[15, 8890'-8908', 8919'-8929', 8955'-8970' ~bing(size. gradeand measureddepth) 2-7/8", L80, 12408' MD, 12611' (TUBING TAIL) PackersandSSSV(typeand measureddepth)PACKERS: 9-5/8" & 5" OD Brown 11753 & Brown isolation, 5" OD @ 12590' SSSV: Camco "TRDP-1A", 2.312" ID, 12389' @ 2143' 12.Attachments Description summary of propos'~a~j~ Detailed operations program [] BOP sketch 13 13. Estimated date for commencing operation APRIL 15, 1987 14. If proposal was verbally approved Name of approver Date approved 15. I hereby certify that the foreg.ging is true andcprrect to the best of my knowledge ~r-~ Lisburne Op. Co°rd. Signed Title Date 4/3/87 Conditions of approval Approved by Commission Use Only Notify commission so representative may witness ! Approval No. ~ Plug integrity 'E3 BOP Test [] Location clearanceI ......' ........ by order of C'. ~!~ Commissioner the commission Form 10-403 Rev 12-1-85 Submit in triplicate ATTACHMENT i WELL LGI-8 ARCO Alaska, Inc. proposed to conduct the following on Li~burne well number LGI-8: Isolate Wahoo zone 2. Conduct pre-stimulation flow test and flowing temperature log on Wahoo zone 4. 3~ Acidize Wahoo 4 with 160 barrels of 15% HC1 with 1000 pound of unibeads. Acid will be pumped through tubing in two radioactive traced stages. 4. Run a post-stimulation GR/temperatuure decay log on Wahoo 4o 5. Cond~ct a post-stimulation test of Wahoo zone 4. 6. Isolate Wahoo zone 5. 7. Conduct pre-stimulation flow test on Wahoo zone 5. 8. Acidize Wahoo zone 5 with 100 barrels of 15% HC1. Acid will be pumped through tubing and tagged with iow level radioactive tracer. 9. Run a post-stimulation GR/temperatuure log on Wahoo 5. 10. Conduct a post-stimulation test of Wahoo zone 5. Ail flow testing will be done using the L1 drillsite facilities. ARCO AI.~I(A INC. LISBURNE ENGINEERING Date: 2-9-87 From: Pam Lambert Enclosed are the following: OH Finals for Lisburne Wells '"' L1-2 Mudlog 9-2-85 NL Baroid '~Ll-14 Mudlog 7-13-85 Westlog -"~=--L2-3 Mudlog 11-4-85 NL Baroid ~ L2-21 Mudlog 11-26-85 NL Baroid ~L2-25 Mudlog 1-30-86 NL Baroid ~L2-33 Mudlog 2-28-86 NL Baroid ~- L3-2 Mudlog 9-9-86 Westlog ~L3-5 Mudlog 9-18-85 Westlog ~ L3-11 Mudlog 10-25-85 Westlog ~ L3-22 Mudlog 11-18-86 Westlog ~ L3-19 Mudlog 12-19-85 Westlog ~ L3-30 Mudlog 12-31-86 Westlog '-- L5-4 Mudlog 1-20-87 Westlog '""~-LGI-2 Mudlog 8-7-86 Westlog LGI-6 Mudlog 6-20-86 Westlog ~LGI-8 Mudlog 5-19-86 Westlog ~--- LO~%i~l~: 7-19-86 Westlog Please sign and return to~Pam Lambert ARCO AK INC. 700 G Street ATO 477 Anchorage, AK. 99510 D&M STATE FILE ROOM 167 TRANSMITTAL # EXXON STANDARD CENTRAL FILES A~CO AI,ASI~ ~N¢. LISBURNE ENGINEERING Date: 2-5-87 From: Pam Lambert Enclosed are the following: CH Final for LGI-8 Flopetrol Pressure Survey 1-24-87 Run 1 5" Sch Bottomhole Pressure Survey for LGI-8 is also enclosed 12-7-86 to 1-24-87 Sch Received by: ~/ '-'~ r_ ~ 1~-~ ],98~,,,~''~ ~ Please s~gn ~return to. P~~rt ~CO ~ INC. 700 G Street ATO 477 Anchorage, ~. 9951 D & M EXXON STATE STANDARD FILE ROOM CENTRAL FILES TRANSMITTAL # 163 A~CO AI, ASI~ INC. LISBURN~ ENGII~EI~IN(~ Date: 1-29-87 From: Pam Lambert Enclosed are the following: CH Finals for Lisburne Wells L3-2 Production Log 12-25-86 Run 1 5" Sch L3-2 Production Log 12-27-86 Run 2 5" Sch Log 12-29-86 Run 1 5" Sch L5-24 Production LGI-6 CCL/Tie-in-log 12-7-86 Run 1 5" LGI-8 Gamma Ray/CCL 11-16-86 Run 1 5" LGI-12 Cased Hole CNL 4-25-86 Run 3 5" LGI-12 CET 4-25-86 Run 3 5" Sc~ LGI-8 Perforation Record 11-16-86 Run 1 5" Sch Camco .0 ~ Alaska Oil & Gas Cons. Commission Please sign and return z pam_L~ert Anchorage '-ARC~AK INC. 700 G Street ATO 477 Anchorage, AK. 99510 EXXON STAN FILE ROOM CENTRAL FILES TRANSMITTAL # I53 ARCO ALASI~ INC. LISBURNE ENGINEgRING Date: 1-29-87 From: PamLambert Enclosed are the following: CH Finals for Lisburne Wells L3-2 Production Log 12-25-86 Run 1 5" Sch ~ L3-2 Production Log 12-27-86 Run 2 5" Sch ~'~ L5-24 Production Log 12-29-86 Run 1 5" Sch ~~ LGI-6 CCL/Tie-in-log. 12-7-86 Run 1 5" Camco ~o~[~ LGI-8 Gamma Ray/CCL 11-16-86 Run 1 5" Sch~~ LGI-12 Cased Hole CNL 4-25-86 Run 3 5" Sch~ CET 4-25-86 Run 3 5" Sc~ LGI-12 LGI-8 Perforation Record 11-16-86 Run I 5" Sch Received by: ~/ ~/ Alaska Oil & Gas Cons. Commission Please sign and return ~,~ para_ L~er t Anchora.qe ~ARC-Cr AK INC. 700 G Street ATO 477 Anchorage, AK. 99510 EXXON STAN Am FILE ROOM CENTRAL FILES TRANSMITTAL # 153 ARCO ALASKA INC. LISBURNE ENGINEERING Date:l-30-87 From: Pam Lamber t Enclosed are the following: CH Finals for Lisburne Wells ~-~ --~ ~iW Completion Record Run 1 5" Sch 5-15-86 PWDW ~ (CBT) 5-15-86 Run 1 5" Sch -i._ L3-18 Acoustic CBL 11-11-86 Run 1 5" DA -----LGI-8 CBL 6-3-86 Run 2 5" SCH --" L3-12 Collar Log 12-19-86 Run i 5" DA Received by: ~ Alaska 0il & Gas Cons. Commission ?lease s~gn and retur err ~~CO ~ INC. 700 G Street ATO 477 Anchorage, ~. 99510 D&M EXXON STANDARD FILE ROOM CENTRAL FILES 157 TRANSMITTAL # .... STATE OF ALASKA ~. ALASi OIL AND GAS CONSERVATION COMI SION REPORT OF SUNDRY WELL OPERATIONS 1. Operations performed: Operation shutdown [] Stimulate~ Plugging Alter Casing [] OtherX~ 2. Name of Operator ARCO ALASKA, INC. 3. Address P.O.B. 100360, ANCHORAGE, AK. 99510 Perforate X' Pull tubing 5. Datum elevation (DF or KB) RKB 5 2 Feet 6. Unit or Property name Prudhoe Bay/Lisburne 4. Location of well at surface ~ ' L , 1188 FNL, 1668 .FE At top of productive interval 1320' FNL, 1215' FEL. At effective depth 704' FNL, 4328' FWL, At total depth 679' FNL, 4357' FWL, 11. Present well condition summary Total depth: measured true vertical Sec. 1, TllN, R14E, UM Sec. 31, T12N, R15E,UM(app) Sec. 31, T12N, R15E, UM(app sec, 31, T12N? R15E,UM(appl 13423' feet Plugs(measured) 9364' feet 7. Well number LGI-8 8. Approval number543 9. APl number 029-21562 50-- '10. Pool LISBURNE OTL POOl'. NONE Effective depth: Casing Structural Conductor Surface Intermediate Production Liner Perforation depth: 12300'-12350' 8684'-8715', measured 1 19 31 ' feet Junk (measured) NONE true vertical 9 3 3 4 ' feet Length Size Cemented Measured depth True Vertical depth 80' 20" 1700~ POLESET 120' 120' 4322' 13-3/8" 2450 sx AS III & 4361' 3988' 600 sx class G 11931' 9-5/8" 1125 sx class G 11966' 8483' 1655' 7" 600 sx class G 11767-13422' 8362-9363' measurea 12390'-12550', 12640'-12670',12688'-12704', 12748'-12772' truevertical 8739'-8836', 8890'-8908', 8919'-8929', 8955'-8970' Tubing (size, grade and measured depth) 2 -7/8", L80, 12408' MD, 12611' (TUBING TAIL) Packers: 9-5/8" & 5" OD Brown 11753' B r a S t e and5rr~a~ed~def~ ~¥~5e~ r~id~oSIS~l~¥~n, 90' SSSV: Camco "TRDP-1A", 2. 312" ID, & 1236 @ 2142 12. Stimulation or cement squeeze summary Intervals treated (measured) SEE ATTACHED SUMMARY Treatment description including volumes used and final pressure 13. Prior to welt operation Subsequent to operation Representative Daily Average Production or Injection Data OiI-Bbl Gas-Mcf Water-Bbl Casing Pressure N/A Tubing Pressure 2500 4000 0 O- 700 14. Attachments Daily Report of Well Operations ~, Copies of Logs and Surveys Run ~-~ 15. I hereby certify that the foregoing.~is true and correct to the best of my knowledge ~/~--~,~l--~'~ Signed ~. 7~. ~/f', ,4 ~'~,,9 K,4 ,~Z Title Date , Form 10-404 Rev. 12-1-85 Submit in Duplicate Sequence of Events LGI-8 I. Wahoo Zones 1, 2, & 3 Perforations: 12,640 - 12,670' 12 688 - 12 704' 12,748 - 12,772' 12 792 - 12 816 12,840 - 12,876', 12,920 - 12,930' 11/09/86 17:00 hrs. Rig up Halliburton for perforation break~own treatment. lines to 4000 psi - OK. Pressure test 17:30 hrs. Pump 10 bbl diesel w/10% Musol "A" - preflush 17:38 hrs. Start injection 15% HCL. Avg Rate = 2 BPM @ 2800 psi. No pressure breaks seen. Total acid volume = 143 bbls. Displace acid w/70 bbl. Diesel acid nitrified w/500 SCF/bbl/N2 (see attached treatment summary for detailed report). Total load = 233 bbls. Open well to tank. Well produced 70 bbls of diesel. Decision to N2 lift well aborted due to poor porosity development in Wahoo Zones 1, 2, & 3. SI well. II. Wahoo Zone 4 Perforations: 12,390 - 12,478', 12,506 - 12,550' (132') Note: Initial stimulation of Zone 4 was pumped with Wahoo Zones 1, 2, & 3 open. The low perm. seen in the lower zones would be a "natural" plug. The 40' of rathole between Wahoo Zone 4 perfs and the top of the isolation packer was of concern. 11/17/86 08:45 Rig up Halliburton. Pressure test hard lines to 4000 psi - OK. diesel pre-flush (10 bbl diesel w/10% Musol "A"). Start 08:58 Start injecting 15% acid. Pump 40 bbl @ 4 BPM @ 2700 psi. Start rock salt diverter @ reduced rate of .75 BPM @ 1700 psi. Pump total of 50 bbls acid w/1 ppg salt. 09:39 Switch to straight acid. Pump 41 bbls @ 4.75 BPM @ 2100 psi. 09:49 Switch to diesel flush. Pump 75 bbls ~ 4.75 BPM @ 2600 psi. SI well. Total load = 85 bbl diesel; 131 bbl acid. LGI-8 Sequence of Events (contd) 11/17/86 Open well to flow; 16:00 hrs. Well produced for 8 hrs. Recovered 497 bbl. Last Rate = 46.3 bbl oil/hr. = 1111BOPD; WHP 600, BS & W = 4%; Gas Rate = 1700 MCFD SI well 11/19/86 Open well 00:00 hrs. 11/19/86. Flow well'16 hrs. Final Rate = 518 BOPD, WHP 270; Gas rate 735 MCFD. Set plug in BTM isolation packer. 11/29/86 Rig up CTU to stimulate (Halliburton) Wahoo 4 perforations. 10:58 to 13:33 hrs. Pump 10 bbl diesel w/10% Musol "A." Pump 131 bbls 15% w/coil tubes running across perforated interval. Avg. rate 2 BPM - coil tubes. 2 7/8" TBG annulus, press. = 700 psi initial; 1231 psi final. SI well 12:45 hrs. Open well to tanks. After flowing 9 hrs. Rate = 1728 BOPD; WHP = 530 psi. Wahoo Zone 5 12/03/86 13:30 hrs. Pre-stimulation flow test Wahoo Zone 5. avg. rate. 1756 BOPD; WHP 400 psi. Well produced 1 1/2 hrs. at 16:14 hrs. Rig up Halliburton. Pump HCL acid breakdown in Wahoo Zone 5. Pressure test lines to 4200 psi - OK. Pump 10 bbl diesel w/10% Musol "A." Pump 50 bbl* 15% HCL, avg. rate 7 BPM @ 2800 psi. ISIP 1050; 5 minutes 610; @ start of flowback WHP = 450 psi. * After pumping 3 bbl, acid pressure built to 3200 psi with no drop after SI pumps. SSSV appeared to be open. Pressure up TBG to 3500#. Pressure broke to 1100 psi. Resume acid treatment. (BCP may have not been seated properly). Open well to flow: well flowing at average rate of 1000 BOPD, 2400 GOR, 780 psi. STATE OF ALASKA ALASKA L~IL AND GAS CONSERVATION CO,v~'MISSION WELL COMPLETION OR RECOMPLETION REPORT AND LOG 1. Status of Well Classification of Service Well OIL~ GAS [] SUSPENDED [] ABANDONED [] SERVICE [] 2. Name of Operator 7. Permit Number ARCO Alaska, Inc. 86-57 3. Address 8. APl Number P. 0. Box 100360, Anchorage, AK 99510-0360 50- 029-21562 4. Location of well at surface 9. Unit or Lease Name 1188' FNL, 1668' FEL, Sec. 1, T11N, R14E, UM Prudhoe Bay Unit/Lisburne At Top Producing Interval 10. Well Number 1412' FNL, 3576' FWL, Sec. 31, T12N, R15E, UM LGI-8 At Total Depth 11. Field and Pool 773' FNL, 4390' FWL, Sec. 31, T12N, R15E, UM Prudhoe Bay Field 5. Elevation in feet (indicate KB, DF, etc.)16.Lease Designation and Serial No. Li sburne 0i 1 Pool 52' RKBI ADL 34628 ALK 863 12. Date Spudded 13. Date T.D. Reached 14. Date Comp., Susp. or Aband. 115. Water Depth, if offshore 116. No. of Completions 05/03/86 05/24/86 06/01/86'I N/A feet MSLI 1 17. TotalDepth(MD+TVD) 18.PlugBackDepth(MD+TVD) 19. DirectionalSurvey [ 20. Depth where SSSV set 121. Thickness of Permafrost 13423'MD,9406'TVD 13375'MD,9372'TVD YESX~ NO [] 2143 feet MD 1900' (Approx) _ 22. Type Electric or Other Logs Run DLL/MLL/SL/GR, FDC/CNL/GR/CAL/Acou sti 1 o9 ,Acousti 1 o§/GR, GR/PCM/D I L ~ DLL/SDT/NGT .LDT/EPT/CNL/GR/CAL;LSS/GR/WF .RFT .CE 23. GCT,CBT/VDL/GR/CCL CASING, LINER AND CEMENTING RECORD SETTING DEPTH MD CASING SIZE WT. PER FT. GRADE TOP BOTTOM HOLE SIZE CEMENTING RECORD AMOUNT PULLED 20" 91.5# H-40 Surf 120' 30" 1700# 13-3/8" 68.0/72.0# K-55/L-80 Surf 4361' 17-1/2" ?b,~O .~x A.g I11 ~, ~nn ~ ¢~a~s ¢ 9-5/8" 47.0# L-80 Surf 11966' 12-1/4" 112~ sx Cla.~.~ c, ~, ~oo .~ £.g I 7" 29.0# L-80 11767' 13422' 8-1/2" 600 sx Class G 24. Perforations open to Production (MD+TVD of Top and Bottom and 25. TUBING RECORD interval, size and number) SIZE DEPTH SET (MD) PACKER SET (MD) 12300' - 12350'MD 8065' - 8097'TVD w/4 spf 2-7/8" l?F;?b,' 117nR' =l'~'~Rq' ..... ,i'~Kon'(~l,-- 12640' - 12670'MD 888:3' - 8901'TVD w/1 spf 12688' - 12704'MD 8913' - 8923'TVD w/1 spf 26. ACID, FRACTURE, CEMENTSOUEEZE, ETC. 12748' - 12772'MD 8951' - 8966'TVD w/1 spf DEPTH INTERVAL (MD) AMOUNT& KINDOF MATERIAL USED 12792' - 12816'MD 8979' - 8994'TVD w/1 spf N/A 12840' - 12876'MD 9010' - 9033'TVD w/1 spf 12920' - 12930'MD 9062' - 9069'TVD w/1 spf 27. N/A PRODUCTION TEST Date First Production I Method of Operation (Flowing, gas lift, etc.) I Date of Test Hours Tested PRODUCTION FOR OIL-BBL GAS-MCF WATER-BBL CHOKE SIZE IGAS'OILRATIO TEST PERIOD ~ I , Flow Tubing Casing Pressure CALCULATED OIL-BBL GAS-MCF WATER-BBL OIL GRAVITY-APl ('~r'r) Press. 24-HOUR RATE ~ 281 CORE DATA Brief description of lithology, porosity, fractures, apparent dips and presence of oil, gas or water. Submit core chips. I~'~ None i:,,~ ~ ~,l i!'~ ~ ? *Note: Perforated well & ran t~h~n9 r~ Form 10-407 Rev. 7-1-80 CONTINUED ON REVERSE SIDE DAM/WC1:154 Submit in duplicate ~ ~ 3O. 29. ,, GEOLOGIC MARKERS . FORMATION TESTS -- NAME Include interval tested, pressure data, all fluids recovered and gravity, MEAS. DEPTH TRUE VERT. DEPTH GOR, and time of each phase. Top Wahoo Zone 7 Truncated Depth H),dro Press Form. Press Top Wahoo Zone 6 12074' 8536' 12430' 4428.9 psi 4092.1 psi Top Wahoo Zone 5 12216' 8622' 12328' 4396.1 psi 4068.5 psi Top Wahoo Zone 4 12362' 8711' 12259' 4374.1 psi 4126.8 psi Top Wahoo Zone 3 12634' 8879' 12259' 4375.2 psi 4026.5 psi Top Wahoo Zone 2 12730' 8939' 12252' 4369.2 psi 4028.7 psi Top Wahoo Zone 1 12792' 8979' 12219.5' 4374.2 psi 4081.3 psi 12219' 4363.9 psi 4039 psi 12218.5' 345 psi 450.8 psi 12183.3 4353.1 psi 4202 psi 31. LIST OF ATTACHMENTS Addendum (dated 11/15/86) "32. I hereby certify that the foregoing is true and correct to the best of my knowledge INSTRUCTIONS General: This form is designed for submitting a complete and correct well completion report and log on all types of lands and leases in Alaska. Item 1: Classification of Service Wells: Gas injection, water injection, steam injection, air injection, salt water disposal, water supply for injection, observation, injection for in-situ combustion. Item 5: Indicate which elevation is used as reference (where not otherwise shown) for depth measurements given in other spaces on this form and in any attachments. Item 16 and 24: If this well is completed for separate production from more than one interval (multiple completion), so state in item 16, and in item 24 show the producing intervals for only the interval reported in item 27. Submit a separate form for each additional interval to be separately produced, showing the data pertinent to such interval. Item 21: Indicate whether from ground level (GL) or other elevation (DF, KB, etc.). Item 23: Attached supplemental records for this welI should show the details of any multiple stage cement- ing and the location of the cementing tool. Item 27: Method of Operation: Flowing, Gas Lift, Rod Pump, Hydraulic Pump, Submersible, Water In- jection, Gas Injection, Shut-in, Other-explain. Item 28: If no cores taken, indicate "none". Form 10-407 ADDENDUM WELL: 6/04/86 11/01/86 LGI-8 Rn CBT/VDL/GR/CCL f/13,357'-11,100' w/1000 psi. Rn gyro f/surf-13,302'. Equalize SSSV. TIH w/kickover tl, latch orifice vlv @ 11,600' SLM, POOH. RIH w/dummy vlv, set in GLM. Press up on ann to 2500 psi. I TELECO] May 19, 1986 Teleco Oilfield S""-"~es of Alaska Inc. 6116 Nielson Wa Anchorage, AK 99502 (907) 562-2646 JOB # 497TAK ARCO WELL: LGI-8 PRUDHOE BAY ROWAN #41 Please find attached a copy of the computer calculated MWD directional surveys for the above mentioned well. We at Teleco appreciate this opportunity to provide service to ARCO. Teleco is committed to providing the highest quality of service and we would welcome any comments or questions concerning these surveys or any of our other services. Sincerely, Pat Havard Field Service Supervisor PH/el Enclosures A ~lrr~l~'l' COMPANY TELECO OILFIELD SERVICES JOB 497 SURVEY CALCULATIONS Date Page 05-03-86 Company: ARCO Well: LGI- 8 Location: PRUDHOE BAY Rig: ROWAN 41 TELECO Job # 497 TAK Grid Correction: Magnetic Declination: Total Correction: Proposed Direction: 0.00 degrees 31.30 degrees 31.30 degrees 45.93 degrees RADIUS OF CURVATURE CALCULATION **************************************** MEAS '. DIRECTION TRUE VERTICAL COORDINATES CLOSURE DOG LEG DEPTH INCL AZIMUTH BEARING VERT DEPTH SECTION N/S E/W DIST ANGLE SEVERITY feet deg deg deg/min feet feet feet feet feet deg deg/100' TIE-IN 2100.00 0.0 44.0 N 44 00 E 2100.00 0.00 0.00N 0.00E 0.00 N 90.000E 0.000 TELECO MWD 2557.00 13.9 44.7 N 44 42 E 2551.09 66.61 46.18N 48.00E 66.61 N 46.106E 2.142 2712.00 17.7 46.1 N 46 06 E 2700.21 108.80 75.81N 78.04E 108.80 N 45.832E 2.464 2927.00 22.8 48.5 N 48 30 E 2901.85 183.16 126.25N 132.71E 183.17 N 46.428E 2.403 2403.00 10.7 48.5 N 48 30 E 2400.64 33.81 23.64N 24.17E 33.81 N 45.627E 2.190 2249.00 7.4 44.0 N 44 00 E 2248.58 9.60 6.90N 6.68E 9.60 N 44.057E 4.966 TELECO Job # 497 TAK 05-03-86 Page 2 MEAS DIRECTION TRUE VERTICAL COORDINATES CLOSURE DOG LEG DEPTH INCL AZIMUTH BEARING VERT DEPTH SECTION N/S E/W DIST ANGLE SEVERITY feet deg deg deg/min feet feet feet feet feet deg deg/100' 3071.00 25.5 47.5 N 47 30 E 3033.23 242.03 165.67N 176.48E 242.06 N 46.811E 1.896 3233.00 28.4 40.4 N 40 24 E 3177.63 315.35 218.49N 227.40E 315.36 N 46.145E 2.671 3450.00 33.0 37.6 N 37 36 E 3364.16 425.29 304.55N 297.10E 425.47 N 44.290E 2.219 3603.00 37.0 38.7 N 38 42 E 3489.47 512.22 373.55N 351.30E 512.79 N 43.241E 2.647 3754.00 41.9 39.7 N 39 42 E 3606.03 607.48 447.88N 411.92E 608.50 N 42.605E 3.272 3907.00 47.7 40.8 N 40 48 E 3714.55 714.71 530.13N 481.54E 716.19 N 42.251E 3.824 4062.00 53.6 41.1 N 41 06 E 3812.79 834.06 620.61N 560.07E 835.97 N 42.064E 3.809 4325.00 54.8 40.1 N 40 06 E 3966.63 1046.45 782.57N 4577.00 53.8 41.1 N 41 06 E 4113.68 1250.20 937.95N 698.88E 1049.21 832.05E 1253.82 N 41.767E 0. 551 N 41.576E 0.511 6360.00 53.2 44.7 N 44 42 E 5179.32 2677.64 1981.98N 1808.09E 2682.81 N 42.373E 0.279 6728.00 53.7 46.1 N 46 06 E 5398.47 2973.25 2189.55N 2018.58E 2978.06 N 42.673E 0.334 7097.00 54.9 47.8 N 47 48 E 5613.79 3272.84 2394.10N 2237.55E 3276.94 N 43.064E 0.496 7464.00 56.0 49.0 N 49 00 E 5821.92 3574.83 2594.78N 2463.58E 3578.00 N 43.514E 0.403 5958.00 52.5 43.6 N 43 36 E 4936.55 2357.38 1752.08N 1584.91E 2362.57 N 42.132E 0.127 5713.00 52.3 43.3 N 43 18 E 4787.06 2163.46 1611.16N 1451.42E 2168.52 N 42.014E 0.349 5439.00 53.2 42.9 N 42 54 E 4621.21 1945.62 1451.91N 1302.40E 1950.46 N 41.893E 0.244 4947.00 54.4 42.8 N 42 48 E 4330.64 1549.18 1160.84N 1032.40E 1553.51 N 41.648E 0.406 TELECO Job # 497 TAK 05-03-86 Page 3 MEAS DIRECTION TRUE VERTICAL COORDINATES CLOSURE DOG LEG DEPTH INCL AZIMUTH BEARING VERT DEPTH SECTION N/S E/W DIST ANGLE. SEVERITY feet deg deg deg/min feet feet feet feet feet deg deg/100' **************************************************************************************************** 7835.00 55.2 49.5 N 49 30 E 6031.52 3880.43 2794.60N 2695.48E 3882.71 N 43.966E 0.243 8218.00 54.8 48.7 N 48 42 E 6251.21 4193.68 3000.02N 2932.62E 4195.28 N 44.349E 0.201 8590.00 53.2 48.8 N 48 48 E 6469.86 4494.26 3198.45N 3158.88E 4495.40 N 44.643E 0.431 8717.00 52.3 48.7 N 48 42 E 6546.73 4595.23 3265.11N 3234.88E 4596'.23 N 44.734E 0.712 9081.00 50.5 47.1 N 47 06 E 6773.81 4879.52 3455.81N 3445.94E 4880.28 N 44.918E 0.602 9301.00 .50.3 43.6 N 43 36 E 6914.04 5048.99 3574.92N 3566.51E 5049.76 N 44.933E 1.229 9558.00 53.9 44.7 N 44 42 E 7071.89 5251.65 3720.40N 9808.00 58.6 46.4 N 46 24 E 7210.74 5459.45 3865.92N 10180.00 57.9 46.1 N 46 06 E 7406.49 5775.77 4084.67N 10553.00 54.7 46.8 N 46 48 E 7613.42 6086.04 '4298.44N 10805.00 52.3 50.3 N 50 18 E 7763.30 6288.35 4432.51N 11154.00 51.2 49.2 N 49 12 E 7979.36 6561.81 4609.59N 11338.00 50.5 49.9 N 49 54 E 8095.53 6704.22 4702.16N 11580.00 49.5 48.5 N 48 30 E 8251.09 6889.29 4823.29N 3707.74E 5252.50 3856.08E 5460.29 4084.59E 5776.54 4309.47E 6086.72 4461.27E 6288.88 4670.44E 6562.12 4779.03E 6704.44 4919.36E 6889.43 N 44.902E 1.441 N 44.927E 1.963 N 44.999E 0.200 N 45.073E 0.872 N 45.185E 1.467 N 45.376E 0.401 N 45.465E 0.481 N 45.565E 0.606 TELE£O Oi If±~id PLAN VIEW Serv i EAST 11200 , g6DO 8000 6400 4800 3200 1800 0 0 1600 :3200 4800 6400 8000 9600 TELECO 0 i 1 ~ i ~ i d S~Pv i c~s VERTICAL PROJECTION 0 2000 4000 8000 8000 10000 1~000 14000 10000 18000 20000 4000 6000 8000 10000 12000 VERTICAL SECTION (?t) FILE=L&PC2434,- T/~.PE IN,~n'u~.,M~TtON' , ,,~ ,,,,;:, .,. ...... , ..., ..... ., ,,,,,,., , DEP SP 'GR CAL ES IS ED RHLL RS RD 1 33 7~, 003 O, 900 O, 9.000 0.000 0.000 3t.769 6S.523 7a.713 ;S':...:~: ;:':~.:.~::,~:~;;,:..'::?::':· 1257~.000 2.445 24.245 9.4:~9 430.70~ 60.0~7 ~97.999 '?.*." ~ ~ 12373 030 PO ~ .... uS 19.1 ~ o 99'~ 480 565 ~ pO~ 5,~ . ...... .... u5 205 1" 1 65 O. 1 61 . 1 t 1 575. 201 I 78'~u..,~2~, 6.861 50.193 12.963 3'~.143 I 7 095 14.36? 14.85: 4..184 15.111 10.453 !47.084 a96.,444 85~.937 11978.000 17.5Sl 99.014 12.975 -0.633 -5.234 -6.~1~ --O.C~A.3 85.737 0.483 4..667 10.1'44 11773.000 7.37:5 50.931 8..507 211,118 ' 543.7S7 228.7o0 : ' ;: : ',,. ;' 'o':: -~::' ~, ~ t ~ :~ ~ : : : :.: ::::' ;. , .,' ,~-7~;:i!:, ;:: :: :: ;~, : ;' ;: . 2 2::,:6 :: ~,:,: O' 759 0. ~ 65 ! .064 14.977 10.014 33~.093 45.777 11~,91 53n 8 72'~ 19 ~,95 8 ~67 Pll 197 cz,'~ 940 ~: .::.., ,~ ~~~, ~ :: : ~ ~ ::. ~. ~.~ ' :t :, ::: .':~ ~ · :: ,~r : :: :. ':::: ' ": . : 1.' 51 3 I .061 14.978 10.01 3 228.852 0.206 339.202 9.55,3 FILE ZNTE.RVC, L: 80T= 13378.0'00 TOP= 1195~.000 23.275 20.541 '¢;'is i!t 2:t.75, Ou.O:. :,i::.:.::~;-. )2 ,'8'1-27! ..:'~¢~:':485.,:8,.:7517:?,;¢:~9~'; 3::I 3::,;::::.;~::.._:~0.$.? 3:7.5 z, 88. 688 1 6. 853 FZL_.=: MAZN .001 FIL~ INTE.RV~L: BOT= 13381.000 TOP= 11602.000 S S D L£ D C N DEN C OR R 1 3391 . 000 0.000 O. 000 O. OOO O. 000 0. 000 ~ ;%~:.!::~,,:?,~:,~,~;.~?:.e~,i.coj~~ :!O:,:~:~:~Oi'~:'~E?o;:o'o~o::2'~?::::?io;~-oo, o? ';'o. ooo SSN DENP O.OO -999.25 LSN 4.49.415 175.328 ~,026 2.632 0.025 12981 .000 20,02~ 9,543 5304.613 38.074 19.562 ~:.:.:~': ?, ;.':}~;? :.~ :: ;:~'"':~::,.:,;~4;;7.'1 65.0 0'. 1 07 ,: , · ,, ,.. ,, ,., ,, ,, , ...., ,, .... . .. , 4.41.481 -999.250 454.755 -999.250 322. g 6 c-, 296.075 81::'i'001.0 t:': 9:8:, ",1'4,076: 16.658 418.715 46R.297 186.929 4.233 2.670 0.127 -999.250 .. 12581.000 19.111 9.479 4805.742 65.501 21 .003 14.8.393 ~7~i:.".:--::?' '~:': ?' ~::i:::,!:~i~ 51:~'~:.7..t04'? ;!.5:0:';~88:2 ~?:::$~":~? I: ,: 839-~-:,, ,:: ;;:-.."',': 2 · 7 ~'U ,0 · 0 ~ 0 ,999. Z 50 ....... ..... ' ..... 6i 6.'1'~'3 314.850 34.552 2.54" .214 -999.250 11781 .090 51.230 8.530 4102.262 108.404 32.100 135.989 : . ... '. ' : ,:~. ; ~.~.'"' _-..~.;~.- '~ .- :: ;,:::'~ · _¢~.':,'~':..:_~%i ,. "" 'CS '- ~.,:'¢.~'x-: ~. '; ~ '.' ; ' ?.-:~;::..,~::....:;. :.': ~?:~.:;.~.~:??;.`/~;.`J::~`~8;?:~`~..:~;8~:.`~;~`~`::~;?`:~98~.i~`~S;~.~.Z(?;:~;~:`~;~::c.`.~;:'~6~8`.~¢`~:; .:;: :: I.,.1 9:;~,, ,,, · -1 ,,7 ~ 6' -99 g. 250 257.016 41.837 399.577 ~39.4~7 47.402 ~1.469 I 56,8,~7 39.933 -999.250 F!L~:~4'~N_ .. . .001 FIL~ INT~-RV4L: SOT= 13426.000 TOP= TEN SPO 994,200 0,000 -10.3,750 1,000 0.238 2,8.675 1.728 22.125 I 3026. OOO ,3.541 0.407 62.921 27. 035 4391.676 '~!i'~;' :~!'. :!:--..:;: '~.} ~ :'~,~ ,',',.:..:~.'~..';',~;::.' ..... ". 'm,~-'." ':-' · '. --- . ~:~. "~,.,-: :~,.: ~. ,._~-~.,'::~...,, :.~.:J,'~¢...;..:...,~. .... ;~-0~.,~;.~ ~: tl .4~'8 .: ... t 2826 ._.OO0,:.:, ?,,. :,' 0.....,54.:--~:-?.,~u.30O~,.'.,~:.-'.Z.5. $~:~ ~,?:,, :.38.043 4,289.613 -19. 328 -' 0,542 15,372 8,0~5 13,820 12626.000 0.5~3 0.417 64.002 26.712 ~17~.906 -22.637 't'(,'. :-. 3 '-:-~. _,: :_f -..,.~::.,' .-/:.¢;.:;,_ ."..: ....' ~ ~ ,,. .... ?_,-::~.: ,¢..::.:' ,. -:-~: :,~,..-~-',,0.1 _7 2 ....................... 1.6 ..,.. Q.O ........................ 1~...~.. ~. ................ .~..!. ~..~.Z. ...... ~":'":'-,: .. .. ....., ~ ~ 0,~07 I. ,678 2,6~3 18,10 11826,000 0,007 0,011 300,000 28,621 3758,001 -i4 "2' 64 ?? '?.':::C :::-~,'.:.:::?:::?:,-..'.¥:~%: .::~.:~!O~'~:;:O .~/::~::,~;Z.~:~ :9'~;3¥~?.:~?~:~::~ :1~9;8:'?~;'~:./??~-~':~_67 -42,252 0,258 0,343 I .500 I ,500 1 1 0.0'47 I 3. 070 O. 34.'7 ~ILE:REPE~T.OOJ FILE INTERVAL: SOT= 13381,000 TOP= 1192~9.000 T~EN TEN SPD TH U ED I3 K KT~. 35.996 lZ,.139 306!.E,o~ 570.293 12.999 O,O00 0.291 0.~66 ?~':',?,!?:~,,~~;:!.::, .%...i':?'.:.~"..,.:,'~ , . · ' ' 428.1.953 -58.735 t2.08.5 2.077 3.704, 34~.378 10,951 0.357 19.671 186.053 998,357 59,626 0.812 0.508 10.581 33,559 2~ 7~7 4.460 12.333 4.821 3:500.0¢5 52.103 11 .436 0,379 0.783 ~::~:~?~::.,..:. :~?:<,~i::: ;:~.;;:'::'~:::,i.:'":""~:..,;:L;-:',,~,:,.,~ ' ,,'--. ~.', f~:,.:~!::.:,, ;:!:;, ,~<,; .e,;i~Z-:'::.,: '~.' %~:' .~':~-. ~';i~:,~f- ' '; ;':: .':::!?;. ,. ,'.. :: %!.: "'.};:-{": c~ '-:'.. ' ~;:"-...,<:.. ~,...:,-.'~-:.,~,~:~: ~":':,-..i:::~.':~:'-",'~i,~:2-'O.,,-,~.-~.:~ ,..J,.>.~:,:~ Z!~:;.::,..~:.:~.~:~,,,~,~:.,.~:.:,.,:t.~ -,: ::~::~:,:x-.. ,.:'.:..:.... ........... 853.463 3.66g 0.4&6 16.043 -9,937 7 S · 082 FILE=L.~P~2~$4 FiL=: R~PEAT. 001 F~LE INTERVAL: ~OT= 13382.000 TOP= 12101.000 ~ -" · ' ~ · .~;.:~:~ .,,:,,.~.?~,~:~,~!~< ~'.~,;~,,.~ :~. . ,c'~,~.~. ,,} ,~,. . _~.~ . .;.~,.:;?: ,~ ~.,~.-- ~ ~<.,- '~'-,,.:.~-:.:~..:...,.f ~ ~ .~::-.;~:~..,,: .~ ~ .~. -;,, -.: ~,~,.~,, . . ~:~,: :: _, · ~.:~ ' ~'~ ~ ;?~:'?:~',~".'f' ::'o~ ~' ,. ,~.;:L:::;'; .::?~::' "~-'~'~' ~';;~f:"~" : ~' ~',':,'::::::,:,~;~ :, ;' '::. ~', :::,~;¢'~' "?' , ""z:.:-~. - ~ - ' '~ '9 2" ~ ..~.;....~:,.~,,~.:~: ~:,.,,9,~~. ,,,.~._~,~,~..~:._.,; ,;~,~_~_, ~,. ...... ~ .... ~; ~:""'~'~;'~":::'~-~' ~: ~ ' 5 ,:~' '~:;.~"78: 2::~'~' 0'0.,0;'~-';'"':~,'~/75~:'6"~,~S~S~:~'"~?~:~5:'~A~:.~:8~7~'-:;~'; 6'~' 75 ~;~'~ ~;S 1 3 52 Z. 750 27.095 ~G~" ' ': .... - ~ , :". ~ -- .~,' - ' , , ",,· , , ........ :' :' 2 ~':' ' -'.-::?:f.~:,'~':'"' :'R;'~'"::"~,;,~,-~- -~-'='" ~':'; ": '. "6 :: ~:~'~)': · ':"9~ ~ 71~,2.00~,...,~,.::~..__~,.~.~;.:,1.,~:,~.:-~,~.57:6..~,~,5~ :, ;,~ ~ .,...6~5. ,~.-o8S.. ~ .....6S1.8. 5 23.359 ., . .. ', . ...... .....~ : .~,- .~:. -;~z ,:. ~.. /.- · _.. ~';t 2S. 82 ..O00_-,~ ,":~'-'~..:,~ 3,:, E6f~.:::,;:,~?;.',.~;73:'..-~,! 3-- :.. :~.~Z~,'l.-88: ::.:.~;-,.',: 707 .TD0 , 479. 000 E2. 027 ¢' :~::'1,:2182~000 `~;~`:~``..~.S~:~;S:5:;`~....~L..~.:~:~:~;~;~.~`~::..~..:`~.65~938 .' :':.:50~" 500 484 68~ 23 465 z....,. - . ..... . . .. - , · . - . : - : _ ~ ~'~: ~ 21-.0t ,,. 5'0 O,;~::~:: ::::'~:~',~;~;~:.56~.:, ~:~:;;.:,-; ~;'7':~.:-` ~ ,..:::.,,-~;~, ~:~...~ ).. ;.~,,~:..~...-. ~.:, ~:,.~.,~.;. _-.. ~, ';..~::,;;. ;~..-~,:.~,:.~_;~.;;;~: ............................................... ........ . .................................. ~, ~>~..,,~ ............. ..~ ........ . ,. ?:`.`:.~.:`~:::~`:`~.~.~.~:.~.;`~:..~.~:~?~`:~";~;.~/~.~::~::~.;~:L~.~ .~,: :.:,,:~.-~?::.:,:,,~;:,.,~.???...,;?~?:~:~.,, ~ ,:-:~';~:. ~:';:-.; _ ~~ ' ..:.-~,~>-. - ~ .;~.., .. ,',.. . ~, ,..- ; ~?.-7:.~ ~.: ~:~' .',::? .~%,.~'~:~: ~?:;,~-..~. ~?~,% ~,.'-.,'~:.,,:~ .;?;_ ,.~ ~.;;~ ~'.;~_ ~:.L.~.',:~ 559 LSD CN DEN CORR DEN~ ' ...'..~ -....:~ : ..~:. .~:. - - :.: ~: ~-.~:~. -. · ...: :s: _: _;....:..:. ,--:.:: .. ~.:. - . .~ ~:i....:~:':!~..;,."'?!: ~:::.'i:i:i;:~':';"~: :~.:"~:':::,~::.~:;::.~.;~: ~!..::~-~i::~:.'7':!~:!:::'~.~? . . 129~1.003 26.537 8.263 1988.401 -6.099 1.0~~ 470.053 · .-. · - - _-v..~.~.~ ~.; · ~:.. F · ~ -~::~:~ -:~;~ ~;.:::::~:. ,.~ ~. ~::..:-:~ ., : ~ ' · LSN 116.058 698.970 409.381 33.481 2.702 0 1254.1.000 31.414 9.8z, 5 5025.-556 75.553 21 ~'~: ....-:'~FC: ': :':'.:"-- ~:'?;.';-" ~ :~ :::' :'~.:, .,: -.? .4 -~ -;,,:~:~, (:::': ,'.'~:.: :'.%' :-: .~.,::~ ~ :~:' -~:,: .(:::: :~ ': ~ · · ~:, ...... . ..... ::-.~-::,,.:::~--:, ~:9~-.6:4~ :'..:,_~:3-. ~-~,,~: :_;.-,::,~.t,2,.:~,~,-.~ ..: .... -,:~,,~,.,~34, ,,, 0 .144 158.~65 42.826 .326 -999.250 ,166 293.91z, 135.7a~ ,Z3S -999.250 '..1:234~.~::_..0.0u.-2'~-.. !:::1 4~,8.1 2 : -:,~.:;;,10:~, 12. ,-....'--~443,699'.::?, ,1.71.910 20. 975 276. I 5 555.678 279.745 16.513 2.404 0.151 -99~.250 12141.000 25.829 9.057 4305.207 -237.612 21.172 519.68~ ~ ':::/:.'~: ~- ~¢;~;:. ::7;%~??;:.'::':~:.50.3 ,:908::,:~': 8:t~:;.79-9:5 ?~:-~:;~:;,?:;};??: ~;':-02:'6:::;~ ::;.;,?.c :?:/:,:::,; '2 , 7 3 9. ·: 0.1 3 Z - 999. Z 50 - 1 1 41 ..000:_:-:.-_.::$ 4~::~¢~:? ':.:,c ~:,.:,_~u~;,,~: ~:~:.¢S~.:Z':,, ~,~;;_~:~,~:.~,::'$¢8 ~..:,~56~:.:::~:? :2 Z. 2:8.1. ~.43. :1 40 :"cd::().) :.'-~;'-C4:.::?";?:;~: ~':: ::'~::- ~;~:~:8":; :ZCq;:~. ........... 88_. 9 O 5 31.671 1.330 - 1 .,66.-1 - 999. Z 50 ,' · ,,~ , ',' , · ::c~.~ ~%:~?~ ~<~:¥::!~¢?~'~F??'~"~-~. ..... ""?:.--'-,:-,x,.t~-~-~- .......... -- -- - ~I:::::I~S 4-~: ..:0'8: :,~::'?: t '7;:, 8::~:"~.~ ....... ~ 9:~:LS.0ZL~.~,;~;~:~,~5~:~9..::975 -.~¢: · ..':..:-,t:::'% ......... ~::-~; · -:.:.-: ..... . : ...... i -, 11341 .000 16.640 8.575 3879.486 27.559 30.271 173.465 ;:::?h::.:': ~,.:~:;;.~-.:::::~ ::~..:'?:;: ;.~J;??'.1~5 6:?0::3'~: ~:;;~,, ~Z'2:~;~':~::::Z 0:~; 9:~83`~::'~:::~:~'' ~:,~:::?:>~ ~:'-~':'33~'' ' ..... -1,72 O · -o 09.250 ....... , , , , ~¢: . ¢27:~ ::;?";': ' :c d ,;', ,?~*.';:--'. ' ' ¢ ' ' I 116.327 396.$77 32.337 38.87/., 5C,&56 63.232 172.003 88.465 4,9.202 1.343 -1 .732 ::::::::::::::::: :::::: .- . ' . · . ' 123.065 26.296 -999.250 =IL= · .=L~PH2484 , '~": ~.:~?'? ;,-L" ~,~' -' ~ ,~.~.~;~'-;'~:F_./~p:; '~.~:'~:~ ~ :C- ~:A~.: '~. ~_~': .:..c/::~ ~-::...'- ~., . F'rLE = REPE,~,T. 001 i-<iii'::":'/.!'.,' :.~!2:;:.':~:'~;::.:'~'!::'i'?!~?:,:~i:.' :~,-i.' :.:::-.: .: F~LE INTERVAL: EOT= 13257.000 TOP= 12097.000 15257.000 3./,14 0.217 72.217 29.41,3 2366.563 -3~.59o S~D 0.00O 3.799 10.270 105.100 13.691 12~,57.000 0.533 0.313 78.83~ 27.973 3802.097 -29.501 -33.35~ 0.375 61.153 0.187 -231 .37z, 0.187 0.187 0.187 ~UB.$URFACE DIRECTIONAL SURVEY ~UIDANCE r~ONTINUOUS r-~ OOL CompanY Well Name ARCO ALASKA. INC. SURFACE: ' LGI-8,, (l188'FNL~1668'FEL~ SEC.I~TllN~R14E~UM) Field/Location PRUDHOE BAY/LISBURNE POOL Job Reference No. 71527 SARBER Oat__..~e 6/3/86 Comguted By: .1 ~DCl Ol~:Cl!]'q2L SUR~,v L,SI -~ METH,3. Ds 0.= C]qP'JT~TiO~I T]O.. l~IT~RP]~TZDq: VSqTI"~L S:CTZDN: LI hi': AR qORiZ. DIST. ~R]J~CT::3 ]tT:] .~ T~;":-T 'ZZI'~UT~, :AST /~RCO ALAS<A, INC. L$I-8 PRUDH3E BAY/LiSBdRXiE NDRTH SLDPE,~L6S~A P]OL INTERPOLATE3 VALJES FOR TRUE SJB-SEA EASURED VERTIC6L VERTI:6L DEPTH DEPTH DEPTH 0-00 0.00 -52.00 I00.00 100.30 ~.00 200.03 200.00 14~.00 300.00 300.00 24~.00 · ~00.00 400.00 34g.00 500.00 500.00 ~5.00 500.00 599.99 547.9'9 ?00.00 699.39 547.99 800.00 799.99 747.99 900.03 899.99 847.9? 1000o09 999.99 947.99 1100.00 1099.9~ 1047.99 1200.03 1199.99 1147.99 1300.00 1299.98 1247.98 1~00.00 1399.98 134~.95 1500.00 1499.98 1447.93 1500.90 1599.9~ 15~7.95 1700.00 1699.~8 1547.98 1800.00 1799.98 17~7.9~ 1900.00 1899.98 1847.98 2000.00 1999.)8 1947.98 2100.03 2099.98 2047.98 2200.00 2199.77 2147.77 2300.00 2298.91 2245.91 2~O0.OD 2397.38 2345.38 2500.00 2495.24 2443.24 2500.00 2592.29 2540.29 2700.03 2688.30 2635.30 2800.00 27,82.81 2733.81 z oo.03 z 75.9 3000.00 Z957 ~. 75:, Z915.75 3100.00 3058.23'~ 3005.23 3200.03 3147~35. 3095.05 330'0.00 3234.27 3182.27 3~00.00 33t9~55 3267.55 3500.00 3~0~95 3350.95 3500.00 3483.78 3431.78 3700.00 3561.82 3509.82 3800.00 3636.14 358~.14 3900.00 3T05.50 3553.50 ~VEM 1SO ~,3JRSE VERTI .aL 3EVI&Ti]~ AZi~4dTH SECTiPN DEG qlN Dz-3 Ml'q N 50 i - 21!,41 N ~_ 3 _" 293.a2. N 39 3 : 3~.~! N 37 55 T~ ~:39.01 q 33 23 £ 454.5'3 N 35 55 = 512.7'7 N 39 5~ ~_ 57&.74 N ~3 p c 641.13 0 0 0 3 0 12 0 9 0 16 0 19 0 22 0 Z3 0 Z1 0 ZO 0 16 0 12 0 7 0 0 0 3 0 0 5 0 5 0 5 0 33 $ 2 9 0 10 35 12 51 15 17' 22 ZO 31 22 9 24 26 15 28 17 30 32 !3 34 37 40 li 43 34 4,3 1 DAr: D= S'JR'¢EY: O?-JJ~-S5 K:LLY BUSHING :3-V':iTY,.,"'SRT'41. . O :: St I 0 ] =: :: i . ~ ~ 146 · 3,15 i7~. ~,~I 207, 2.$~ 24~, 1.5~ 2:~5. g. Fg 32~. 1,55 375, 3.45 423. ..~._L~~, CO:.;RDI't~T-iS HDRIZ D':P~RTdRE S3UT-~ E '-~ ST/W-= S T DIST. 4ZI'qUTH T F:ET F-:f "T ;DES 93 N O,O0 E O,O0 q 9 0 E 3! $ O,iZ W 0,13 S $1 13 N 0? q O,Z~ W 0,2'~ '~ 35 43 ~/ 12 $ 0,72 W 0.73 S 80 1Z ~ 27 S 1.1~ :.4 1.17 S 76 51 ~ ~7 S !.5g W !.5~ S 73 42 ,~ 71 q_ 2.19 w ~?.29 5 71 55 ~ 95 S 2.31 W 2.~97 S 71 17 N I$ S 3.41 W 3.~1 S 70 55 N '3,1 S 3.33 W ~. 11 S ~1 16 ~ AS S '4.39 '4 4.52 S 71 41 N 57 S' '~,.75 W 5.J1 S 71 43 N 65 S 5.05 W 5.~2 S 71 55 N 7~ S 5,25 ~ 5.53 S 72 4 ~ 73 3 5,39 W 5.66 S 72 13 N 75 S 5.$~ w 5.75 S 72 20 W 73 S 5.39 W 5,37 S 71 13 W 12 5 5.69 W 5,.~7 S 72 17 W {$5 ~ 5.7~ W 6.08 ~ 71 53 N ~ S 5.~7 W '5.20 S Fl 20 ~4 97 S 5.91 W 6.26 S 70 38 W O~ S 5.74 W 6.1i S 73 2 N 56 ~] 1.37 W 2.08 ~ 41 18 ~ 5,5 N 7,96 ~ 13,23 N 37 0 E 33 N 20,78 E 30,50 N 42 56 E 57 N 35.51 E 50.97 '.~ 45 45 E 35 N 53,75 E 75.04 N 45 45 E 24 N 72.:32 E 102.93 ~ 4~ 3~ = 29 N 95.59 E 135,53 N 4~ 51 ~ 55 N 122.31 = 171.~1 ~ 45 23 ~ 35 "~ 152.59 E 211.42 55 N 18~+.F+5 E 253.95 :;1 q 216.4~ E 29).35 62 N 248.26 E 348.53 57 '4 280.53 E ~00.3,3 35 M 31~.59 E ~55.Z~ 37 N 351.31 E 513.'g0 ~ ~3 7 E .~_, N 391.0~ ~_ 576.29 55 ~ ~3~.3~ E 543.10 ~' ~ N 4~0.50 _~ 314. ARCO ~L~SK4, INC. L$i-B PRUDHDE B~Y/LiSBUR'~E POOL NORTH SLOPE~4L~SKA INTerPOLaTE] TRUE SJB-S:A E4SURED VERTIS&L VSRTI'4L DEPTH DEPTH DEPTH 4000,00 3759,97 3717,97 4100.00 ~829,11 5777.11 4200.00 3886.11 383~.11 4300.00 39~3,54 3~91.54 ~00.90 ¢001.~3 39~9.83 4500.00 ~050.~4 ~00~.5~ 4500.00 ~119,~1 ~95~.51 4?00,00 ~178,11 4125,11 4800,00 ~236,52 ~18~,68 4900,00 ~295,32 4243,02 5000,00 4353.54 $301.54 5100,00 4412,80 ~360,~0 5ZOO.OD ~71.~4 ~419.5~ 5300.00 ~530.~3 ~478.~3 5400.00 ¢590.80 ~538.80 5500.00 4650.75 ~598.75 5600,00 ~710,B7 ~558,87 5?00,00 ~771,~6 4719,85 5~00.00 4832.94 ~780,94 5900,00 4893.99 ~841.9~ . 6000.00 ~955.23 ~903.23 6100.03 5016. 79 f, 964.79 6ZOO.OD 5078.09 5025.09 6300. DO 5138.51 5085.51 6~00,00 5198,56 5145,66 6500.00 5258.50 5205.50 6600,00 5318.17 5265,17 6700.00 53'77~ ~7'~ 5325,47 6800,00 5436~59' 5384.59 6900.00 5495,89 5443.8'~ 7000.00 555'%'~ '84:. 5592.~4 7100,Og 5 61~2'; ? 7 5550.77 ?ZOO,DO 5.~6'9, 58.' 5617,58 7300,00 5725~53. 5673,53 7600.00 5781,~8"~ ~729,33 7500.0D 5837- 3g 5785 .~9 7500.00 5893.5'7' 584~.57 7700.00 5~50.~5 589B.05 7800.0~ 5007.~6 5955.~S 7900.03 5054.39 5012.39 V~LJ'-S F°R EVEN 100 F~.? O: COJRS: VERTI'~L ].EVI&TIS~ aZImUTH SECTI]N SEVerITY O~G HIM DE~ Mi~ FE~T gE~/IO0 51 53 N 40 34 :~ 738,56 55 1 N ~D 45 ~ :~58,71 1,35 55 8 ~ ~0 55 ~ 950.41 3.4! 5~ 55 N 40 50= !031.S2 53 51 N 42 57 ~ ill~,~.6! 1 54 9 ~ ~1 35 ~ 1~73.~9 53 5~ N 4~ 15 E 1354.23 }.50 5~ ]! ~ ~Z 55 'E i435.05 0.63 54 16 N 4~ 10 ~ 1516.0~ 53 ~6 N ~3 13 ~ 15'~7.00 54 6 N ~3 5 E 16F7.33 1.21 53 39 N ~3 Z 'E 175~.12 53 31 M ~3 1~ ~ 1'~3'~.47 3.4~3 52 ~7 N 43 13- !:~13.32 0.53 53 19 N 43 ~ "' 1~9~,19 52 ~3 N ~3 7 ~ 2'077,92 52 23 N 43 i) ~ 2157.00 ].2? 52 Z1 N 43 35 =.. .Z:Z3$.O3 0.21 52 10 q 4~ 43 _ 2.315,10 51 E 2472,73 3,93 15 e 2551,64 1,07 38 E 2531.17 0.$5 5 E !711.08 23 = 27:~1,17 0,~7 ~ 5 = i ~ 71,3 9 13 :_ ~032,55 19 3113.06 i.ll 33 - 3357.51 S.7~ 57 ~ 34~'3,45 3,69 !5 < 35!3.3~, 1~ c. ~,535.1i i 5 = 3539.77 17 ~ 3771.22 23 ~ 3953.2'3 3. 1 2= .~ 3~33.1~ P.17 ~SE 2 ~LLY SUSqlNS 5LEVaTZ]N: 52.00 FT :',tG I',t E E R: S&RB£R SULaR CgSRgiNaT~S Hgqiz. DEm:RTURE SOUT~ E~ST/W=ST gIST, AZIMUTH 5i37. 710. 772. {34 · '~ 95. 1DlS. 1075. 11~5, 51 q 530.15 = 791.42 N 42 3 E 75 N 5~2.71 E ~72.03 ~ 41 55 5 37',1 535.4~ % 954.17 N 41 50 c"' 79 N 693.0~ 5 1036.03 N 41 45 E 14 ",J 743,!8 ~ 1117,27 N 41 4I E 3~ q 7~ao o4 ~ 119;3 ~1 q ~1 38 E 03 q 349.57 E 1273.97 ~ 41 37 ~ 27 N 903.77 ~ 1350,00 ~ 41 38 E ~7 '1 955.6-~ '5 1441.04 ~ 41 42 5 I~ ',2 1314. 17 E 152°~.~.~ N ~1 46 ~ ! iq,~. 1. '~ 5 ~ l~lZ, 1370. 1~,2~. I ~.q7. i545, ! 503. 1561, 1713, ~. '4 1059 70 E 1503 30 ~ 41 51 O~ ~,l 1124,7~ 5 1583,83 %1 41 54 21 ~,] 1.1?O,OZ ~ 1764,74 ~ 41 57 9'5 q 1235.09 5 1845.25 %~ 4Z 0 19 N 12q9_, .95 E 1)25.~ N 42 4 51 ~ 134~.67 ~ 2~05.28 q 42 6 96 W 1399,27 ~ 2055.17 N 42 8 13 N !509.01 ~ 2243.57 N 42 13 &7 N 1552,b7 ~ 2322.74 N 42 16 !775, !932, 1~{9. ~39~ 2359. !115, 2171, 22~2. 4,7 N 1,517.45 F~ 2~,01.76 N 42 20 E 31 "d 1672.05 E 2480.53 N 42 22 E I1 'Q 1'725.97 ~ 2559.52 %1 42 25 E 9~ N 1782.70 ~ 2539.08 N 4~ 29 : ~I '~ 18~9,. ,12 =._ _~713.'~8 ~ 42 33 - 05 N 1895.99 ~ 279~.02 q ~2 38 E 22 ~1 1953.29 E 2379.15 ~ 42 43 E 16 q 2011.22 ~ 2959.55 ~ 42 4~ ~ 96 N 2059,45 E 33~0.05 q 42 ~4 ~ 55 q 2127.60 5 ~120.~5 'i &Z 59 5 2338 · 2.393. 2502, 2557, ~,511. 1565, g71~, 277!, ~1 N 2185 .)4 = 3~0! 97 ~ 43 4 = 54 N 224.5.09 ~Z 3282,37 ~ 43 lO : ~3 N ~307,58 E 33,54.34 ~ 43 18 ~ 99 q 2369,88 E 3~46,35 q 43 26 = i2 'Q !432,65 5 3529,40 N 43 34 ~ 19 q 2495,41 ; 3511.84 N 43 al 5 16 N 2558,12 5 3594.19 N 43 49 5 ~5 N 2620,69 ~ 3775,34 ~ 43 56 6 ~4 W 2582,~5 5 3~5~.07 N 44 3 5 ~CO ~'LASK4, INC. L$I-8 PRUDHOE B6Y/LZSBURqE NORTH SLOPE,ALaSkA TRUE EASUR:D VERTICAL DEPTH DEPT~ 80DO.DO 51Zl. T1 8100,00 5179.15 8200.00 5236.32 8300.00 5294.73 8600,00 5353.25 8500.00 5412.13 ~$00.0~ 5471.63 8700.00 5531.99 BBOO.O3 6593.Z4 8900.00 5655.76 9000.00 671~.2B )IO0.OD 5782.B~ ~200.03 5846.52 9~00,00 5910.~2 )6OO,OO 5974,17 ~5D0.33 7035.91 ~O0.OO 7094.74 ~700.00 7150.79 9800.00 7204.13 9900,00 725~.90 3000.00 7305.~8 OlO0.O0 7357.27 OZOO,OO 7~10.Z3 0300,03 7464.~9 0600.00 7520.13 DSDO.OD 7576.g5 D$O0.OO 763~.57 0700.00 7693.56 0800.00 775~.Z3 OgO0.O0 7815.83 1000.00 7877'56 lIDO.OD 7939..78': 1200.00 8002.,~.0.,. 1300.00 8055 1600,00 8128 1500.00 8193 1500.00 825.8 1700.00 8321 1BOO.OD 8381 lgO0.O0 8438 ~]OL D~TtlE 3F SJ~V:_Y: 03-JJ~-85 iNTEq~OL~TE3, V~l d~S_ :oR EVSN l~O. F'EET 0= ~Z'~Sg2E~,`.~ u 9:gTH. C]JRS_= 2EVi~T'121 aZlHJTq DEG qlN DES Sd~-S:a VERTI 'AL D E ;::) I'H 5069.71 5127.1p 518~.82 6242.73 5301.25 6360.13 5419.63 647~.99 5541 5503.76 5567.25 5733 579~+.52 5855 5922.17 5983.91 7042.7~ 7152.13 7~02.90 7253.48 7305.27 735~.~3 7412.49 7453.13 752~.95 7582.67 7641.56 7702.23 7763.83 7325.66 7837.7~ ?950.40 ~45-: 8013.45 ~:~2: 8075.92 .16.. 8141.16 -O8 8205.08 ,38 8259.08 .13 8329.13 .~+9 8386.49 SECTION S'-V-R£TY :--_ET r"= 3/1 OD... _ Cg3R9 a ST/ FEET I ~ a T E S WEST ;4]RIZ. """'ST ,-.' g. I F~=_T DEParTURE &ZIXUTH ~3i7.02 O.!O 237q.i! ~033.gl 0.15 2932.~4 ~1~3.45 0.53 ~251.91 3.6~ 3039.37 ~242.37 J.~? 3}~2.33 ~423.75 '].21 3145.13 %304.0~ 3.59 3!~.05 ;552·7' i, 13 3'303. 3~ 2307,~5 2369.55 2931.35 ~'gq~ 37 ~053.gl 3175.D8 3294.~4 '3353.5:~ 4921.33 4102.87 4194.29 4255.57 4346.45 4427.07 4507.24 45'{5.76 4665.61 '~51 7.97 C,.Z3 :~ ;~ ) 5.15 O. 9 ~ 3 '~ 3'l. :;972. 25 1.53 50'~9.14 3.9~ 3564. 31 '~5 0 ~ ~ ~ ~ ~51 '9, 52j~.65 1.5! 3676. 3363,20 1.33 3792, 3452.7~, ~ i.q'~._ 33:1,, . 353~.91 2.55 3310. ~6 N 3411.37 54 ~'4 3~63.71 35 ~ 352~.93 79 N. 3533.25 33 N 3~03.39 =3 ~l 3~53.9g ~.~ N 3925.22 4-520,53 N 45 2 E 4'397,57 N ~+5 5 E ~77~,74 NI 45 7 E 5351,66 N 45 7 E 5123.58 q 45 6 E 5!07.34 ~ 45 5 E 3298.13 '4 45 5 E 5~70 99 ~ 45 5 = 5~55.57 q 45 5 ,s 55al.70 q 45 6 E 55~-q~_ .I:=.;~ 0.55 _:~970. 57iJ.7! 3.62 5962.43 ].42 4!00. S,]~. ~2 3.'" _ ~ 4~ 36. 5125.57 J.S? ~3!1. 5237,32 !.2J &365, 5355.61 3,77 4~7i. 54 q 4051.3~ 51 N 4113.37 75 N 417~.3~ 32 :q ~235.71 25 N 4236.04 53 N 4355,07 !3 ~ 4~15.69 14 ~ 447~.88 70 M 4533.67 5527.94 ~713.4a 579~.22 53:~2.15 5~65.22 5047.46 6129.07 6209.76 6299.21 6~67.91 5..--.22.'47 ].7~ '~57~. 569J.32 2.73 4524, 3577,77 3,2~ a573, 575~.~7 0,5! 4722, ~ .3' 3,1~ ~77~ . 5~OV.~q- , ~ 1.37 C~19.. 59.3~,31 ?. 3! ~5'3. 705~.65 2. }5 4921. ~.5 N 4592,8 q.'3 x~ ~652,2 3'9 N 4712.0 :39 q 4772.0 ~3 Xl 4831.9 37 N 4891.0 3 g ~ 4949.6 73 '4 5009.2 i5 q 5070.4 ~ ~132.9 5~46.33 6524.55 6502.27 6579.5~ 6756.5~ 6~32.39 5908.72 6936.15 70~5.90 T147.52 L~I-8 PRUDH3E B~Y/LISBURq,= NORTH SLOPE,AL&.S<~ CO4'PU'TATIOq POOL '.. EASURE3 VERTiS~L DEPTH DEPT9 2000.00 ~493.?0 2100.00 $551.~5 2200.00 8611.79 Z3~O.OO 8573.!0 2¢00,0D 8734.2~ 2500.00 87~5.54 2500.00 $857.55 2700.00 8920.38 2800.00 ~9B~.25 2900.00 9049.19 3030.33 9114.55 31.00.00 9131.)1 3200.00 gZqS.~2 3300.00 931B.~1 3~00.00 g389.~Z 3~23.00 g~05.13 O~fE: 18-JJN-85 !NTE~°OL~TED VALJES :OR EVEN t00 ;~ET '2= SJS-SEA VERTI'~L DE~TH 55 g4 M 53 1~ ~ 1~29,72 53 5~ ~ 51 1~ : 7311,17 2,51 52 16 N 51 2g E 7590,67 1,0~ 52 10 N 51 53 ~ 746g.3a D.7~ 52 18 ~ 51 5~ E T5~.27 51 59 N 52 '~ 'E ?625.92 0,72 51 19 N 52 15 ~ 7725.0!5 0.7! 50 ~1 N 52 1~ ~ 7?$2.50 4'9 53 9 52 19 = T359,11 49 13 N 52 3~ ~ 7934.9! 0.43 8441,70 8499.45 ~559,79 ~621,20 B68Z,25 $743.54 ~805,55 8~69,38 ~932.25 B997.19 9052.55 9129.01 9195.32 9265.91 9337.82 935q.13 N~T~/ · 'AT=_ ]= S'J~VSY: 03-JJN-85 5LLY 3USHI93 ELECATION: 52.00 FT 9 ~/) ~ P TH 3UL'~.q C0~]RDI'4,~TES H]~,iZ. 5]JT~ E'.i ST/W' ST DIST. ~t Z I qU'T H T =c=Y F'~!T D=S -;027.93 :'7 J 79. ~ 0 51'7~. 31 5227.,.,.35 557i · 2~ 5 ~ 1 !!. 31 5196.5') ~ 7233,79 ~ 45 56 525~,~4 E 7312,13 ~ 46 0 5322,i7 5 73~!,53 ~ 45 3 54~6.~! ~ '75a8.8S ~ 46 10 5503.7~ ~ 7627.~ ~ 45 14 5570.75 ~ 7705.51 q 46 17 $572.2~ ~ 7781.8~ ~ 46 21 5.5~3,19 ~ 7:3$:~.~Z '~ 45 25 575~,a8 ? 7935,36 ~ 45 28 E E q 5¢31.3.51 F, 301'3.19 ~ 46 32 E ',J 537~.20 = 8,]'3¢.56 N ~5 35 E q 5')31.73 E 8157.53 ~ 45 38 5 ~ 59~9.57 ~ 322~.53 '4 45 42 = ~'4 50a&.ql E 92~.53 ~ 45 a5 E ~.i 6357.~ E ~514,75 q 46 45 E ARCO ~L~SKA, INC. L$I-B PRjDHOE B~Y/LZSSURNE NORTH SLOPE,AL~SK& P30L Cg'4PUT&Ti3~ O~T~' 1.5-J:JH-=55 ZNT:RPOL~TS3 VALJSS TqUE SJB-S:A E~SURE3 VERTICAL, VE~TZ'AL DEPTH DEPTH DEPTH O.OO 0.00 -5Z.O0 lODO.Og 999.09 047.99 2000.00 1999.98 194T.98 3000,03 2967.75 2915 40DO.O0 3759. =J7 3717.97 5DDO.OO (+353.54 ~'301.5~ 6000.00 4955.23 ~903.Z3 ?O00.OO 5554.~4 5502.84. 8000.00 .5121.71 5069.71 9000.90 $719.23 5567.2,5 0000.00 7305.~ 7253.48 1000.00 7877.56 7825.66 2000.00 8493.?0 ~441.70 3000.00 ~t14.55 9062.65 3~Z3,00 9406,I3 935~.13 :OR :VEN 1033 C]J~S~ DEVI~TI3q AZIMUTH 3YG 4iN 9£3 ?41x~ 0 16 'S~ 75 27 ~ 51 53 N ~3 3~ _ 53 ~5 N ~ 1~ : - 54 3 N ~5 4~ 55 2 N ~9 !3 ~ 50 31 N 48 12 ~ V:RTIC~L S:CT£OF,i 0.00 -4.20 -5.73 211.4! 75~. 55 i 5 ~7. OO ~017.02 ~317, ~7 3013,00 331~.72 FE~T 2= S ;': V ": R ! r Y iD = g / ~ 3 :.3 3.00 0.1! l !.!P 3' .2~ · 1~,6. !!9~. 1 775 · £~7~. 5327. 5 ~I). ~5)5. DaTE 3~ SU~'~'¢Y:Y: 03-JJN-8$ ill, ~_ , C~{}RD~',J~T=qu _,~ _.~ H]RIZ. Sg,JTi ~ST/'4"ST ;'DIST. AZIqUTH 7 F~'F Fz:T 0:5 03 N 3.30 ~5 S 97 S 5.~1 35 q I 52 . 59 5! ,~ 530.15 23 q lO~).ZO u7 q 21 ~ 2!~6.2~ i! 'I 2807.45 ~5 N 3411.37 E 0.00 q g 0 E W 4.52 S 71 ~1 W W 5.16 S 70 33 R ,: 211.~2 ~ 45 11 E E 791.&2 ~ 42 3 ~ : 1533.30 ~ 41 51 E = 2$01.75 N ~2 20 E h 3!01.07 ~ 4~ 4 = E ~'.)21.33 N 4~ 16 =_ 55 Z 7 · 94 6445.35 7233.73 4310.i) 3:31~.T5 ARCO ~LASKA, INCo LGI-8 P~J'DMgE B~Y/LISBUR'qE PDDL N3RTH SL. OPE, ALaSKa, INTERPOLATED VAL'JES :DR T~UE 3JB-S:A EASURED V~RTISAL VERTI'AL DEPT4 DSPT4 DEPTH -52.00 0.00 103.00 200.00 333.00 403.00 500.00 500.00 700.00 803.00 903.00 1000.00 1100.00 1200.00 130O.~O 1403,00 1500.00 1503.00 17OD.O0 l~OD.O0 1900.00 2003.00 Z103,00 2200.00 2300.00 2400.00 2500.00 ZSOO.O0 2703.00 2800.00 2900.00 300C.00 3109,00 3203.00 3309.00 3¢DD,O0 3500.00 3603.00 3700.00 3809.00 CDJ~SE · DEVIATION ~1Z .I MU T'I D~:G qlN OF..3 M!"~ O 0 25 0 5 0 19 015 0 15 0 Zl 0 !2 0 24 0 14 0 1'5 0 13 0 10 0 9 0 0 4 0 5 0 3 0 4 0 0 3 0 3 3 21 7 2'9 10 5 11 1~ 6 15 28 19 38 21 36 24 2~ 23 30 31 33 10 35 20 39 ~5 44 51 50 ~0 O-OD 0.00 52.00 52.00 152.00 152.00 252.00 252.00 352.00 352.30 652.00 452.00 552.01 552.00 652. D1 652.00 752.01 752.00 852.31 852.00 952,01 952.00 1052,01 1052.00 1152.01 1152.00 1252.01 1252.00 1352.02 1352.00 1~52.02 1452.00 1552.02 1552.30 1552.02 1652.00 1T52.01 1752.30 1852.02 1852.00 1952-02 1952.D0 2052.02 2052.30 2t52.05 2152.D0 2252.59 2252.30 2.353.8~ 2352.00 2~55.73 2¢52.30 2558.37 2552.00 2552.98 2652-00 2757.18 2752.00. 2874.17 2852.00- . 2982.73 2952.00 3093.07 3052.00 3205.52 3t52.00 3320.61 3252,0'0 3~38.55 3352~'0'0 3560.31 3452'30 3587.21 3552-30' 3822.23 3652.00 3971.21 3752.00 41.40,18 3852.00 16 ' J jN-:j~ V=~TIS2L F :E ~ T -0,0! -3.i4 -0.4i -1.24 - 1 . 7 -2.40 -3.01 -3.55 -4.40 - 4.71 - 4.91 -5.0~ ' -5.14 -5.26 -5.36 -5.¢~- -5.55 -5.68 -5,75 -4.10 5.17 22.01 ~1.4:~ 9i.9i 125.12 16£.15 10~.35 ~20.57 655.50 755. Zi 901.53 P~G~_ 6 J~TE 3~ S:jRVSY: 03-,JJN-$5 K~:LLY 3tJ,SqlWG 5LEVATIDN: 52.00 ~T 3; SIJS-SE~ 34PTH .S=V-~ITt 3 ::' 1 / 100 O. 03 2.25 0.15 ~.5p -- ',} % '~ 3.53 :D · 2 ) 3. 3.~£~ 3.05 0.D~ }. 33 D. 27 0,37 3.3] 3.33 3.50 7.51 1.71 3.03 ~.£~ $.41 1.5~ ~',i :3 q T ~ / S 13 ij T .q =LET H3~iZ. 3137. OEP~RTURE AZIqUTH D=S MIN O.33 *'4 3.33 q 3,02 S 0 · ~ '_ S 0.1:) S :,3 . 35 S 0.5) $ 1.07 S 1.28 S 3.00 W 3 0 E O.O1 0.18 S 0.'54 S 87 41 0.95 S 75 27 t,'~1 S !.97 S 72 35 2.5~ 3.32 S 71 10 3 · 37 S 70 3 9 1,52 1.52 1.65 1.59 1,7]~ 1.77 i.~I 1.95 1.91 a.17 ~.59 5.17 5.32 5.5¢ 5.72 5.52 4.41 S 71 11 ~ 4.85 S 71 43 ~' 5.20 S ?1 51 N 5.43 S 72 10 N 5.58 S 71 Z1 N 5.59 S 72 16 & 5.32 S 72 18 W 5.93 S 72 10 ~ 6.01 S 72 6 ~ $.12 S 71 49 ~ 2.03 2.12 1.17 5.7'~ 15.71 29.47 44.79 65.3'9 35.31 S S S N 5.3P W $.52 W 3.04 ~ 29.24 E 45.51 E 64.97 E 87.35 E 115,23 ~ 5.22 ,5.~$ 4,57 6.53 22.13 41.51 64.57 91.~6 1Z$.Z! 15~ 22 S ?0 59 N S TO 10 ~ S 75 29 N ~ 27 42 E N 44 41 ~ l~l.q4 !39, ~S 252,{3 355.5! %17.34 570.52 67~.7~ 147.13 182.24 218.22 254.92 293.32 335.42 385.78 444,.05 515.54 604.~'"9 204.37 2~0.93 35'~. 97 ¢21 · ¢99.19 553.11 55';.. · 56 ~0-3. D3 N,45 ~ 45 ~ 45 ~ 43 ~ 42 ~ 42 2 34 10 13 9 20 23 6 53 ARCO , L~I-8 PRUDH3E B~Y/LIS'BJ~E NgRTH SLOPE,ALaSKA POOL INTEqPCLAT:3 VALJES :OR :VEN 100 TRUE EASURE3 VERTICAL VERTI'AL 3EPTH OEPTt DE~TH %,31~.75 3952.00 3900.00 %685.51 ~052.00 ~000.00 %$55.52 ~152.00 610D.O0 %826.35 ~252.00 %200.00 %997.39 ~352.30 ~300.00 5157.0% ~52.00 ~03.00 5~35.57 ~5~2.30 ~500.00 5502.10 ¢652.00 ~60D.O0 5667.~? ¢?52.00 5831.2~ ¢$52.00 ¢803.00 ~99¢.72 ~952.00 %90D.00 S157.¢0 5032.00 5003.00 5322.23 5152,90 5100,00 5689.13 525-2,30 5203.00 5556.91 5352.00 5303.00 58~6.10 5%52.00 5~95.15 5552.00 5503.00 7158.89 5652.00 5603.00 ?~67,20 5752.30 570).00 7526.1~ 5852.00 5800.00 ??~3.62 5952.00 5900.00 ?B78.38 6052.00 6003.00 B052.83 5152,00 5100,00 B226.24 5252,00 5200,00 B397.89 5352,00 5300,00 B557,18 $~52.30 B732.80 5552.00 $500.00 ~894.35 5652~'00 $503.00 ~051,69 6752,'00 ~ 570D,00 ~208,57 5852',00 5800,00 16-JJN-95 ::ET 0= C33~S= V:~TIC~L 3O3LEC- AZIMUTH SECTION S~Vr:RIT~ 54 ~9 N 40 53 5 1043.33 53 55 N ~1 0 5 1131.48 54 7 N 42 1 E 1313,&5 54 72 N 43 1 ~ 1455,43 53 %7 N ~3 13 E 1594.90 ;3 53 N 42 59 ~ 1731.63 53 19 N 43 17,_= 1R56, .99 53 19 N 43 ~ ~: 1999.~15 52 11 N ~3 15 ~ 2131.23 52 !4 N 43 37 q 2250.7~ 52 14 N ~3 5'~ =.. Z33).87 52 9 N ~+~+ 3 : 2513.01 53 13 N ~5 23 J '2732.~5 53 ~5 N 45 13 E 3053.61 54 6 N a5 ~ ~5 ~1~.9~ 53 56 ~'i 4~ !3 % 3527.77 55 19 N ~9 1~ ~ :j, 77~,03 55 3 N ~9 2~ = 3917,46 5a 55 N 4~ 20 ~ ~053.27 54 38 N 49 3 2 ~201.33 53 55 N 43 4& E ~.:14!.27 53 !4 N l~ ~ : ~477.7~ 52 19 N 4~ 57 :~ %60).73 53 32 N ~7 53 : ~:~j7.71 50 16 N ~5 5~ '- ~7S.~5 )~65.06 5952:'00 5903.00 50 Z2 )526.8B 7052.00 ?009.00 53:7 ~?02.21 7152,00t100.00 56 52 ~89~.18 ?2SZABO:; 7203.00 59 5~ }089.98 73~52,~B0', . 1300.00 5:3 ~3 ~656.29 7552'00 ?50D,O0 55 20 9529.59 7652,00 7600.00 54 3 }?96.33 7752.30 ?70D.O0 52 19 )958.52 7852.00 7800.00 51 ~7 ~ 4~ ~l : ~?~ 1~ q 47 Z 5 5.~6~.~ N 47 ~ ~ 590~.01 ~'~ ~7 !5 ~ 515'3.56 ~ a8 9 : 52~?.9~ N ~g 5! : $411,5'3 1.03 0,77 2,.53 !.1~; ! .42 ] · ~.-51 3.1 q 3.37 0,47 1. ')3 O.gl 3.45 ]. 97 !.47 1.15 ~. 79 O, l ! 3.5; I . OS 1.25 ! .53 1,7~ i,S! 3.57 !.27 S, 5'J O · :3 $ 3.75 D&T~ 3: SJR~EY: 03-JJN-~5 KELLY 5US~IN5 ELEVaTI]N: 52,00 FT RE'Tiq%ULaR CD'J~OI~nTES HJRIZ, DEPaRTUrE H]~Tq/SOOTq E~ST/WGST DIST, ~ZI~UIH =:FI__ FEET,_ F~T_ D=3. MIN 731.93 'i 597.95 ~ = 1049.11 q 41 45 E 53.~.a'9 'q 7~8.$1 E 118,5.50 q ~1 39 E ~39,$5 '.l B79,.$~ E 1~24,Ii ~ 41 37 E lPgl,56 ~ 9T3,30 E 1%~2,47 ~ 4~ 43 ~ 1I~2,75 ~4 106~,~S E 15~i,19 ~ 41 50 E 1391.76 ~,,l !25~..5~ ~ I~73,32 N 42 2 E 1~3.'{4 N 13~5,~2 E 2006.9,5 N 42 6 E 1554.35 N 1435. ~7 ~ 213~.64 q ~2 10 ~ i5'7¢.19 'q 11525.0'3 : 2261~.31 ~ 42 14 ~ i772.46 'J 1614,56 1364.96 'q 1703.50 1 ~=q 5A ~ 17=5.13 vJ3~ ~? ~I !8~9.79 !147.07 Xl i9~6.15 224!.5a ?4 !094.65 252~,34 q 2511,,3~ 2397,59 g 42 19 E ~525.q6 ~ 42 24 E 2656.81 ~ 42 30 = 2790.31 N 42 37 5 292~.~5 ~ 42 46 E 3~35.75 'q 43 29 ~ 3533.~2 ~ ~3 4~ E Z720,90 M 2622.31 2314.~7 N 2731.7~ 2907.23 N 2840.31 i)')9.59 N 29a7.53 J091.75 N ~052.53 B!~1.77 M 3155.27 3265.5i N 3254.30 3351.~3 q 3359.13 ~;32.53 q 3440.95 751~.)I M 3529.73 ~179.1~. 3922.0t~ >,1 a~. 8 E 4J54.~.5 4205.62 4344.75 4481.00 ~ 44 45 E 351}0.~a ~.l 351~.49 35~!,5~. N 3703.17 3793.5? "l 3804.71 ~907 ~4 N 3922 56 4022.32 N 4045.1~ 4130.7~ N 4160.~) ~327.87 N &373.72 &~17.50 M 4~72.72 ~50~.~4~ ,, N 4~66.1~~ ~ 5101.57 q 45 5 5 '5223.~; ~ 45 5 ~ 5372.35 q 45 5 = 5536.55 N 45 6 ~ : 3704.92 q 45 9 E 51363.13 ~ 45 12 5 6011.58 ~ 45 15 5 6286.31 N 45 gl = 6%1~.83 N 45 25 ~ ARSD A~/~S(A, IqC. PRUDHOE B~Y/LISBURqE NDRTH SLOPE,AL~.SKA CD~PUTAT~Dq 'DARE' i$-JJN-3$ P.3uqL T. NT~POL~TE3 V~LDES ..=3R .-_'VE~ !30 F=~r .52.00 FT E~SURED DEPTH 1119.5] 1278.7Z 1~36.20 1590.59 1750.91 192¢-33 2265,~? 2~28,9~ 2591,12 2~9.5 1 2904.32 3056,5~ 3204.5D 3365.67 3~23,02 TRUE VERTiCaL DEPTH ?952.00 80SI.DO 8152.00 8252.00 8352.00 8552.30 ~652.00 B752.00 8952.00 ]052.00 ~152.30 94~6,13 SJB-S:A C]JRSE VERT!SaL YZRTI-AL 3~VIATIDN AZIMUTH SECTZDN DEPTH Z903.OO ~003.00 8103.00 8200.00 5302.00 gqOO.O0 B500.30 ~500.00 8703.00 ~803.00 8~OD.O0 9000.00 9103.03 9203.00 9300.00 ~35~.13 51 Z] 5O 9 53 ~ 52 '6 51 Z3 N 50 47 ~ 5661.31 N 50 2~ E 575Z.63 N 50 1¢ E 5903.11 q 4~ 57 ~ 7025.20 N 4~ ~3 ~ f166.75 N 51 13 ~ 7311.93 N 51 37 E ~¢42.15 q 5Z ~ ~ 757!.05 5O 46 44 44 S~VER!T'f r',_,_.~::: ~ / ~... 33 ~ L: ~ r 0.~5 ~553.38 q 1.35 a7aO.g3 "4 1.70 aBiS.Dq N !.'~3 4'~95,59 q 2,51 4~B7.23 N Z,5_:: 5079. J3 N ~.,3 =i41.44 ,,. :~ ~ ~,~ 0 · 5 ~ 2.n2.. 0.03 C~SRDI~IT:S H]RZZ. DE~RTUR:~ EaST/W:ST DIST. &ZI~UTH FS~T FE~T DES MIN 466~,97 E 5539,92 q 45 29 E 4759,25 E 6553,15 ~ 45 34 E 4853,46 ~ 67~4.31 ~ 45 40 = 4944,08 E 6901.56 ~ 45 45 E 5040,!I E 70:26,~$ ~ 45 50 E 5148,40 E 7157,~ N 45 54 E 5260,53 ~ 73!2,99 M 46 0 ~ 5464,47 ~ 7~7!,69 q 46 ti ~ 5565.2~ : 759B.SZ ~ ~5 17 5 5,562.53 E 7820.¢9 ~ 45 23 E 5755.09 E 7933.31 ~ 45 lB E 5'B~7.42 : 895:!.39 U 45 33 5 5)3~,~'B E 8160.~3 ~ 45 38 5 5014,~2 E ~261,24 N 45 43 E 6057,~4 ~ ~314,75 N 46 45 ~ II, RCO ~L~SK~ I~C. L~I-8 ~RUDHOE B ~Y/LI~B'J~E ~3RTH SLOPE,AL~$K~ TOP ~AHDC] ZDdF TOP WAMDD ZONE 'FOP ~'~HDD Zg~E TOP ,~M,DO ZO~IE TOP ~AM]O ZD~E TOP ~AHJD ZD~ TOP NAM DD ZD~E PBTD TD C ] ~lPUT ~TI~'~I ~OOL iNTE~OOL~TED VALJES q~ASJRED D-2 P r,~t ~:LOW K~5 TeUNC~TEJ 12074.00 12216.30 12362.00 12534.30 12730.00 12792.30 13375.90 13323.00 DAFE: 15-JJN-~$ 5H0:SEN HDR!Z ]NS ] 7 t S i N = TV~ K ? :~536 · 25 ,5521 3711.35 2939.45 ~979.0~ 9377 ~0~, I IlS F ,=NL, O~TE K~L' Y SURVEY: 03-.J J ~I-B 5 3USHI',IG ELEVATIgN: 3Z.O0 FT F=L, SEC !, TllN, Ri~, UM N3~TH/SDUTt E~ST/WSST 5056.19 N 5243.50 5!37.15 N 5332.05 522~.52 :',1 5422.70 5339.90 N 5571.7i 53~5.4! N 5650.52 5~14.57 N 55~3.35 $674.g~ N 6030.~5 55~5.~3 q 605'?.8~ ~CO ALASKA, I~C. 3~T= ]= SJRVS¥: O3-JJN-~5 L~I-8 PRJDH3E B~Y/LISBUR~E NORTH SLOPE,AL~SK& POOL <=LLY !!~JSHiNG 52.00 M&qK=R '~-31N=~, il.~a_ FNL, ~SJRErJ O~°T'~ TVD ~ ...... =R~'~'~ i<3 .... cL2~4 K.'~ ...... 155~ SJ~FaSE ,OCATION SEC 1, rlla, R!~, N.]RTH/S]UTq E~ST/4EST TOP ~H30 ZOnE 7 TOP TOP ~H]O ZOnE 5 TOP TOP ~HOO ZOnE 3 TOP ~H]O Z]~ 2 TOP ~&q30 Z3~ 1 PBTD TD ~5055.1~ N 52~3.59 5137.15 N 5332.05 5'203.52 N .5~£2.70 5339.~] :q 5591.72 '3~.¢2 N 5550.52 5414. . 57. N 54~3~ .35 5674.99 N 5039.35 35~5.~3 N 5057.$~ :IN~L WEL,,. LO~'~Ti]N~, &T TO'. TRJE MEASJRED VERTICAL VERTi''gL DEPTH DZ~TH 13423.0 0 ~405.13 935 ~+. 13 .53ia.75 q ~5 45 E FT SCHLUMBEROER O I'RECT I ONAL SURVEY COMPANY ARCO ALASKA INC WELL LOI-8 F I ELD PRUOHOE BAY/L I SBURNE COUNTRY USA RUN 2 DATE LOOOED 03 - JUN - 86 REFERENCE O0007]SZ? WELL: LGI-8 (1188'FNL & 1668'FEL, SEC.1,TllN,R14E,t~)~ No~rH 1o000 REF 0000'7 SC:PiLE: = l / 2000 I N/FT 8OOO 6OOO 4000 2000 -2000 -4000 SOUTH -~000 -40O0 NEST -2000 0 2000 4000 6000 8000 lO000 12000 EPlST 22(3. ,WELL- LGI-8 (1188'FNL & t668'FEL, SEC.t,T11N,R14E,L~) -4000 -ZO00 O O Z000 4000 I I ! i i 1] ] ~T~n [ i i ] ........................ i , ~ i , i , . r : : : : : : ........... : = : ----~ . . . . --* . · * ~ j * ~ . . ~ t ....~. ~:.~ * ~ ~ ~ , ~ ~ * ~ -.i...f.-H ...... f.-H.+-H.-i--~f-. ~--.t..H..+...-.i~':]~. ~--+H.-~.--b-F.+.. -+--H...H.-.i.V~. ~ i ~ ' 't - ~'': -?~'~ .......... ? ................. ~'~ ......... -'f'.t..++...--i%+H..H-H ...... H~.- r.~-FH--b H-Hi, , h~.. 4..~..~ 4...Pbb "'i'" 'Hr ....... ~,i...i.-..-,+.,i,-,~,,.-,-~.,i.,.~,,.i.-l,,.i,..i-~4,..--*.,,*.-~,.i...--i,.-i-.i---i,--,-.i...~*..4- ~.:,~..i ...... -'?-+"f%-J-'t--'fff ....... t"%t--t--'--?t-'~"-.-t-..~...t-t ....... j--'j--f'~'" H'-'i---~--~---~'--~-+H '-~--+-'~--'~ ~--'~--r'-]--- --{-+H-'+H-H .H-H ...... F¢.~-...H-H-..-FFH.-.~ ...~-bbb 4-4-¢¢-+.bbb -~'"F'~I'" "'Y'Y'T"T" 'W"~'"Y~ ....... ?r-'~-" m'"y'~-*"" '"*'"r"~-?"-~'"~'"~'"+"' "'~'"~'+'~ ....... +'"~'+"+-' '"~-~"~ '"~-5"'~'"~--5"+"~"~-'-~--.~4...&.., ~..4~}.-.g.-~-~.-~..4-..~..}...~-~&.4 '+"?+'+" "+-+"t"~ ...... H...+..-~ ....... b4 ......... H+.+..¢ ...... HHHH.4.--HH~ ....... HH~--4 ....... {...~...~..-~.....~&..,-4~ ~4..4-..;....4.~-,.4.....4...L4...L....&.L-L.L...4.4.4...L.-.4...L.L4 -4--~..~¢...-4-¢.~..¢--...-~...H-~.--~--.~-..*.4-~-..--~..4..4...~..~....-~...&..~...*....-~..4.4..4 - 4 .¢ *~... ??"?"! ...... t"t"?"i ...... ?"?"?"? ...... ~ t"t ..... ' ...... ?"?"?"~ ....... f.?..f.?......?..~...?l.?.....?..?..i..t ....... ?i.-.H--....--?--+,~ ....... H---~--.H---H--....~..++.i---~--+-H---i ...... H---H-4...H---H r'TTIr' "'rT"t"r" "T"?'r" 'TT"~'" 'TTT'~ ....... m-?" '"~ .... - T"t- -?"F?" 'i"i'"~'"?~'",'-fff'"t"' ~"t"t"~-XJ'~0 ~-i'" -'?~.-.t,~---.-~-..~.-?~-t..+--H..+- .... i I ~ ...~ .... ' .......... .,~: .:.: : : : : / : : : : : : : : / : : ~ : : : ~ t : : : :,::/:::: :~:: ::~:::FF~::, ~ .................... ::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::: :T:h..%+.++-~'-'"' '+++'~'"'""~'"~-*'"~'"~4..,4.$.~...~...~;:~::~'""*'"" ' ..... ....... Y'."?" ?'Fro"'. TT"rTT'FFFF' "'?"?m'"r'r'T"?T'~ '"?"?"t'"~Tt"~'"t"T"~ '"H-H'"I"'H-H ..... +'"H'"F't"6+++"~ "+"H'"6'~"+"H"+'"-.H.-.4.--%--H..-H-..~ ......~ W"~'"* ....... ~'~"'y"* ...... W"W"?'~ ...... ~ ?'?'~'"~: ...... ~] .... ~ r--~-'-*-"~ ~ ~ '-~-.-~..-¢..4..-: ~ ~ ~ ..-~.--~-4---b-.'.--+-.~-.-~---;--.~--;--.;-4~ ~ ~ ~ -~ ¢ ¢ ~ ~ ~ ¢ 4 4 4 4 ¢ ;: i: *[ ~ ........ ¢ ¢ ¢ }-} } 4 t y..~...~.-~- "T'TT"? ...... TT'r'T" ?TT"t ...... FFY'~ ....... r"?"r"t ....... ~"'~'"?"~ ...... i"'r'"r"-i ....... ~'"y"y'? ....... r"r-?'-?'- -'ff-'ff'-ff-"? ...... fff.--.?-i ....... i..ff.--~-.--i ...... t.+-+.+-.~-.+.+.>+-.:..+.+-+.+--.'..+-+.+-.-;..-. ....... ....... ~ ! ~ i i i i i ! i i i ! ! i i i ~ i i I ~ ~ i ~ ~ ] i ~ t i i i ~ i i i ~ i i'TT"i ....... !-'Y'?~'TT'"['T'T"?T'"F"7'TT']'"?T"?"~"T'T'"F't",'"'f"T"?'"? .444...~ ...... i-..i...i...i...:.4444 ....... i...i...i...!... 4444.44444... ,.-i--i...i...i.-~..i.-.i..-!--4 ...... bg4444...Li4-...44...LLL.L.L.LL~.4...LLL14.4.4.4....4...LLLL.LLLL '.'H-.'6.f ...... H...H ....... H.-.H ....... H...H ..... H...H---H-4-.-.b.~-.- .'+..H--.H---Hb-H ...... H---H.4..-H.-.H ........ b--b..b-H-4...i.--.b.~--.~-4....b..L4...b.i.4.4...i ...... L.L4...L~.4.4...L.L.. "+"f'"t"t .... i"-t-'f'"t-"'-'-H'"t'-'i ....... t-6"H ..... H-+-'H'-+'+-+-+" 4--H--+-.H-+.+.+..~..-b~-.H.-+.+-+.-H-----H.-+.+..bi....b-H ....... H---H-4-4.--H.-.i ...... H---H---H--.H-.-~-.. -.f..t.-.?..t ...... ?.?.?i...,..t.?-.?--~ ....... ?..?-.?..?.- --tt~nn~-'-H-"?'-"H'"H'ffff"H-{--~-"H'-'H--'t-'f--H-t-'-H ....... H---H---H ....... H...H.-.?-.-H.---?..,.?..H.-.H--?-..H..-t-- · "t'"t"t"t ...... t"?"i'l': ...... t'"i--'t"t"t"ff'"t'ff'-f'" "t'ff-'t"i ....... t"t-'f--'t"~"ff'-i'--t--t-'-t--te-ff ....... f-f-t.+.-t-+--.?--~:..t ....... t--+--t--.t.--t-+.+.-t.--H ~ t i ~ t~ t ? ~t ~i I! ~ t ~ t ?:t i "'~ 't'"t'"t'","?"i-'?"?"'-?"?-fl ...... t"t?"f't'"?'f'i ....... H'"H"'i'"H'"H ....... H'"HTff'H'"i ...... f""i ....... ffH'"H'"?1- ~ I ~ : ! ~ ~ ! ! I ! ~ / ~ : I ~ ~ t t I "t t't"t'~'-?":-'T-~-"'!'"?"?'1 ...... t'"t'"t'"?" ""!"17"I'"?'' "1"T"t'"?'T"t'"?l"1'"!''' '--1'-?-T--!---r'l~--'1-'"?--t ....... ?.l.r.r..p.1ll_Tl.l~..,...?... · ..t._t...!...t ...... t...t...t...1 ...... t...?...w..t...~...!...?.?.t ..... t...~...~...~ ...... i._~..i...~_ ..i...i...i_.i._ _~..i...i..~_....4..4...i...i.......~...~....b..i ...... ~..i...i...~...i...~...~...i...i... "'.~ + '"r" f"t ....... ?.'r.-?.t ....... ?'?'t"'* ...... ~'-?-?-~-'- ~'.!.-.~..-t-..t ...... t'"r"~--'t"- --~.,~f4-- -.~...f..~-~ ...... ~"'f'"'?"H' -'~"'~'-'H-H- ...H.i---~.--~.,-f--.~--.~----b-.~ ...... ~.--~-.-~...~...l..4...H.;...,~ ....... H-~-.--b--*..-l--.~,.,~.-.i---i .... "'.'"~ ...... t ....... ?"t'"r"t ....... 1'"?'"t'"? ...... ?"1'"t"~ ...... FY"t'T' "T"Ft"T"-'t'"?"~'"t'-'"t"'~'-~"~ ....... F~W"t"' '"?"?"t"f ....... ?"?"?'~ ...... ?'t"t'"~ ...... ??"k'?"?"?"?i t'"?"?"f ...... ?"?"~'"t .... ?t't':"?tt'f ....... ?"f't't ....... ?ttt'~"?tt?tt't't'~ 'ff"?'~ ~'"t'"'~'"~"~ .%-f-?-ffH---t.-f ....... ...................... , ............................................................. t .................................... * ........... ~ ................................... ?....., ................................... i- n ii z PROJECTION ON VERTICAL PLANE 4S. - 22S. SCALED IN V£RTICi:IL DEPI'HS HORIZ SCALE = 1/2000 IN/FT FOrm to be inserted in each "Active" well folder to check for timely compliance with our regulations. OPERATOR', WELL. NAME AND NUMB~ Reports and Materials to be received by: Date Required Date Received Remarks Completion Report ye._~ /~-'/~ Well History Samples Mud Log ~,~:- ~1 ~ ~/~ ,, Core Chips Core Description ~/~/~'" Registered Survey Plat 1 Inclination Survey ~i~tio~a~ S.rVey ~ri~ S~ ~ ~por~s ...... ~,-- .y/~~.. ~ , Production Test Reports ~ ..... ,~, ~1~ Digitized Data ~-- STATE OF ALASKA -- ALASKA ,.. AND GAS CONSERVATION COMMI[ .)N REPORT OF SUNDRY WELL OPERATIONS 1. Operations performed: Operation shutdown F~ Stimulate ~ Plugging r-- Perforate~ Pull tubing Alter Casing [] Other MX COMPLETE 2. Name of Operator ARCO Alaska~ Inc. 3. Address P,Oo Box 100360 Anchorage, AK 99510-0360 4. Location of well at surface 1188' FNL, 1668' FEL, Sec.1, T11N, R14E, UM At top of productive interval 1412' FNL, 3576' FWL, Sec.31, T12N, R15E, UM At effective depth 793' FNL, 4363' FWL, Sec.31, T12N, R15E, UM At total depth 773' FNL, 4390' FWL, Sec.31, T12N, R15E, UM 5. Datum elevation(DF or KB) RKB 52' 6. UnitorProperty name Prudhoe Bay Unit Feet Well number I /'~1 -~ 8. Approval number 9. APl number 50-- 029-2;1562 10. Pool Li sburne Oil Pool 11. Present well condition summary Total depth: measured true vertical 13423 'MD 9406 ' TVD feet Plugs (measured) feet None Effective depth: measured feet Junk (measured) true vertical 13375 'MD feet None 9372 'TVD Casing Length Size Cemented Measured depth True Vertical depth Conductor 80' 20" 1700# Poleset 120'HD 120'TVD Surface 4322' 13-3/8" 2450 sx AS I I I & 4361 'MD 3979'TVD 600 sx Class G Production 11931 9-5/8" 1125 sx Class G 11966'MD 8475'TVD Liner 1655' 7" 600 sx Class G & 11767'-13422' 8361 '-9405' 300 sx CS I Perforation depth: measured 12300'-12350'MD, 12688'-12704'MD, 12792'-12816'MD, 12640'-12670'MD, 12748'-12772'MD, 12840'-12876'MD, 12920'-12930'MD true vertical 8065 ' -8097 ' TVD, 8913 ' -8923 ' TVD, 8979 ' -8994 ' TVD, 8883'-8901 'TVD, 8951'-8966'TVD, 9010'-9033'TVD, 9062'-9069'TVD Tubing (size, grade and measured depth) 2-7/8", L-80, tbg w/tail ~ 12624' Packers and SSSV (type and measured depth) HB pkr ~ 11708', lB pkrs @ 12389' 12. Stimulation or cement squeeze summary & 12590' (WLM) & TRDP-1A SSSV 8 2145.' InteNrv/a~s treated (measured) Treatment description including volumes used and final pressure 13. N/A Prior to well operation Subsequent to operation Representative Daily Average Production or Injection Data Oil-Bbl Gas-Mcr Water-Bbl Casing Pressure Tubing Pressure 14. Attachments (Completion Well History) Daily Report of Well Operations ~ Copies of Logs and Surveys Run X__X Gyro 15. I hereby certify that the foregoing is true and correct to the best of my knowledge Form 10-404 Rev. 12-1-85 ~ - Title Associate Engineer Date Submit in Duplicate ARCO Oil and Gas Company Well History - Initial Report - Daily Instructions: Prepare and submit the "Initial Report" on the first Wednesday after a well is spudded or workover operations are started. Daily work prior to spudding should be summarized on the form giving inclusive dates only. District Field Alaska I County, parish or borough I State I North Slope Borough I Prudhoe Bay ILease or Unit ADL #34628 Wa"f(~i-8 ~Title I Completion Alaska Auth. or W.O. no. ALO052 Nabors I-ES API 50-029-21562 Operator ARCO W.I. ARCO Alaska, Inc. 50% Complete 10/18/86 1500 Hrs. Date and depth Complete record for each day reported as of 8:00 a.m. 10119/86 thru 10120186 10/21/86 i0/22/86 10/23/86 Thesign~above i~,correct ~~ For form l:k,eparatidn and distribution, 7" f/11,767'-13,422' 13,375' PBTD, Perf 9.4 ppg NaC1 Accept rig @ 1500 hfs, 10/18/86. ND master vlv, NU & Cst BOPE. Circ out diesel cap, set storm vlv. POH w/2-7/8" tbg above storm vlv. ND BOPE, NU 5K tbg spool & tst. NU & tst BOPE. Retrieve storm vlv. Tst csg to 2500 psi; OK. RU & prepare to perf. 7" f/11,767'-13,422' 13,375' PBTD, RIH w/pkr 9.4 ppg NaC1 RU WL, perf 12,920'-12,930', 12,840'-12,876', 12,792'-12,816', 12,748'-12,772', 12,688'-12,704' & 12,640'-12,670' @ 1SPF. Perf 12,300'-12,350' @ 4 SPF. Rn 8.425" gage ring/JB. Rn 5.80" gage ring/JB. Set btm pkr on WL @ 12,590'. PU middle pkr & RIH on WL. 7" f/11,767'-13,422' 13,375' PBTD, Rn 2-7/8" CA 9.4 ppg NaC1 Att to set middle pkr on WL, pkr set on 3rd rn @ 12,361' WLM. w/2-7/8" CA. RIH 7" f/11,767'-13,422' 13,375' PBTD, Displ w/diesel 9.4 ppg NaC1 Rm 2-7/8", 6.5#, L-80 EUE 8RD NKK tbg w/$SSV @ 2143', HB Retry Pkr @ 11,708', lB Pkrs @ 12,389' & 12,590' WLM, TT @ 12,624'. Tst tbg to 2500 psi, ann to 2000 psi. ND BOPE, NU & tst tree to 5000 psi. Displ well w/diesel. IDate 11/04/86 [Title Drilling Supervisor see Procedures Manual, Section 10, Drilling, Pages 86 and 87. ARCO Oil and Gas Company Daily Well History-Final Report Instructions: Prepare and submit the "Final Report" on the first Wednesday after allowable has been assigned or well is Plugged, Abandoned, or Sold. "Final Report" should be submitted also when operations are suspended for an indefinite or appreciable length of time. On workovers when an official test is not required upon completion, report completion and representative test data in blocks provided. The "Final Report" form may be used for reporting the entire operation if space is available. Accounting cost center code State Alaska Well no. LGI-8 District County or Parish Alaska Lease North Slope Borough Field or Unit Prudhoe Bay ADL #34628 Auth. or W.O. no. T t e AL0052 Completion Nabors 1-ES Operator I A.R.Co. ARCO Alaska, Inc. Spudded or W.O. begun IDate I Complete Date and depth Complete record for each day reported as of 8:00 a.m. 10124/86 7" f/11,767'-13,422' 13,375' PBTD, RR Diesel Displ well w/diesel. API 50-029-21562 W.I. rrotal number of wells (active or inactive) on this Icost center prior to plugging and I 50~ labandonment of this well I IHour I Prior status if a W.O. 10/18/86 [ 1500 Hrs. RR @ 0830 hfs, 10/23/86. Old TD Released rig 0830 Hrs. Classifications (oil, gas, etc.) Oil New TD Date PB Depth Kind of rig 10/23/86 Type completion (single, dual, etc.) Single Producing method Official reservoir name(s) Flowing Lisburne Potential test data 13,375' Rotary Well no. Date Reservoir Producing Interval Oil or gas Test time Production Oil on test Gas per day Pump size, SPM X length Choke size T.P. C.P. Water % GOR Gravity Allowable 'Effective date corrected Signat~~ Title ' 11/04/86 Drilling Supervisor For form preparation and distribution, see Procedures Manual, Section 10, Drilling, Pages 86 and 87. ARCO ALASKA INC. LISBURNE ENGINEERING Date: 11-24-86 From: Para Lambert Enclosed are the following: CH Finals for LGI 8 ~---~Collar Log 10-20-86 Run 1 5" DA (Set two Packers) Collar Log 10-20-86 Run 1 5" DA (Perforations) Received by: Please sign and return to!Pam Lambert ARCO AK INC. 700 G Street ATO 477 Anchorage, AK. 99510 D &M STATE EXXON STANDARD FILE ROOM CENTRAL FILES TRANSMITTAL # 106 STATE OF ALASKA ALASK~-~')IL AND GAS CONSERVATION COMIV--'~ION APPLIC I FOR SUNDRY APPROVALS 1. Type of Request: Abandon [] Suspend [] Operation Shutdown [] Re-enter suspended well [] Alter casing [] Time extension [] Change approved program [] Plugging [] Stimulate ~xPull tubing [] Amend order [] Perforate]{2](Other],~][ 2. Name of Operator 5. Datum elevation (DF or KB) ARCO ALASKA, INC. RKB 52 feet 3. Address 6. Unit or Property name P.O.B. 100360, ANCHORAGE, AK. 99510 Prudhoe Bay/Lisburne 7. Well number LG1-8 4. Location of well at surface 1~o'~-'p F. NL. 1.668. FEL, or pr~ducuve tnterva~ Sec. 1, Ti1N, R14E, UM 8. Permit number 1320' FNL, 1215' At effective depth FEL. Sec. 704' FNL, 4328' FWL, Sec. At total depth 679' FNL. 4357' FWL., Sec. 11. Present well condition summary Total depth: measured 13423 ' true vertical 9364 ' 31, T12N, 31, Ti2N, 31, T12N, R15E, UM(app) R15E, UM(app) R15E, UM(app) R6-57 9. AP~number 50-- ~29-21~62 .. 10. ~o~ LISBURNE OIL POOL feet feet Plugs(measured) NONE RECEIVED Effective depth: Casing Structural Conductor 80 ' Surface 4322 ' Intermediate Production 11931 ' Liner 1655' Perforation depth: measured measured 11931 ' true vertical9334 ' Length Size 20" 13-3/8" 9-5/8" 7" feet feet Junk (measured) NONE OCT 3 1 1986 Alaska Oil & Gas Cons. Commission Cemented Measured-depth ,a~lch0i'ag~ Vertical depth 1700# POLESET 120' 2450 sx AS III & 4361' 600 sx class G 1125 sx class G 11966' 600 sx class G 11767-13422' 120' 3988' 8483' 8362-9363' 12300'-12350', 12640'-12670',12688'-12704', 12748'-12772' truevertical 8684'-8715, 8890'-8908', 8919'-8929', 8955'-8970' Tubing (size, grade and measured depth) 2-7/8", L80, 12408' MD, 12611' (TUBING TAIL) PACKERS: 9-5/8" & 5" OD Brown 11753~& 12389' "'Packers'and$SSV'(tYpea~{n~su~edld~' SSSV: Camco "TRDP-1A" 2 12.Attachments Description summary of propos~x[] Detailed operations program [] BOP sketch [] 13. Estimated date for commencing operation 14. If proposal was verbally approved NOVEMBER 2. 1986 Name of approver RUSS DOUGLAS Date approved 10/29/86 15. I hereby certify, that the foregoing is true and_cPrrect to the best of my knowledgf~' Signed _..~~'.Z,t/'~~,,~_F' :~;:Titi:e Lisburne~Op, Coord. · · . . Commission Use Only 10/28/86 Date Conditions of approval Notify commission so representative may witness ' I Approval No. [] Plug integrity ' '[3 BOP Test [] Location clearanceI Commissioner by order of the commission Date Submit in triplicate ATTACHMENT 1 WELL LGI-8 ARCO Alaska, Inc. proposed to conduct the following on Lisburne well number LGI-8: 1. Pre-stimulation test of Wahoo zones 1,2, & 3. 2. Stimulation of Wahoo zones 1,2, and 3 with 140 barrels of 15% HC1 and 500 SCF/B of nitrogen. Acid will be pumped through tubing and flowed back to recover the load and establish flow rate. 3. Production test of Wahoo zones 1, 2, and 3. If oil is not produced, isolation of Wahoo 1,2, and 3 with plug set at 12611' MD. 4. Perforation of Wahoo zone 4 (12390'-12478' and 12506'-12550') with through tubing gun and 4 spf. 5. Pre-stimulation test of Wahoo zone 4. 6. Stimulation of Wahoo zone 4 with 132 barrels of 15% HC1. Acid will be pumped through tubing and the well will be flowed back to recover the load and establish flow rate. 7. Production test of Wahoo zone 4. 8. Static bottom hole pressure survey of well. 9. Pre-stimulation test of Wahoo 4. 10. Stimulation of Wahoo zone 5 with 50 barrels of 15% HC1. Acid will be pumped through tubing and the well will be flowed back to recover the load and establish flow rate. 7. Production test of Wahoo zone 5. 8. Production test of all zones. RECEIVED 1 1986 Alaska Oil & Gas Cons. An~orage Lisburne Engineering To: State of Ak From: Pam Lambert John Boyle Date: 7-25-86 Transmitted herewith are the following: MWD Directional Survey for Lisburne Wells LGI 6 7-1-86 Teleco LGI 8 5-19-86 Teleco Receipt Acknowledgement: Return Receipt to: ARCO Alaska Inc. Pam Lambert ATO 477 PO Box i00360 Anchorage, Alaska 99510 Transmittal No: O~ Lisburne Engineering To: State of Alaska John Boyle From: Pam Lambert Da=e: 7-9-86 Transmitted herewith are =he following: OH Finals for Lisburne Well LGI 8 BHC Acoustilog 5-25-86 Run 1 2"&5" DA Densilog Neutron -Raw 5-25-86 Run 1 2"&5" DA Signature 5-26-86 Run 1 5" DA DuAl Laterolog/Micro Laterolog 5-25-86 Run 1 2"&5" DA Dielectric Log 5-27-86 Run 1 2"&5" DA Densilog Neutron Gamma Ray 5-25-86 Run 1 2"&5" 'DA Caliper Log 5-25-86 Run 1 2"&5" DA Spectralog 5-25-86 Run 1 2"&5" DA Neutron Gamma Ray 9 5/8 casing 5-25-86 Run 1 2"&5" DA Receipt AcknowledsemenC: --7 ~fv t~[~_10 1986 Return Receip~ Co: ARCO Alaska ~a u~ ~ Gas C0[ls. ~0mmissi0" Para Lamberc/~TO 47/F .... An0h0rage Po sox oo 6o / Anchorage, i~t's~ 99510 Transmittal No: U ~l State of Alaska , 2~bU~ne Engineering ~ From: ---'--- Dace: TcansmtCCed herewlch are che following: Magnetic Tape for tisburne Well LGI 8 Depth Shifted 5-25-86 Dresser Atlas ~-~~~ D ~/~ ~ _//~ 91- i~ ~~ Return ReCeipt Co: ARCO Alaska/inc. , & Gas Cons. Commisslo~ .~.~~0~17 Anchorage Transmittal No:~~~aska 995~0 Lisburne Engineering To: State of Alaska From: Pam Lambert Date: June 25, 1986 Transmitted herewith are the following: OH Finals for Lisburne Well LGI 8 RFT 5-27-86 Run 1 Sch CyberlOok 5-28-86 Run 1 Sch DLL/SGR 5-27-86 Run 1 2"&5" Sch ESS 5-28-86 Run 1 2"&5" Sch LDT/CNL(Poro) Run 1 2"&5" Sch 5-27-86 LDT/CNL (Raw) Run 1 2"&5" Sch 5-27-86 Natural GR Spectroscopy Run 1 5-27-86 2"&5" Sch Analog DT from Array Sonic 5-27-86 Run 1 Sch EPT 5-27-86 Run 1 2"&5" Sch Array Sonic 5-28-86 5:' Run 1 Sch LSS/WF 5-28-86 Run 1 Sch CET 5-28-86 Run 1 Sch CNL in 9 5/8 casing 5-28-86 Run 1 Sch Receipt Acknowledgement: k~~...-/~'?~. ~ ' ~i ~z Return Receip= to: ~C~ask~nc. , PO ~0360 Anchoraie, Alas~ 99510 Transmittal No: ~ 7 A Lisburne Engineering To .' St?_te of A!8~8 3ohn _~cy!m ~'rom: Date: Pam Lambert June 24, 1986 Transmitted herewith are the following: Magnetic Tapes for Lisburne Well LGI 8 OH LIS Shifted 5-28-86 Run 1 Tape Number 71505 Sch ~ ~ ~ ~ 3 e' --5 - o,,~ ~ -I01 ~ o .- / ~ I $~o Rec eip t Acknowledgeme Return Receipt to: ARCO Alaska Inc. Pam Lambert ATO 477 PO Box 100360 Anchorage, Alaska 99510 Transmittal No: "I '[~ ARCO Alaska Inc. L£sburne Engineering To: Stage of Alaska John Boyle Date: Pam Lambert June 13, 1986 Transmitted herewith are =he following: Magnetic 'Tape for Lisburne Well LGI #8 OH LIS Unshifted 5-28-86 Run 1 Tape Number. 5-28-86 Sch Receipt Aci~owl~lsment: Return Receipt to: ARCO Alaska Inc. Pam Lambert ATO 477 PO Box 100360 Anchorage, A%aska 99510 Transmittal No: ~~ JUN 1 ? 1986 Alaska Oil & Gas Cons. Commission Anchorage STATE OF ALASKA -- ALASKA ~IL AND GAS CONSERVATION COMMi ,ON APPLICATION FOR SUNDRY APPROVALS feet 1. Type of Request: Abandon [] Suspend ~ Operation Shutdown [~ Re-enter suspended well ~ Alter casing F; Time extension [] Change approved program [] Plugging [] Stimulate ~ Pull tubing ~ Amend order ~ Perforate ~3 Other 2. Name of Operator ARCO Alaska, Inc 3. Address 6. P. O. Box 100360 Anchoraqe, AK 99510 p 4. Location of well at surface 7. 1188' FNL, 1668' FEL, Sec.l, T11N, R14E, UM LCI-8 At top of productive interval 8. Permit number 1320' FNL, 1215' FEL, Sec.31, T12N, R15E, UM (approx.) 86-57 At effective depth 9. APl number 704' FNL, 4328' FWL, Sec.31, T12N, R15E, UM (approx.) 50--029-21562 At total depth 10. Pool 679' FNL, 4357' FWL, Sec.31, T12N, R15E, UM (approx.) Li'sburne Oil 5. Datum elevation (DF or KB) RKB 52 ' Unit or Property name r~dhr~e Ray Ilni t~ Well number Pool 11. Present well condition summary Total depth: measured true vertical feet Effective depth: truemeasuredvertical 1 3375 feet 9334 Casing Length Size Conductor 80 ' 20" Surface 4322 ' 13-3/8" Production 11931 ' 9-5/8" Li net 1 655 ' 7" Perforation depth: measured N° ne true vertical None Tubing (size, grade and measured depth) 13423 feet Plugs (measured) None 9364 feet Junk (measured) None Cemented Measured depth 1700# Poleset 2450 sx AS III & 600 sx Class G 1125 sx Class G 600 sx Class G True Vertical depth 120 'MD 4361 'MD 11 966 'MD 11 767 ' -13422 'MD RECEIVED 120'TVD 3988'TVD 8483'TVD 8362'-9363 N o n e JUN 1 7 ]986 TVD Packers and SSSV (type and measured depth) None Alaska 0tl & ~a~ Cea& C0mml~slo. 12.At.taqh. m¢.ots. Descr[ption summary of proposal [] Detailed operations program [] BOP sketch [] we~ H~s'cor¥ and Addendum (dated 6/9/86) 13. Estimated date for commencing operation December, 1986 14. If proposal was verbally approved Name of approver Date approved 15. I hereby certify that the foregoing is true and correct to the best of my knowledge Signed ~~'~')'~ ~(.,{~I.,A,./ Title Associate Engineer Commission Use Only ( DAM ) SA/065 Conditions of approval Approved by Notify commission so representative may witness [] Plug integrity [] BOP Test J Approval No. [] Location clearance / , by order of Commissioner the commission Date Form 10-403 Rev 12-1-85 Submit in triplicate ARCO Oil and Gas Company Well History - Initial Report- Daily Instructions: Prepare and submit the "Initial Report" on the first Wednesday after a well is spudded or workover operations are started. Daily work prior to spudding should be summarized on the form giving inclusive dates only. District Field Alaska ICounty, parish or borough North Slope Borough Lease or Unit ADL #34628 Title Drill & Complete IState Prudhoe Bay Auth. or W,O. no. AFE AL0052 Alaska lWell no. LGI-8 Rowan t;41 API 50-029-21562 Operator IARCO W.I. ARCO Alaska, Inc. 50% Spudded or W.O. begUnspud IDate 5/03/86 I'°ur 1130 Hrs. IPri°rstatusifaW'O' Date and depth as of 8:00 a.m, 5/03/86 thru 5/05/86 5/06/86 5/07/86 5/08/86 5/09/86 The above is correct For form preparation and distribution, see Procedures Manual, Section 10, Drilling, Pages 86 and 87. Complete record for each day reported 20" @ 120' 3207', (3051'), DD Wt. 9.4, PV 8, YP 44, PH 9.7, WL 22, Sol 8 Accept ri~ @ 0900 hrs, 5/3/86. NU diverter sys. Spud well @ 1130 hrs, 5/3/86. Drl 17½" hole to 2100', DD & surv to 3207'. 2249', 7.4°, N44E, 2248.59 TVD, 9.60 VS, 6.91N, 6.67E 2557', 13.9°, N44.7E, 2551.09 TVD, 66.59 VS, 46.19N, 48.00E 2927', 22.8°, N48.5E, 2901.85 TVD, 183.11VS, 126.26N, 132.71E 20" @ 120' 4102,, (895'), Repair'main breaker on draw wrks Wt. 9.5, PV 5, YP 47, PH 9.3, WL 21, Sol 8.5 Drl & surv 17½" hole to 4102'. 3233', 28.4°, N40.4E, 3177.63 TVD, 315.06 VS, 218.50N, 227.40E 3603', 37.0°, N38.7E, 3489.47 TVD, 511.69 VS, 373.56N, 351.29E 3907', 47.7°, N40.8E, 3714.56 TVD, 714.38 VS, 530.14N, 481.54E 13-3/8" @ 4361' 4370', (268'), Cut off lnd'g jt Wt. 9.8, PV 5, YP 43, PH 9.2, WL 24, Sol 9.5 Drl 17½" hole to 4370', CBU, POOH. RU & rn 107 its, 13-3/8", 72#, L-80 BTC csg w/FC @ 4280', FS @ 43~1'. Cmt w/2450 sx AS III, followed by 600 sx C1 "G" w/2% CaC1o. Displ using rig pmps, bump plug. CIP @ 0245 hrs, 5/7/86.~ ND diverter. 4325', 54.8°, N40.1E, 3966.63 TVD, 1045.96 VS, 782.58N, 698.88E 13-3/8" @ 4361' 4577', (207'), Drlg 12¼" hole 8.3 ppg Wtr NU & tst BOPE. RIH, DO flt equip & cmt + 10' new formation. Conduct formation tst to 12.5 ppg EMW. Drl & surv 12¼" hole to 4577'. 4577', 53.8°, N41.1E, 4113.68 TVD, 1249.88 VS, 937.96N, 832.05E 13-3/8" @ 4361' 5634', (1057'), Drlg 12¼" hole Wt. 9.0, PV 4, YP 12, PH 10.8, WL 25, Sol 5 Drl & surv 12¼" hole to 5634'. 4947' 54.4° N42.8E, 4330.64 TVD, 1549 14 VS, 1160 86N, 1032 40E ' 9 · · · 5439', 53.2°, N42.9E, 4621.21TVD, 1945.60 VS, 1451.92N, 1302.40E RECEIVED JUN 1 7 1986 Alaska 0il & Gas Cons. C0mmjssJ0n [Date 6 / 11/86 ] Title Drilling Supervisor Anchorage ARCO Oil and Gas Company Daily Well History--Interim Instructions: This form is used during drilling or workover operations. If testing, coring, or perforating, show formation name in describing work performed. Number all drill stem tests sequentially. Attach description Of all cores. Work performed by Producing Section will be reported on "Interim" sheets until final completion. Report official or representative test on "Final" form. 1) Submit "Interim" sheets when filled out but not less frequently than every 30 days, or (2) on Wednesday of the week in which oil string is set. Submit weekly for workovers and following setting of oil string until completion. District JCounty or Parish I State Alaska North Slope Borough Field JLease or Unit #34628 I Complete record for each day while drilling or workover in progress Prudhoe Bay Date and deptl~ as of 8:00 a.m. 5/10/86 thru 5/12/86 5/13/86 5/14/86 5/15/86 5/16/86 Alaska JWell no. LGI-8 13-3/8" @ 4361' 8860', (3226'), DD Wt. 9.3, PV 4, YP 7, PH 9.3, WL 14, Sol 7 Drl & surv 12¼" hole to 8860'. 5713', 52.3°, N43.3E, 4787 TVD, 2163.48 VS, 1611.17N, 1451.49E 6360', 53.2°, N44.7E, 5179 TVD, 2677.77 VS, 1981.99N, 1808.10E 7097', 54.9°, N47.8E, 5613 TVD, 3272.73 VS, 2394.11N, 2237.56E 7464', 56°, N49.0E, 5821TVD, 3574.56 VS, 2594.79N, 2463.59E 8218', 54.8°, N48.8E, 6251TVD, 4193.34 VS, 2999.85N, 2923.64E 8717', 52.3°, N48.8E, 6546 TVD, 4594.89 VS, 3264.94N, 3234.91E 13-3/8" @ 4361' 9356', (496'), RIH Wt. 9.3, PV 6, YP 8, PH 10.2, WL 10.6, Sol 7 Drl & surv 12¼" hole to 9356'. 9081', 50.5°, N47.1E, 6774 TVD, 4879.20 VS, 3455.49N, 3445.97E 9301', 50.3°, N43.6E, 6914 TVD, 5048.57 VS, 3574.60N, 3566.55E 13-3/8" @ 4361' 9878', (522'), Drlg Wt. 9.3, PV 5, YP 6, PH 11.9, WL 15, Sol 7 Drl & surv 12¼" hole to 9878'. 9558', 53.9°, N44.7E, 7072 TVD, 5251.28 VS, 3720.08N, 3707.78E 9808', 58.6°, N46.4E, 7210 TVD, 5459.09 VS, 3865.60N, 3856.12E 13-3/8" @ 4361' 10,845', (967'), POOH f/BHA chg Wt. 9.4, ?V 5, YP 9, PH 11.7, WL 10.4, Sol 7.5 Drl & surv 12¼" hole to 10,845'. 10,180', 57.9°, N46.1E, 7406.75 TVD, 5775.54 VS, 4084.34N, 4084.60E 10,805', 52.3°, N50.3E, 7763.56 TVD, 6287.75 VS, 4432.18N, 4461.28E The above is correct For form preparation and distribution see Procedures Manual Section 10, Drilling, Pages 86 and 87 13-3/8" @ 4361' 11,456', (611'), Drlg Wt. 9.6, PV 10, YP 7, PH 11.4, WL 5.8, Sol 8.5 Drl & surv 12¼" hole to 11,456'. 11,154', 51.2°, N49.2E, 7979.63 TVD, 6561.37 VS, 4609.26N, 4670.46E 11,338', 50.5°, N49.9E, 8096.04 TVD, 6703.52 VS, 4701.70N, 4778.89E Drilling Supervisor D rEIVED IDate ITitle 6/11/86 JUN 1 7 1986 Alaska 011 & Gas Cons. Commission Anchorage ARCO Oil and Gas Company Uaily Well History--Interim Instructions: This form is used during drilling or workover operations. If testing, coring, or perforating, show formation name in describing work performed. Number all drill stem tests sequentially. Attach description- of all cores. Work performed by Producing Section will be reported on "Interim" sheets until final completion. Report official or representative test on "Final" form. 1) Submit "Interim" sheets when filled out but not less frequently than every 30 days, or (2) on Wednesday of the week in which oil string is set. Submit weekly for workovers and following setting of oil strin~ until completion. District Alaska North Slope Borough I County or Parish Field ILease or Unit Prudhoe Bay I ADL #34628 Date and depth Complete record for each day while drilling or workover in progress as of 8:00 a.m. IState Alaska IWell no. LGI-8 5/17/86 thru 5/19/86 5/20/86 5/21/86 5/22/86 5/23/86 5/24/86 thru 5/27/86 5/28/86 9-5/8" @ 11,966' 11,972', (516'), Drl cmt Wt. 9.8, PV 11, YP 7, PH 10.4, WL 5.6, Sol 9.5 Drl & surv 12¼" hole to 11,972', 25 std short trip, CBU, POOH. RU & rn 282 its, 47#, L-80 BTC & NS-CC csg w/FC @ 11,883', FS @ 11,966. Cmt w/150 sx 50/50 Pozz Cl "G" & 975 sx Cl "G" w/1.5 gal/sx D-600, .05 gal/sx M-45, .06 gal/sx E-2009, .3% D-65 & .1% D-133. CI? @ 1300 hrs, 5/18/86. ND BOPE. NU tbg spool. NU & tst BOPE. RIH w/8½" BHA, tst csg to 3500 psi. Drl cmt & flt equip. 11,525', 49.5°, N48.5E, 8215.99 TVD, 6846.83 VS, 4795.43N, 4887.48E 11,922', 56°, N49.3E, 8456.16 TVD, 7162.32 VS, 5003.17N, 5125.42E 9-5/8" @ 11,966' 12,384', (412'), Drlg Wt. 9.4, PV 8, YP 5, PH 10.7, WL 9.8, Sol 7 Drl cmt & flt equip + 10' new hole. Conduct formation tst to 12.5 ppg EMW. Drl 8½" hole to 12,384'. 9-5/8" @ 11,966' 12,585', (201'), Drlg Wt. 9.4, PV 8, YP 6, PH 11.6, WL 5.8, Sol 7 Drl & surv 8½" hole to 12,585'. 9-5/8" @ 11,966' 12,878', (293'), Short trip Wt. 9.4, PV 8, YP 5, PH 10.8, WL 6.6, Sol 7 Drl 8½" hole to 12,878'. 9-5/8" @ 11,966' 13,047', (169'), Drlg Wt. 9.4, PV 8, YP 6, PH 10.3, WL 6.6, Sol 7 Drl 8½" hole to 13,047'. 9-5/8" @ 11,966' 13,423', (396'), Logging Wt. 9.4, PV 8, YP 5, PH 11.9, WL 7.6, Sol 6 Drl 8~" , , 2 hole to 13 423' TD, CBU short trip. RIH, rm 11,966'-12,261', CBU, spot LCM pill, POOH to log. RU DA, rn DLL/MLL/SL/GR, FDC/CNL/GR/CAL/ Accoustilog & Accoustilog/GR. RD DA. RIH, wsh fill f/13,332'-13,423', C&C, POOH. RU DA, rn GR/PCM/DIL f/13,205'. 9-5/8" @ 11,966' 13,423', (0'), Logging Wt. 9.4, PV 7, YP 5, PH 11.8, WL 8.0, Sol 6 RU Schl, log DLL/SDT/NGT, LDT/EPT/CNL/GR/CAL, LSS/GR/Waveform. RFT's. Prep to rn The above is correct IDate ITitle 6/11/86 For form preparation and distribution see Procedures Manual Section 10, Drilling, Pages 86 and 87' Drilling Supervisor RECEIVED JUN 1 7 1986 Alaska 0il & Gas Cons, Commission Anchorage ARCO Oil and Gas Company Daily Well History-Final Report Instructions: Prepare and submit the "Final Report" on the first Wednesday after allowable has been assigned or well is Plugged, Abandoned, or Sold. "Final Report" should be submitted also when operations are suspended for an indefinite or appreciable length of time. On workovers when an official test is not required upon completion, report completion and representative test data in blocks provided. The "Final Report" form may be used for reporting the entire operation if space is available. Accounting District ICounty or Parish I State Alaska North Slope Borough Field ILease or Unit Prudhoe Bay I .ADL #34628 Auth. or W.O. no. I Title AFE AL0052 I Drill & Complete Rowan #41 Operator A.R.Co. W.I. ARCO Alaska, Inc. 50% Spudded or W.O. begun Date Spud 5/03/86 cost center code Alaska IWell no. LGI-8 Date and depth as of 8:00 a.m. 5/29/86 5/30/86 5/31/86 thru 6/02/86 API 50-029-21562 I otal number of wells (active or inactive) on this cst center prior to plugging and bandonment of this well our I Prior status if a W,O, I 1130 Hrs. Complete record for each day reported 9-5/8" @ 11,966' 13,423', (0'), CBU Wt. 9.4, PV 6, YP 4, PH 11.0, WL 8.4, Sol 6 Fin rn'g LSS/GR/Waveform f/13,168'-11,950'. f/11,940'-8993'. RIH to cond hole f/csg. Rn RFT's. Rn CET RECEIVED 7" @ 13,422' 13,423', (0'), POOH wet JUN1 7 1986 Wt. 9.4, PV 10, YP 4, PH 10.8, W-L 6.8, Sol 6 CBU. Rn 38 its, 7", L-80, 29# BTC csg w/LC @ 13,246', FC @ 13,375' FS @ 13,422', TOL @ 11,767'. Cmt lnr w/600 sx 35/65 Pozz C1 "G" cmt; CIP @ 0435 hrs, 5/30/86. POH. 7" @ 13,422' 13,375' PBTD, RR 9.4 NaCl brine w/400' diesel cap POOH. RIH w/8½" bit/9-5/8" csg scrpr, wsh 10,883'-11,377', drl cmt to 11,753' TOL, CBU, POOH. RIH w/6" bit & 7" csg scrpr, CO 7" lnr. DO LC & cmt to 13,375'. Tst csg to 3000 psi. Displ well to 9.4 ppg NaC1 brine, POOH, LD DP. ND BOPE, NU tree & tst to 5000 psi. RR @ 1830 hrs, 6/1/86. Old TD New TD PB Depth 13,423' 13,375' Released rig Date Kind of rig 1830 Hrs. 6/1/86 Rotary Classifications (oil, gas, etc.) Type completion (single, dual, etc.) Oil Single Producing method Official reservoir name(s) Flowing Lisburne Potential test data Well no. Date Reservoir Producing Interval Oil or gas,Test time Production Oil on test Gas per day ,.. _ Pump size, SPM X length Choke size T.P. C.P. Water % iGOR Gravity Allowable Effective date corrected The above is correct _ _ Date JTitle For form preparation and distribution, see Procedures Manual, Section 10, Drilling, Pages 86 and 87. Drilling Supervisor ADDENDUM WELL: 6/04/86 LGI-8 Rn CBT/VDL/GR/CCL f/13,357'-11,100' w/1000 psi. f/surf-13,302'. Rn gyro Drilling Supervisor RECEIVED JUN 1 7 1986 Alaska 0il & Gas Cons. Commission Anchorage ~/~1~ Date ,MEMORANPUM State of Alaska TO: C.v.fC~~t~on DATE: May 15, 1986 Chai~~' ---'~ FILE NO.: D.BDF. 40 THRU: FROM: Lonnie C.. Smith_.~-; ;.~.;~: f~ .... TELEPHONE NO.: Commissioner '~ ~'~~ SUBJECT: Bobby D. Foster Petroleum Inspector BOP Test ARCO PBU LGI #8 Permit ~86-57 Lisburne Oil Pool Wednesday, ~[ay 7, 1986: ~-6-nCi~de~-at'7: 30 p ~'i were no failures, The BOP test began at 5:30 p.m. and was As the attached BOP test report shows, there In summary, I witnessed the BOP test on ARCO's LGI #8. STATE OF ALASKA ALASKA OIL & GAS CONSERVATION COPLMISSION B.O.P.E. Inspection Report Date Location, Oenerai fP K Weii Sig~I}~i ACCt,~nn. ATO~, S~STn~ General Housekeeping,. O~ Rig ~//~ Reserve Pit ~3// Mud Systems Visual Audio Trip Tank Pit Gauge ~'~ Flow Monitor Gas Detectors · BOPE Stack Annular Preventer Pipe Rams Blind Rams Choke Line Valves H.C.K. Valve Kill Line Valves Check Valve Test Pressure Full Charge Pressure ~~ psig Pressure After Closure /V~,, psig Pump incr. clos. pres. 200 psig -- min~_._~-sec. Full Charge Pressure Attained:. ~__~ min~ec. Controls: Master ~~ ~ Remote ~ Blinds switch cover~~ Kelly and Floor Safety Valves ' Upper Kelly , / Test Pressure, Lower Kelly / Test Pressure, Ball Type / Test Pressure Inside BOP / Test Pressure Choke Manifold ~~ Test Pressure No. Valves No. flanges Adjustable Chokes I /- 1~. Hvdrauica!l¥ ooerated choke / Test Results: Failures ~ Test Time ~ hrs. Repair or Replacement of failed equipment to be made within .... day~ and inspector/ o Commission office notified. Remarks: Distribution orig. - AO&GCC cc - Operator cc - Supervisor March 10, 1986 Mr. T. P. Oostermeyer Regional Drilling Engineer ARCO Alaska, Inc. P. O. Box 100360 Anchorage, Alaska 995]. 0-0360 Telecopy: (907) 276-7542 Re: Prudhoe Bay Unit LGI-8 ARCO Alaska, Inc. Permit No. 86-57 Sur. Loc. !188-'FNL, !668'FEL, Sec. 1, TllN, R14E, UM. Btmhole Loc. 492'FNL, 359'FEL, Sec. 31, T12N, R15E, UM. Dear Mr. Oostermeyer: Enclosed is the approved application for permit to drill the above referenced well. The permit to drill does not indemnify you from the probable need to obtain additional permits required by law from other governmental agencies prior to commencing operations at the well site. To aid us in scheduling field work, please notify this office 24 hours prior to commencing installation of the blowout prevention equipment so that a representative of the Commission may be present to witness'testing of the equipment before the surface casing shoe is drilled, t~here a diverter system is required, please also notify this office 24 hours prior to commencing equipment installation so that the Commission may witness testing before drilling below the shoe of the conductor pipe. C.V. :erton Chairman of Alaska Oil and Gas Conservation Commission BY ORDER OF ~E COMMISSION dlf Enclosure CC: Department of Fish & Game, Habitat Section w/o enc!. Department of Environmental Conservation w/o enc!. Mr. Doug L. Lowery DRILL [~[}X lb. Type of well EXPLORATORY [] SERVICE REDRILL D DEVELOPMENT OIL ~ SINGLE ZONE DEEPEN ~ DEVELOPMENT GAS ~ MULTIPLE ZONE ~ ~A¢~JECTOR la. Type of work. 2. Name of operator ARCO Alaska, Inc. 3. Address P. 0. Box 100360, Anchorage, Alaska 99510 4. Location of well at surface 1188' FNL, 1668' FEL, Sec.1, T11N, R14E, UM At top of proposed producing interval At Target ~ 8552'TVD:1320'FNL, 1215' FEL, Sec.31, T12N, R15E, UN At total depth 492' FNL, 359' FEL, Sec.31, T12N, R15E, UM 5. Elevation in feet (indicate KB, DF etc.) 6. Lease designation and serial no. RKB 52', PAD 13' ADL 34628 ALK 863 12. Bond information (see 20 AAC 25.025) Federal Insurance Company Type Statewide Surety and/or number #8088-26-27 9. Unit or lease name Prudhoe Bay Unit/Lisburne 10. Well number LG I -8 11. Field and pool Prudhoe Bay Field Lisburne 0il Pool Amount $500,000 13. Distance and direction from nearest town 9-1/2 mi. N of Deadhorse miles 16. Proposed depth (MD & TVD) 13652 'MD, 9400 ' TVD t 17. Number of acres in lease feet 2462 19. If deviated (see 20 AAC 25.050) 14. Distance to nearest property or lease line 5198 'MD/4498 'TVD/O '~5949 '/4934TVD 20. Anticipated pressures 15. Distance to nearest drilling or completed LGI-12 103' (~ 2656'MD/2651'TVDfeet 18. Approximate spud date 4/16/86 3420 psig@_40°F Surface KICK OFF POINT 2100 SIZE Hole 0" 7-1/2"/ 7-1/2" I 2-1/4" / 8-1/2" I feet. MAXIMUM HOLE ANGLE54.6 o I (see 20 AAC 25.035 (c) (2) 4490 psig@ 8952 ft. TD (TVD) Casing Weight 20" 91 .5# 13-3/8" 68.0# 13-3/8" 72.0# 9-5/8" 47.0# 7" 29.0# Proposed Casing, Liner and Cementing Program CASING AND LINER Grade CouplingI Length H-40 Wel ~ 80 ' K-55 BTC/ 70 ' L-80 BTC1 4230' L-80 BTC/ 12099 ' L-80 BTC~ 1816' SETTING DEPTH MD TOP TVD 39' I 39' 39' I 39' 109 ' I 109 ' 37' I 37' 11836' I 8348' MD BOTTOM TVD 119' I 119' 109' 109' 4339' 14000' 12136' 18522' 13652' 9400' QUANTITY OF C'EMENT (include stage data) 2000# Poleset 1890 sx AS Ill & 600 sx Class G Tail 560"G"/300AS I&ArcPack 340sx65%"G"-35%Poz 22. Describe proposed program: AR60 Alaska, Inc., proposes to drill this Lisburne gas injection well to approximately 13,652'MD (9400'TVD). is planned as a Lisburne gas injection well in the Wahoo formation. It A surface diverter will be installed and operationally tested prior to spud. A 13-5/8", 5000 psi, RSRRA BOPE stack will be installed on the 13-3/8" surface pipe. It will be tested to 5000 psi (3000 psi for annular) upon installation and weekly thereafter. We plan to set 9-5/8" casing just above the Wahoo and a 7" liner across the Wahoo production interval. Selected intervals will be logged. A string of 5-1/2", 17.0#, L-80, EUE, 8rd AB-MOD tubing, including provisions for subsurface safety equipment, will be run with the packer set above the Wahoo. Selected intervals in the Wahoo gas cap will be perforated and reported on subsequent reports. Perforated zones will be production tested prior to beginning gas injection. · 23. I hereby certify that the~reg_oing is true and correct to the best of my knowledge SIGNED .%/~/. ~~~/~- TITLE Regional Drilling E ngr. The space below for Commission use / CONDITIONS OF APPROVAL Samples required ; ko Permit number APPROVED BY Mud log required E~YES /~O Directional Survey required ~YES [~]NO APl number 5o-~zq- 2. i Approval date f~.~~.~.,,'~ ,,_,, _ 03,/1,,0186 Form 10401 ~P~/PD239 / ~ Submit in triplicate SEE COVER LETTER FOR OTHER REQUIREMENTS ,COMMISSIONER DATE March 10, 1986 by order of the Commission PERMIT TO DRILL LGI-8 (cont'd) Non-freezing fluid will be left in all uncemented annuli within the permafrost interval. Reserve pit fluids will be disposed of down the 9-5/8" x 13-3/8" annulus of this well prior to Arctic Pack operations (approx 130 bbls Arctic Pack on top of 300 sx Arctic Set I cement). That annulus will be left with a non-freezing fluid during any extended interruption in the disposal process. The maximum anticipated surface pressure of 3420 psig ~ 40°F was calculated from the Wahoo datum pressure of 4490 psig ~ 8952'TVD and 183°F. It assumes a 300' oil column to 8652'TVD and a gas column from there to surface, gas temperature and compressibility effects considered. A similar calculation, assuming a full gas column and original reservoir pressure in the Sadlerochit Sand @ 8077'TVD, yields a maximum surface pressure of 3359 psig @ 40°F. Such surface pressures could occur only if 9-5/8" casing had been set. With 13-3/8" casing set ~ 4000'TVD, the maximum anticipated surface pressure is ~4.40 psig, based on a 13.7 ppg EMW pump-in gradient at the shoe and a gas column to surface. Our formation leak-off test history, for surface pipe set at similar depth, shows a 11.5 to 13.7 ppg EMW pump-in gradient just below the casing shoe. LGI-8 is 120' from LGI-12 at the surface. The planned well course for LGI-8 passes 103' from the LGI-12 planned well course at 2656'MD/2651'TVD (LGI-8 depths). The two wells diverge rapidly below this point. There are no other wells within 200' of the planned LGI-8 wellbore. West Beach State #1 is the next nearest existing well to LGI-8. The closest pass between LGI-8 and West Beach State #1 is 2286' at 11,045'MD/7889'TVD (LGI-8 measurements). RECEIVED MAR 0 1986 Alaska Oil & Ga~ Cons. Commission LGI-~ 0 0 1000 2000 3000 4000 5000 6000 7000 ~000 9000 10000 tO00 2000 3000 4000 SO00 8000 7000 80CO 90CO riO00 0 CONDqCTOR TVD , ARC,::) AL/ ,SKA, INC. m 2.5 $HL:1188 FNL 1588F~L 12.5 SEC. 1 'llN R14E UM 1'7.5 THL: 132CI FNL 1215' F 52. > 27.5 4-2.5 ,*7.5 52.5 lOC TVD =13967 MD =, 4282 DEP = 963 [ ~ ~4 OEG 33 MIN ~-10 TVO =~177 MD =9817 OEP" 5472 ~ ~ ~ K-5 TVD = 7702 MD 107:~2 DEP--6~og ~ ~ '~ LCU TVD ~ G077 ,MO = 113G~ DER - ~- ~-~6 ~ / ~ SADLER~CHIT TVDI- 8077 MEt-- 1138g ~EP = 6736 ~ I KAVIK~'VO -- 8447 MD = 12~07 OEP - ,255 ~ g-$/8" CASIN~ TVO ~22 MD ~136 OEP -, 7361 J WAHOO 7 TVD El552 MD ~2188 DEP ~ 7403 ' = :OCCC i000 2000 3000 4000 50'00 60'00 7000 VERT]:C~,L SECTION 8000 9000 0 1986 Alaska Oil & Ga:; Co!m, Commt~mon 1CO0 2000 4000 5CCC 9088 iOCCO o - 1000 0 o o o 0 c~ cz] cs) CS) z E - N COORDINRTES 0 1000 2000 3000 ~JO00 5000 BO00 7000 8000 9000 .~HI' 11RR' :NI l~flR FFI SEC. 1T1 4R14EUM THL: 1320' :NL 1215' FEI SEC. 31 'l 2N R15E UM / / Lg I -- 8~// T ARGE1 ~ TVD = i ~62' IMO ~ 188' 7~J DEP = 7 03' N 5148 ........ E 5320 , 3573 - 1000 0 1000 2000 3000 't000 5000 15000 7000 8000 9000 f-' I,,I I"f-if-/Fe['~l I IxI['tT[''c:, o -1000 1000 2000 E - bi COORDINATES ~3000 4000 5000 6000 7000 8000 9OOO CZ) ' m 8 3552 73 t i i i ~ ~ , i , , , , ~ i ~ i , , , i , , , , , i i , i i , , , , , i ~ , , , , , , , i i , i , , , ~ , i , , , , , , , , , , , , , , , , , , , , , , ~ , , , , , , , , , , , , , - 1000 0 1000 2000 5000 ~000 5000 6000 7000 8000 90UO E -- N COORDINATES E - i~ 'SO on - -200 - O0 0 I O0 200 30~-~ 400 500 606 ,, , _ /~789 72¢ i' 3~~95'~ ;573 .. 3277 · ~289 596 -200 - 1 O0 0 I O0 200 300 400 500 600 E - N COORSINR~ES RECEIVED . ? SURFACE HOLE D IVERTER SYSTEM SCHEMATIC ARCO ALASKA INC'. ..~ I0" HYD. OPR. BAI_.L VALVE J F ~LL eo~e I SEE DE'fAIL ! / ,,/"F IO" HYD. OPR. BALL VALVE / // I ALL 90' IURNS ARE "TEE" ~LL RESERVE. PIT AREA NOTE' FL~ INE DR ILL lNG R ! SER F L 20" 20O0 PSl 'AP ANNULAR PREVENTOR ,/ '""! ,..ri , I RTER LINE ~_] l~ Valves on diverter lines open automati- cally ~hen the annular preventer is closed. 20' 3ONDUCTOR PIPE IO' HYDRAULIC OPERATED BALL VALVES "DETAIL" 2026010203 BLIND SPOOL 13-5/8" BOP STACX D~ ~:. ~,~,la:or Ca~aci~ Tes: 1. Ch~r_k ~ fill accumAla:or reservoir level ~ ~~ic ~. 2. ~s~e ~: ~,]a:or ~ss~e 1500 psi ~:~ of ~ reda:or. ~. ~e t~, ~n close all all ~:s ~ clos~ ~ ~rg~ is A5 s~ clos~g :~ ~ 1200 psi press~. 1. Fill BOP s:ack an~ manifold wish a non-free:lng 2. Check r. has ali hold cbm~n screws are fully resracsed. Mark rura~ing joirm wi:h prede:ermxne~ plug sea:lng c~epth. Run :es: plug on dmill pipe ~ sea: :n wellhemi. Run in lock d~wn screws. 3. Close atmular preventer ami ups:ream valves. ~.. ~-:i~ly res: c, ho~s. · 5. -In each of r. he follo~rL~g :es:, firs: hold a 250 psi lo~ pressure :es: for a minAm~ of 3 re.inures, r. ben :es: at the high pressure. 6. Increase pressure to 3000 psi ami hold for a ~ of 3 ammmes. Slee~ pressure :o zero. ?. O~en am~m~ar prevetmer an~ close lop se: of pipe rams. Increase pressure :o 5000 psi a~ hold for a: leas: 3 mirmmes. Bleed pressure :o leto. 8. Close valves direc:l¥ ups:ream of chokes ar~ open choke~. Ira:tease pressure :o 5000 psi ami hold for a: leas: 3 mimutes. Bleed pressure :o :ero. 9. Open top se: o£ pipe rams :hen close hot:mm se: of pipe rams. Lncre~se pressure :o 5000 psi below :he bo::c~ se: of pipe rams ar~ hold for a: leas: 3 m_in- ~rtes. Tes: reamining un:es:ed manifold valves (i£ any.) w~r.h 5000 psi ups:ream of valve ~ zero pressure ~owns:ream. Bleed pressure :o zero. Open bot::m se: of pipe Back off runn~g join: an~ pull ou: of hole. Close blLr~ rams a~ :es: :o 5000 psi for at leas: ~ mxnu:es. Blee~ pressure off all e~.ipmen:. Open blin~ rams. Make sure marigold aru~ lines are ~ull of non- freezing liqu4d ami all valves are se: Ln &tilling position. Tes: s:ar~pipe valves :o 5000 psi. Tes: Kelly cocas an~ inside BOP :o 5000 ps~ ~rzr. h Check opera:ion of Degasser. Recor~ :es: LnA~ormation on blc~x~t prevermer :es: form. Sign a~ ser~ :o Drilling Supervisor. Per~o~ cmmplete ~ res: once a ~eek ar~ func- :iomally opera:e ~OP~ daily. 10. 1I. I2. 13. 14. 15. 16. 17. 18. Reviseci 2121/8a ARCO Alaska, Inc. Post Office Box 100360 Anchorage, Alaska 99510-0360 Telephone 907 276 1215 February 11, 1986 Mr. C. V. Chatterton Commi ssi oner State of Alaska Alaska Oil & Gas Conservation Commission 3001 Porcupine Drive Anchorage, AK 99501 SUBJECT: Conductor As-Built Location Plat - LGI Pad (Wells 2, 4, 6, 8, 10, 12, 14, 16) Dear Mr. Chatterton' Enclosed is an as-built location plat for the subject wells. you have any questions, please call me at 263-4944. Sincerely, Gruber Associate Engineer JG/tw GRU13/L91 Enclosure If ARCO Alaska, inc. is a Subsidiary of AtlanticRichlieldCompany , ~LaN[ PIT ' I · ~ ~ (V~cm~ ~p) ~'~'CO''LISBURNE' F~CILI~IES ~JEcT ~::~ ~ & · (~,~,Z.Sm.) ~. ~ SEC. I~TIIN,RI4E, UM.,AK ~l '!: ~ 4 · ~ NOTES- L__J ~ ~ ~ ~ I.STATE P~NE COORDINATES ARE ~ ' ' /~--- ,7~5.oo ~ALL GEt,lC ~SIT~S ARE // // ~SED ON NAD 1~27. // // 5.~FSETS TO SECTION LINES ARE C~- // PUTED B~ED ~ ~OTRACTED VALUES OF THE / SECTION CORNER POSITIONS. . 4. PLANT CO~DI~TES ~ ~R ~/~AUN DIG, CED 4~7-17212~ Slit ~1, REV. I. i I I II I II II II II I I II ii I LOCATION N SECTION STAT[ PLANE COORDINATES GEODETIC ~SITiON .. A/B PLANT. COORDINATES ......, WELL F.N. L~N[ ~F.[. LINE NORTHING IEASTING LATITU~ (~ L~*TUDE (Il NORTH EAST , 2 . 1J65 l~32 S976~.S3 6~734.6~ 70-~t~.6~, 148;~36.823" ~.01 6487.58 4 L3~ 1.644 5~63$S.~ 6~2[.[3 70-~24.~ [48' ~ ~7 .17 4" 8[~.09 6487.S8 5 ].247 [6~ 597~13~ 6~7~.4[ 70'~24.~g" [~37.5~ ~.0[ 6487.33 8 1188 1668 sg7~[.~ 6~.~ 70'~'25.418" 148'~'37.~8" ~0.07 6487.50 10 112~ 16~ 5975S30.3S 5~.60 70'~'25.~" 148' ~ '38.228" ~.01 6487.52 12 1070 1692 S97&S~.~ 6~67.07 70' ~'~.S75" 14 lOIZ 1704 597~.~ 5~53.S7 70'~'27.15~ 148'~'38.931" ~40.~ 6487.48 16 ~3 1716 59757~.72 ~40.08 70'~'~.730" 148'~'39.282" ~.Ol 6487.49 i i II I I II I I II I I I I RE~ISTE~E~ AND L~CE~SED TO P~CTtCE ~.~ LAND SURVEYING iN THE STATE OF ALASKA PRESENTS ~ COCAT)ON SURVEY ~DE ~Y ~E OR UNDER ~Y SUPERVISION, AND THAT ALL DI~ENStONS AND OTHER DETAILS ARE CORRECT, LGI PAD r ~-'-,. ,..,~'~.-'. SURVEYED FOR' , ' · , , ,, D,TEL I ,/24/86 SC4LE: 1'=400' FRB -ANCH FB-8~2 ITEM APPROVE DATE (2 thru 8) '(8) ' ' : (9 thru 12) _ . 10. (10 and lf) / 12. (5) BOPE (6) Add: tease & Wel, Nop~ ~, YES NO · REMARKS 1 Is th permit f ch d ' ~K . e ee atta e ............. .. ........................ .. 2. Is well to be located in a defined pool ............................. ~ , 3. Is well located proper distance from property line .................. ,?fA(._ , ...... 4. Is well located proper distance from other wells .................... /~a~ 5. Is sufficient undedicated acreage available in this pool ............ ~M 6. Is well to be deviated and is wellbore plat included ................ ._~fr~ 7. Is operator the only affected party ................................. .~/~ , 8. Can permit be approved before ten-day wait .......................... ~ .... Does operator have a bond in force .................................. ~< , Is conservation order needed' a eeeeeee~eeeeeeeeeeeeleeeeeeeeee~eeeeee Is administrative approval needed ................................... Is the lease number appropriate ..................................... 13. 14. 15. 16. 17. 18. 19. 20. 21. Is conductor ~tring provided .... ,,,,,,,,,,,,,,,.,,.,,,, ....... , ..... Is enough cement used to circulate on conductor and surface ......... Will cement tie in surface and intermediate or production strings ... ~zf~ Will cement cover all known productive horizons ................. Will surface casing protect fresh water zones ................... Will all casing give adequate safety in collapse, tension and burst.. Is this well to be kicked off from an existing wellbore............. Is old wellbore abandonment procedure included on 10-403 ............ Is adequate wellbore separation proposed ............................ 22. 23. 24. 25. 26. 27. Is a dtverter system required ................................. Are necessary diagrams of diverter and ~ eq~:pme~t attached . Does BOPE have sufficient pressure rating - Test to ~'~ psig .. ~ ' Does the choke manifold comply w/API RP-53 (Feb.78) .................. Is the presence of H2S gas probable ................................. Additional requirements .......................... ................... ff~.~/' ; Ceo logy: Engip~eY~ing: WVA L~frM--: -0 - HJH JAL ~ / rev: 03/13/85 6.011 ...... INITIAL" CEO.~ "UNIT Off?OFF POOL CLASS STATUS AREA NO. SHORE Well History File APPENDIX Information of detailed nature that is not particularly germane to the Well Permitting Process but is part of the history, file. To improve the readability of the Well History file and to simplify finding information, information of this nature is accumulated at the end of the file under APPENDIX. No special effort has been made to chronologically organize this category of information. ~'! :N ~ ~ C 0 ~,1 T E N T S PO3L ~ N: ~t C 0 :'41 f '~ T $ =i=tg =lTL"3 J ~ i T JNIT ryp= 003 O0n 033 TYP~ 300 900 JO0 0 0 005 002 SiZE 055 055 06:..5 ;~PT S~2qiAL ND: 3~{,)Td, -DRILLER : 1:,~23., .O= C~Si,,,, -]:"ILl,- _F~. : Ii94x~.¢.0 F DE~T~-L]S:3ER : 13171.0 = C~$1NS-LDgSER = 11:~50.3 = ~Tq. L]3 iNTeRVaL= 1315~.0 : S~SiNS = 9.S25 " FJP L]] iNTERVaL: 119{3.0 = W;~I:$:!r ~F.O L~/= ~ -- S ? J-~ ~ ~ R ~ZTTqT-SSED 5Y: SC Pr<U3q 3E 5~Y ~J~!~C'~':Zq/~qlYa f S!-Z,~SKZ/DbJCET fATRIX : L! EST3NE 1Drl'~ : 2,?I S/S3 -'LJIO ~ WSZTY = !,0 ~E 'fl & RK S: L I/2" SI'A'4DOF;S ,JS:3 3'1 3. ,AND T '3,3 L ?~'~TT3~ '~T ~" "' ' 3F ~LL LSSSiNG ,V~ OlD.dO2 :¢f~i;!CaTi3:,~l LISTiN3 oaS,--- 5 '0:15 :NTRY 3_0C <,S )ATJM SPECIFIC~TISN 3L3 ]EDT -LS DLL ~LD DLL SP DLL SV3 3LL $I0 DVS 3LL DIO VIRES DLL 5 5 P~3~SS (OST~L) O0000000000000 O00000OO00OOOO O00000OO000000 03300000000000 OJJOOO30OO0000 OOOOOOO0000000 OOO00000000000 OOOO0,'D30000000 00000000000000 OOOO000000OO00 ~V~ 9!O.~,OZ V~ZFiJ~TZ3xl L~$?INZ, ~,.~3~ S 5,50 S 35 4.23 53 5 3 I ? 13 .J 35 3 35~ 000 '039 5 ~ 5 ? 2 3 5:53 313 3 ! '3 719 31;~ 3 10 310 ~,' O ~ 23 65 O 5 3 5 31 O l ~ 3 S Z ,~ 56 O 635 520 .52 O 89 O 4~0... 0 O :3 '3003000'3390 3' 3 ~ 33303 } O0 000 3.~,.,00033, O~OOO 039 C',O 30 ) O 3 O 30 0 0 O 3:33 3333'J'30 O 3 3:3300 333033 O00 303~ '* 3030'303 O0 0 0"300*'* 00030 3:3300 O 300 3300,3 03300303000000 000300303]3030 0033303 O 9 O 3300 ,~ ~ O000 On 000 33333030033000 90000330000003 93 30,330 O 03 0 O00 0 ;)'0 O 00 O 33 O O JO 0 5i: 00300030033300 $~ .303030;30333030 S~ 0;3330330033003 53 0:9330000030000 5;. 0005.3000003000 SS 00300000009000 5!i 0330033'3033'300 5..::,0 ..n :3 O 3 '",,. 303 O 990 O $:~ 903'30030000000 53 30900390000003 5.~ 03303300033000 53 30000000'309000 SE, OOO0000OOOOOOO ~ OOOO000)O00000 5{ 003000~0000000 5'~ 00~00000000000 5:~ 00000000000000 ~-S O00000000OO000 ~3 03300000000000 58 OOOO000OOOOO00 5;, 00000000003000 53 O00000OOOOO000 ::53 O0 5.3 03300039000000 5~ 5~ O0,:}O00OO000000 5 ~.. 3 ,-33 ,., ~* 0 'O 3009300 O 5¢ 00000000030000 SS 00300000003000 55 5;~ 53 33300030003000 53 OOOOOOOOO00OO0 5~ 00000030000000 SP 'CNL qTE~ LU 552 PJT~ CALl 9T NPHi SR LSDT DTL DTSq 13187,2, 0 $ 3 LL S -)9~.2500 GR -999.2500 OP~i -999. ~50:~ LS -~99.250 O ~S S -999.2500 MT~q -999,250J -999,2~00 W3N' -999.2500 -999.2503 '4RES 53. 9117 DTL -999. 2503 - 999. Z 503 R -999. 2503 LDT; - ~9'2.250 O T - 99,~. 2 ~00 DT S T 13100. 0003 LLS -38.2D70 SV3 223']'.5000 Z 6,038 786.8 125 34~,. 5373 O..OD4~ DP~i 2'2.3125 LS $00. t ~05 :.~S S 0.1 Z 21 1,2207 9.3,4023 W 3 O, ! ~30 ~.,!T: q 12.5395 -9~9.2.500 -9~'9. 2500 -9 ~ 9 . Z 500 -R 99.25n0 -9 ~9. -9 99 500 -9~9. 2500 -3 99 . 1500 52. 7517 -9~9.2500 -9}9.2500 2. !750 0.1230 54.4549 54.4548 l Z. 5 ~ 8 B 253,~906 0,0073 3~4,5375 170.1992 0.1215 LL QL S S:i ~ WaW3 ~qTf '4 mCNL TE~S TENS LLJ ..," i. l L I T -i ~LS TENS -'} :29 · -99 :~. - } 99 . -999. - 9 :j 9. -'9 :'," 9. -~99. -'~ 99. -9~99. -'~ 99. - ~ ~ 3. -9~9. i7. - ~ ~ 9. - ~ ..~ 9. -999. -999. 170. 19, 3, 50. O, 51, 4, 5103, 171. 2500 2593 2300 2 50,3 2 ~O.O 2300 2500 250 :] 2500 ! Z ~ ~ 2~00 2~00 2500 2 $ 00 ? 12 :~ 2~OO 9150 8713 1367 2258 1179 IF00 93'7~ · .Q D 5: 5~ 5~ 5~ DV3 N r q SS! T~NS C$ q W 1 ~ 3 T~NS T E t~ S NCN~ 4DT DT TSWS N C N ~RFS LL :SS1 T~NS ~ · W I W WSW3 G~ T~$ -"~ 9 -99 -99 _ '~ '~ -99 -99 - ~ '9 -99 -99 -99 -99 -99 5 t !!5~.~ 9 2 '2 S 13 4 o:3 21 ? ~ 0 Z :3:0 "~ O 0 00 O 00 O 0 a ~ n ,~ ~ 00 SOO0000 . '~ 3 O ~ 0 O 3009000 O 0000000 OOOOOO0 0003000 0 J J 0000 0009 0 3 O 0000309 3900000 9033000 9. 2530 9.25,30 9.2500 9.2500 :9.2500 9.2500 9,2500 9,2500 9,2500 9,2500 9,2500 9,2500 9,2500 9.2500 0,5~75 9,2500 9,~500 9,2500 '9.2590 1.1367 6.7851 3.2500 5.5900 0.1221 2.~944 7.9375 9.~375 3.2500 7.BB57 9.~125 3.~338 7.3799 7.2500 V;> 013.d02 V'-~iFiC~Ti]~ Ci$T'N3 ~4~3 9 ,T ~P-~Z ,R ,S3T ~TL iTS'4 i,R~T :C~L I T ;:- '4 .U ~RSS 'ALI )T ~PMi .S.} 1' )IL )ISM ])13 ~IR6T =Cqt )R-~] _U SS Z ',IRES qRES ~P~I .S 3T }T~ 3TSq SP 9t3 >~R 'AT :CNL 73 -399 146 12~00 -51 537 1 5 ~31 344 0 19 0 9 -999 102 .0303 LLS .~177 Dod~ · 12g6 4T~'4 . ~ 04 3 7 ~ 3 ~ .5375 · 1 235 '47 ~ q · 9153 '4 q ~ ~ .Z30O . g 773 L DT. .0273 '/~'~ S .0525 3TSr .OOO0 LLS .9258 .8125 .0811 . t 375 .0015 DP~i · 5525 LS ,5206 QSS .1225 .IZ35 .359i .5117 .2500 .2503 .2517 LDT_ · Oleg TENS .0~73 12900.3003 LL~ -53.7595. 1377.5B75 2333.5.300 !7.:~73:3 0 · 1235 17.'35~7 C, · 3107 ~L 3~5.~I~'' 3'3. ;5 ~,30 W~ q 3 17;3. ,g:2 $2 T': ~ S 0 · I Z I 6 37. i 367 -9 ~ 9.2100 T ~ ~ S - 339. Z 5 00 S 2!0.4375 T~d~S 656.5352 LL3 37.9150 0 · 124 O 1.1348 NP~i 14.8~9~ i4. 5395 C~LI 3 · 7109 J6.,.:~12" Llrq 0.0!75 35~.1~7~ 3 . :Z 353 I 70.4Z~Z 0 ·1221 52. 5117 -993. 2500 T~S 5157.2500 SGq i ~9.05!5 r E :'4 S 156.5566 LLD 0.i235~ 1..~{516 Noqi 33.7517 TEMS ') '~ 6 5 '~ ''~ "! '4 - 3 ') :~. ,_~ 50 .." N C t' r,!. ! ¢67 ]T 51.1367 ]TiP 310~.2300 ~73.3~9~., ! 70 '" · -i4,2 T=qS 34.1 309 qCq~ 4371.25}3 5.2B!2 LL 6 a. 0 ~ ~ S S -O. S 3 i 5 T 77.7!~3 SSq' 2.1+43 Wlq5 12.9~93 55g3.1330 GR !72.5325 -~:J9.lSOO -:~9.2JOO ",! J f 77.71 ~ 3 ~ T 77.71~ 5323.2~03 7q-5. 5741 170.5357 1.2Z07 ~CtL 9. 134:~ 4.9304 LL 4'~ ~:5~S SS! -0.0132 TE~S 13.9S~ 9.2539 :,,,¢~ · 5350 5!57.2300 3:% 172.!375 15.2351 T~WS i3.3}$4 DT 13.930~ JTCO 5i57.2~00 152-7752 SG2 196.3125 !59.3742 TENS 5.1751~ NCW 3007.2300 ~S ~!~3. 2500 O. 00 O O 51.4548 73 .~273 77.7!43 52.4190 5523.2503 30)7.5300 9.1225 135.3525 2~7.3906 8.5270 ~237,2500 ~933,2500 54.~395 91.0273 13.9004 450.6406 3133.2500 6033.!300 0.t225 104.0!'73 197.5975 5~23.2500 12,3145 ~5.9305 !2.5811 50~7.2500 4323.2500 -999.2500 O. 3300 54.1367 51.0 ! ! '7 232.8906 5047,2~00 432~,2500 0.1226 .V~ OIO.HOE VERiFi'~Ti]',~ L!STiN3 o&SE ~ .U )T 4P-.t Z ]T$'~ DEPT SP NRa T ~T 5"4 LU S S 1 qR ~S W2~S MRES DT 342.5375 234,1575 LS 255.3~0~ 'L)SS 0.1226 :3.732~ 3.1235 5~,7517 -99.~.2500 57.2517 104.0173 DIS/ i2700.3000 LLS -~.7333 20.3330 1.0577 5~57.2500 340.5 ~ 75 -0.0005 DP~I 19 B · 4 ~ 75 L S 263.1~06 O.3~!i 26.7705 -9~9., 2500 -;999.2500 54.75i7 54.5~67 102.0273 3TSF 12500.0003 LLS -41. ;5320 SVO 47.4B05 0.9712 7019,2500 Gq 338.7B75 3R 0.032~ 189,1~75 LS 25~,8905 ~SS 0.3905 T 23.7705 9.2!07 49. 5367 -999. gSOO 39..5055 !. 1329 Z.3~38 1 ~:3.5'575 3.3107 3~0.5~75 1,524t 0,12B0 54.3357 -999. 2500 52 ~ 5 · ~ 139. 0625 553.7531 55,2305 O.IZ4= I. 3421 17. 1143 l I 0.54 1'~3.1875 0.~175 335.7~75 O. 9. 36113 157.7Z42 O.. 127.5 09.3~7 -9~9.2500 ;,572.7 :L35 S 163.5Z42 Tiq5 I. 0 :Z 54 NC ~. ~. 2441 5.2~9~ kk g 0. '~ ~ 57 -0.0!81 TE~5 15,D57~ 0:3~ ~ i W 1 q 3 2. t 702 ;,~'5 ~ 3 5235.2500 170.3t25 TE~S i 9.075 Z TE ~ S - 999.2500 NCq t i6.0574 1 6.0 57 '~ OT 523=.1500 37.5 l '?. 3 157.7!42 0.5371 ¢¢!7.2500 9. ! ~26 5.4 53 9 39, ~24Z 15.7705 4947 , ~50~ I S 9. ! :575 19. :3 17 ¢ -999.2500 !~4.1!45 2]1.5375 5037.!500 19.!143 2.0567 20.79~0 5311.2500 -9~.2500 0,3303 5~.:3242 !,5.0574 5!,0~30 5235.25<)0 6753.2500 0.!£30 2.5632 99.4548 195.0525 4875.2500 !1.55S8 45.5742 !.4454 18.0000 4535.25'00 -9~9.2500 O.OOOO 54.2617 5~.0117 18. 7705 ~5.3567 '4907. 2500 7319.2500 0.1240 2. 5915' 98o5~73 195.4375 ~427. 2500 52.5580 0.7202 19.3 955 ¢5¢'7. 2500 4735.2500 -999,. 2500 0.3000 Vm 013 ~0~ VFRr~-T~'~TIS~ L'[STiU3 oa3~ 10 .SDT )T~ )TS~I )EDT JR~iT qT_=q .U ~ S Z iRES )T ~PMI )TS~ )EDT SP 4R~T :C~tL 4TEM .U SS2 qRES qRES ~ALI 3T ~PHZ ~R _SOT )TL ]TSM )EPT qR~T :CqL .U 50.1357 LST_ 101.3773 rjT ~ [ 1253!3.3)03 LLS -23.4325 521.3125 1.1395 ~53).250D 536,7525 0.1~45 DP~l 26B.6~0~ 335,3~05 11.2~29 49.5117 DT - 999.250 O 50.3B67 ~ 6.5 ~ 67 'T' 97.0~73 OTST 12430.0000 LLS -15.7507 SV3 1~+80.$B75 2.4365 RNR~ 1365.5375 334,5125 0.0029 gPMI 39~.3~38 LS 305.3}05 :~SS 0.175~ ~,011~ 0.1~65 MTF~q 83.0173 DTL -999.2500 RNq~ 92.6523 LDT~ 69.D173 TE~S 113.0!73 12303,.3303 LLS -12.7312 SVD 795.3125 ~RE5 2525.5,300 3R 332,7i25 G~ 0.0~13 OPMi 33g.,3~05 LS -)~.1500 113.5~55 Si] 1,1358 tqPMl ZS,??~ T~S 275.5405 LiT~ 3.3542 ~LS 336.7525 SSR I.~3:BO '~ 5;70 156.9357 0.1250 ~,5117 -'))9,2500 £25,J525 'T~NS 21.B231 LL9 0,1265 MT2~ 2.8323 17.$~85 19.2871 0,0]22 ~LS 3~4,5125 S3~ 2.4768 UR~N 12o75~9 ~ 699P TENS 0,1150 MTEM ~4.9323 -91~9.25D0 TE~S -9~9,2500 4657.2500 SGR '2Z5.0525 1'5.7705 PT 18.7705 ruT~3 156.8242 TE~S 0.2~30 NCNL $555.Z500 MR~S 12,5332 ~35 6,6101 LL 52.6357 SSi -0.0359 TENS 33.6367 CGR 2,~772 Wl~3 6.355~ ~5t3 157.~125 T~S -9~9,2500 NCqL 33,5~:57 ST 33,5357 DTS] 4307.2~09 15F5.~I17 TENS 19.1 ~ 9 5 N C 9, :53 3 ! 2.71133 LL 92,339 S S S ! ~9 41il 1.3799 3,7932 ~6.57,2500 SR 1 ~ 7,0525 T E 2.5,7 ~ !Ii TEN S -9~9,2500 NCNL -'999.2500 :'9 ¢1!~ OT 29,411! 9T~3 4557,2 500 ,373.5270 SS 217,5525 DVO !54,7~92 TEqS :),6!91 NCNL 3 'Z 7.2 50 O t~l R :! :$ 4,2781 LL 7 ~, 9 54~ SS ! 51.3117 33.5367 435,3905 4747,2500 5153.2500 0,1250 2.5015 i~3.S125 253,3125 4~55.2500 12.298~ 109.0273 3.0276 30,5270 ~27.1500 ~573.2500 -997,2500 '3.3030 ~5,25!7. ~3.0!I7 29,&!11 50,2305 4733.2500 301~,5000 0.1255 2.3792 170.8125 215,$~75 ¢355,2500 19,5574 ~2,5898 3,7932 24.3377 ~5S3,2500 q~97,2500 -399,2500 3.0000 74,5273 50,0117 17,$643 352.390,5 4~07,2500 4'753,2500. 0,t270 17B,8t~5,~ ~7.1~75 .V~ OlO..d02 V'-RiFIC~Ti]q LiSTiN3 ~:Aq£ ii iS2 33:),!~05 'AL1 10.3223 )~ 51.2517 DTL .SD/ 65,6523 tDr_ )IL 56,7773 )T5~ 122,0!73 )E?T 12933.OJO3 ~P -i3.3733 sro )lO 7~6.3125 ~R~T 1.i~07 :CNL 5731.2=03~ S~-~ 4T~M 330.~125 ]R~3 0,0315 DP~i .O Z05.5 525 LS ~ 32 275.3 ~O 5 ~:~3 S ~RES 0,1274 ~ O T ~ 0. ~ 58 3 r qR ~ S O. 1 Z39 qT 'AL Z 9, g 223 ~!R ~ S, DT 55. I 36t DTL .S3T 55.1367 LDT. ~ 57,3367 TEW5 DTSq 1.38,0!73 ~TST DE.mT 12100.0000 LLS SP -10,7401 3t0 218,0525 FCNL 2223,5300 ~T~ 329,3375 DRq3 0,0145 OP~i LU' 2t5,5875 LS SSi 283,1205 QSS qRES 0,1284 MTEq OOY~ 0.7813 W2'~S 58,1580 WBqS MR~S 0,117~ CALl :~,0~13 aT 65,1523 DTL LSDF 69,~67 LDT. ~TL 67,7773 DTSq 1!2,0,273 0.0537 332.7!25 0.!26.~ 50. 2517 -9~, ~500 ~:37. 250'2 ~9 :3525 2!3.1325 Z3.~5~3 .1,133; 25,331S 3,3362 2 ~7 55~5 O. OO~3 330. 9125 1,5797 · 7,~ I 5.~, !'Z~2 O. 1265 55 · 0117 -9 ~ ~. 250 ~ -9 )~. !500 ~I,5523 2~9,J525 54,7315 13. ! 582 O, tZ79 !, 3551 35, 35., 41'~0 5. 3223 221.0.525 O, 3254 _, ~ 9.3375 1.1502 15,0'332 ~ 5? . 77~2 0,I~9 55,5273 4~55.2500 234.3525 SZ3 qT='q T = Xt S LIT~ FEW. 'rEqs SSR 35:+.57;=~ SSkl 1.1i33 NCNL aP,37.?-O0 '~ -' 5.3552 ~L ~2.~505 SSI 4.3 i 71 W5 q ' 155.1'375 TSENS 33, ~ lC, 3 T= q'~ -,3 ~ 9.2 :x 0 O NC>4 -39'~.2500 ',!ST 3~.4iB0 DT _"~:~ .41;~0 OY''~ J 4535.2500 3 O . 0 ? 39 S S 163.2142 TENS 11.2793 NCq'_ 4257,2500 ~RES 9.0 254 RH] 3 3. ?3245 LL 51 ,~2 SSl 0 · 0305 T i q S 35.5355 CGR 2.6741 3.?202 WSN3 4~ 35,2500 ;3 R 33,5 ~ 30 -999.253 O NC q L -999.2500 3 6.6. ] 55 O T 35,6055 OTC3 ''~ 55,50 5~,9555 1,4~3~ t3,54~ 4327.2500 6~,~023 56.02?3 33,~i30 4~35,2500 54~3,2500 0.!274 2,5428 19B. 4375 ~207.2500 14.650~ !3'~, 9B'75 3.5~99 34.5671 ~4~5. 2500 ~555.2500 -999,2500 .... ~ .. 3567 50,0!17 36,5.955 19,5143 472'7,2500 4351,2500 0.1234 2,6174 237.5525 4355.2500 t,5. 3543 129.4375 !. 3057 31. 2235 45~3.2500 4553.2500 0.0000 58.7148 51.01!7 .vO OIO.MO2 VF~i'-lCil'i]'~i LiSTiN3 ~A3~ !2 ~P )IO =CtL qTEM 3RM3 .LO SSZ 12330.3300 LL5 -2Z.3Z32 52'5.3125 3~5.$375 0.3)72 ~01.t~05 LS ~.127~ ~T~ 3.55~5 TH]~ 202.3i25 43'~3 -~9.gSOD MR.~S ! 13.2773 -~9~.2503 160.~525 li'~O0.OvO0 LL5 -~99.2500 -99R.ZSO0 -9 :~9· 25'~ ~0 -~9.Z503 -999.2500 -~99.25~3 4T~4 -~99.2500 TH3~ -9~9.2500 -~9~.250~ -999.2300 MRS5 -999.2500 DTL 50.7930 RNR~ -999.2500 LOT~ -999. 2500 TE~I5 -999.Z~0 3T5~ !1,,~00. OOO0 LaS -099. £50L') SV} -999.2500 -:~99. 2503 -999.2500 -:~ 99. Z 500 L -~99.Z500 QSS - 9 9 9.2500 O. 1274 3.53&2 137.2773 3'~5~ .5375 ll.~3~Z 74.5Z73 1~2.211T -9 ~ 9 . Z 59 $ 1)5.2773 -9~. ~5C0 -~.2,500 -~9.Z500 48~3,2502 tR!.9625 -9)3.2500 -9~9.2500 -9~9.2500 -9~9.1500 -9~e.l~O0 -9~9. 2500 -i~ ~9. !500 -9 ~9. !500 -~9.2500 -9~9.Z500 4.3~07 -9~9.2500 -~ ~9. 2500 -9)9.2500 -999.25 O0 -999.2500 -999. ZSO0 -9~9,.2500 -9 ~ 3. ~ 500 -9 J'~. 2:50C L~.D N ,~ M f LIT-i 3 · 351,5 ~{43. 2502 i 5 ,';'1.5275 0.1274 ~. 476,3 157.5525 ~. ~37~ ~9.27~3 351. B '~ 06 -~99. 2500 -999.2500 ~5~7.2500 -9~9. 2500 99.9649 97.0273 -~99.2500 -) :~'~. 2500 -999. 2500 -9~9. 2500 -999. 2530 -999. 2500 -'~ :~ 9. ~'* 500 -999.2500 -9,~:~. Z 5 O0 -999.2500 -999. 2500 -999.2500 -999.2500 -999.Z500 - 999. 2500 1483. 5875 -999.2500 -9~9. 2500 -999.2500 -999.2500 -999.2500 -'999,2500 -)99. 2500 -~99. 2500 -999.2500 -9'-~q ::'50n -999.2500 -999,2500 - 9 '9 '~,,. ,-" 5 0 0 - 9 :)9. '25 O 0 .V> 92~3.H~2 VE4!~=Ir~Ti]~ L:3TZN3 ~i;]= 13 ~2~3 ',ALI tPqi )TL )TSVt ~P ~R~T :CNL ,ITEM .U SS2 .iRES qR=S )T .S2T ]T SM SP -~9.2500 MT:q -~9~.2503 3rt Z9.5337 -~9~.2~03 LDT_ -~99.ZSOJ -~99.2503 ]TST 11700.0003 LLS -99-).2503 SV3 -~393.250J -99'3.2503 - ~ ~ 9 . 2500 3 -999.2500 -999,2500 LS -999,2503 -~99.Z503 T~]~ -999.250~ W3q3 -999.2300 -~99.250J -999.250'3 DTL ZS.~lSO -~99.Z500 L3F_ -999.250~ TENS -99~.250~ DTST 11.500,3000 LLS -99:~, 250,3 SV3 --399,2500 -999.2500 RNR~ -9~9. 2500 3R -999.2500 GR -~99. 2500 -999.2500 -999.2500 -999.2500 MT~q -~99. 250~ -999,2500 ~,lT ~ q -999. 2500 -99~.Z500 25.4160 NR~T 25.0~85 -959. 2503 JTSY 11500.0000 LL5 -599.2503 SVJ -k39,2500 T~qS -~9,2502 3.3~09 -9~3.2530 -93'3.2500 TENS -~9. · 1500 LL -999,2500 :SI9 -9~9,2500 MTE~ -9~9.2500 NP~i -'999.2500 T~S -9~9,2500 C~LI -999.2500 -9¢9.2500 Llr:i -939.2500 -9~9.2500 '-9~9.2500 -9-33°2500 -9~9.2590 -3~:,3.~5~0 2.$535 -999.2500 -9 ~ 9. '2 = 00 L L ,: -9 ~ 9. Z500 S i O -339.250,3 -'~ =9.: 5 J S NC'~_ -~9.25'33 -999,2500 LL -9~9.2500 - 9 ~ 9 . 250 J N 1 N 3 -9:~9. 2500 -~-79.2500 TE~S 3 ~ 35.5 ~ 30 M'3 T -g.~9. .25~'0~ 7T -999.2530 -999,2500 SSt -999,2500 DY3 -9:~9,Z500 TSNS -999,2500 NC~L -999,2500 -999,2500 -~99 J 5nO LL -0~9.2500 SS! -9~9. 2500 FE~S - 999.2500 C G -:J9~.2500 -9:)9,2500 TEWS -i~'~9,2500 TiN5 519.3LZ5 NCNL 3951,5000 MDT -~39.1500 DT - g 99. i 5 O0 $.G ~: - 999.2500 DV J -9:~9.2500 -99'3.2501) -999.2500 -9 .3 '9 . 2. 5 ',3 0 -9~9.2503 -9~9.2500 -¢99,2500 -999.2500 - ~ 9 7.2500 -979,2500 -999,2500 ' -999.2300 -9:)9.2500 -999.2500 1753.5~75 -999.2500 -3~9,2500 -9~9.2500 -9~9,2500 -'399,2500 -99'3,2500 -999,2500 -999.2500 -999,2500 -:99'9,2500 -999.2500 -999.2500 -999.2500 -g~9.2500 -999.2500 -999.2500 -999,2500 -999,2500 1S24.5375 -"~99.2500 -9¢9.2500 -979,2500 -999.2500 :CNL iT=_q .U ~S2 4RES ~2~3 ]AL1 ~PMI .SDT }TSq ~RAT :CN~. qT_:q .O qR~S qR~S 'ALi ~PH! ,SDT SP '4RAT =C~L qTEq ,U S S2 '4RES ,~A~ I -99 -99 -99 -99 -99 -99 -99 i 1 11~0 -99 -99 -99 - 99 -R9 -99 -~9 -~ -99 -R9 -99 -99 1 ! -99 -99 -99 9. 2500 R. !503 9.2503 LS 9.2500 9,2503 5.~569 9.Z500 LgT_ 9.250O 9.2%00 ]TST O.S300 LLS 9.2500 SV3 9.!500 9.2500 g. 2500 ~. 2500 9,2300 3P~l 9.2500 LS 9.2 500 MT ~.2503 'TH~q 9,2300 9.2500 9,2503 5.7:333 RNR~ 9,2500 LOT: 9,2500 Y E W S :9,2500 DTST 11300.~000 LLS -999.250~ SVO - 999.250 O MR E S -~99,2500 qNq~ -99~,2500 3R -999.2500 $R -999,2500 DP'~Z -999,2500 ~IEq -~99,2500 /HD.t -99~,2500 MY~q -999,250.3 ~'.I R i S -9~9.2500 -9 ~'~. 2500 -g ~'~ · 2 ;.~0 -~3.Z500 -~ ~9. 2500 -9 ~9. 2500 2.2112 2. 2522 -9~9. 2500 -9 ~9. 2590 -9 -39. -'~ 99,2500 -9~9.2500 -9)9.2500 -~ ~9. 2530 -9~9,15:30 -9 99. 2500 -9 ~9. 2500 -999.2500 -, ~.. 500 2.'3508 -9~9,2500 - 999, g 5 O 0 -9~9,2500 -999.2500 -9 99,2500 -999,2500 -9~9. 2500 -9,97. 2530 -9L~9.2500 -9 ~ 9 · 25 O 0 -9~9. -999, :2500 LLD S13 MT EM NPql TENS CALl LiTW S :$ R TEqS -3~9.2500 LL - 999.2539 S SI -9:)9.250S -~ ~'99. ~ ~'n~ T'N5 39!5 5 ',30 ;~ 'JOT ~ ;uU 3T -~ ~. -~'99. l 53:3 --? ~9.2500 -'~ 99.2 5 O O - ~9 ). 2 500 - ~ ~ 9.2 500 - 9 9 ~. 25 J -'~9.2500 -999.2, 500 -~ 99.2500 I 0'59.6 ~75 ' J -999. 2500 -999,2500 - g :~9.2 5:30 -99'¢. 2503 -a~9.~=O0 =5,30 -9~9.. :- -99,9.2500 -99'9.2590 -E~9. 2500 -~9'~. ~ 500 207~.5030 -~ ~ 9.2 J 00 -999.2500 -9'~ ~. 25 O0 -9'~9. 2500 -~99. 2500 -999. 2500 -~9~. !530 -999.25 JO -999.2500 -9~9.2500 -~99.2500 -999.2500 -~99.2500 -939. 2500 -999.2500 -999,2500 -999,2500 -939.2500 -399.2500 --~99.25!30 -99'9.2500 -999.2500 -999.2500 -999.2500 -99 ~. 2500 -999.2,5 O0 -999. 2500 -~99 -99~. 2500 -999.2:590 )T .S3T : C NI ,'... -U SS2 )T qPMI 'S3T ]TSq SP NR~T =CNL 112.00. 3303 tLS --)99. ZEO0 SV3 -999.2500 qRES -999,250J qNR~ -~99.ZSOJ S~ -9~.Z503 3Pql -999.Z~OJ LS -999.2500 ~13q3 -~99.2503 ~rEq -99~.Z500 '~RES 58.5~Z5 qR~r -99:~.2500 LDT_ -~99.Z500 T~tS -999.~S03 3TSF 11100.3000 LiS -~99.ZEOJ SV3 -99').Z50~ -99~.Z500 -999.2500 32 -'999.ZSOJ GR -999.2500 OPdl -999.2500 LS -99~.2500 -999.2503 THC~ · -999.2~00 -999.2500 MT~q -999.2500 MRE'S -999. 2500 3Ti 57.2255 NR~F: 93,7773 -999.2503 LCT_ -999. 2500 TENS -999.2503 DTST llO00.OJO0 LiS -999.Z500 SVO -229.2503 M2ES -999.2500 RN~ -i~9'9.2500 JR -¢e~.ZEO0 -9~9.25J0 -9;9,2533 T~NS -9i9.Z530 C~Li -3~9.2500 -9~'~.2500 -9~9.Z500 Sg~ -99~.Z~30 -9~9.Z500 ~.AZ15 FC~ ~.5~53 T!~S -9~9.Z500 TENS -9'~.253J LLD -9~5.2500 Si3 -999.ZSnO..., -9~9.253J -:299.'Z503 T~N'S -9~9.Z500 C~LZ -'~9.2500 PEF -990,2~00 LiTH -999. 2500 QLS -999.2500 -999.2500 UR~N -999.2500 TENS -999,2500 MTE~ -99'9,2500 4,5~37 FCN_ 4,555~ TENS -9¢9.2500 SSR .~)Ov -9~9.'2500 -?:~9.2500 -99~.2500 TENS -9~9.2500 -~9.Z500 RH]5 -999.2500 LL - 9'¢9,2903 S S -999.2500 TENS -999.2500 WiNg -'~99.2500 -999.2500 -9.99.2500 -929.2500 TiNS 3J1.~90=. NrWL 3751. ~000 -9~9.2500 9T..... ~.~ 3T ] -:~99,Z503 -9~9,2500 SS7 -999.2503 3V3 -¢'5'~.2500 TENS -'999,'2500 NCN. -999.2500 >aRES -9:99.250 O 19~3.5;J?.=, -339.2500 -399.2500 -99~.250~ -999.25J0 -999.2500 -799.2500 -999.250~ -9~9.2500 -999.2500 -~9.2500 -999.2500 -9~9.Z500 -9~9.25J0 -:999.2500 1357,'5075 -99'9.Z500 -999.2500 -9~9.250J -9:99.2500 -999.£500 -999.2500 -999.2500 -999.2~03 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 1375.6~75 -999.Z500 -9'~9.2500 -999.2500 -999.2500 -099.2500 -999.2500 -999.2500 ~T~ .d }T )TL )TSq 09.0000 LLS 99. 2500 9~.2500 9 9. Z ~ J ,3 ~.,2~OO 9~.250,J 99.2~09 LS 9'9.2500 '~T~q 92.2500 99.2500 "4 T 99.2~0J MRES 9~,2503 JTL ~3,2!2~ 99.2~0~ LDTi ~9.2~0~ T~S 99,2500 DTST 15~00.0000 LLS -999. 2500 SV~ -)99.2500 MRES -99'9,2500 -999,2500 -999,2309 -:~9:~, 250~ -999.250D LS -999,2500 -999,250S -999,250~ 39.1502 75,0273 - 9 '99. 2530 ,., -999, -9~9. 2530 -~ ~-~ · 2530 -9 .~9.250 0 -993,2F. OS -~ ~'~. 2500 -9~9. 2500 - 9 ~ 9 . 2500 -9 :i~ 9.250 O -999,2500 -9 ~9. 2500 -9~9.2500 -9,~ 9.250 J 3,7737 -9'99.2S00 -999.2 50 C -9-.~ 9 . 2 ~: 0 O -999, '2500 -929,2500 -999,2500 -9~9..25J0 -9~9,2500 - ~ '~9.250u -9 ~9. 2500 -9~9.2500 -9~9.2500 -999.2500 -999,2500 3.5530 3. 4307 S'$~ -C~. T~ S LL] Si] T £ 'q3 LiT~ :~ L S ~,,S WL SS~ SG~ TeWS - ~ ~. 25 JO -9~9.1590 -~ 29.2500 -9'~9.2~00 -999. 2500 -9~99. ~500 -999.25 ~0 i 150.6~75 -9~9. 2500 --~9 ~. 25 O0 - 9 ~ 9 . 2500 -999,2530 -99 9.250 O -999.2500 - ? '9 ':,). 2_ 530 -999,2500 -999.2500 -999.2500 -999,2500 -9~9.2500 -999.2500 -999.2520 -999.2500 -999.2500 1~+19.5575 -99~.2500 - '~ 99,,..~ 5 O O -99'9. Z 500 -999.2500 -9)9.2500 -929.2500 -9:~9. 2500 -999. 2500 -99~. Z 500 -'959.2500 -'99'9.2300 -999,1500 -999.=~500 - 9 ;~9, 2500 ! 450. 5875 -999.2500 .V: OlO.t02 ¥5~I~IJlT!]q L!$TiN3 ~IS! 17 )T_ )T S '4 913 :C~i_ 4R-iS 'AL1 )R .SDT )EmT )!0 qR~T ,U SS! qRES DOlL ~R.=. S = J[ 9T qP~l SR LS2T 2TSq SP ,DIS FCq LJ -RRg.2~OO L. DT_ 19600.0000 LL.S -~999.230D -~9.~.230J -999.2300 DP~Z -999.2500 LS -999.2500 MTJq -99~.2500 Td3~ -399.2503 -399. ~7300 3TL 4:2.2353 ~3.~323 -999.2~0~ LDT_ - 9:~ 9.250'3 T 10500.0000 LLS -993.2500 SVO -399.2500 -599.!500 -999.~50J~ .... ~ T~S -~g.23OJ TE~'~S -~3~.2503 CA.Z -9~:9.7300 -939 23g~ -939.2~$0 -93:9.2530 3.3Z9~ 3.5356 -9~3.2500 T~"4o -9}9.2500 LL3 -9~.~500 NP~I -g99.2~0~ -9~9.2300 -9~9.2500 -9~9.730~, -399.2500 3.7Z39 ~.2117 TE~S -379-2500 SSi -939.2500 -939.2500 YEWS -3 ::93.25'] O D T -939.75:]:] }Ti] - 339.2 500 -999.250J SS~'. -9~9.2500 NCq_ -7~9.2~30 ~ ~ ':~ -3~9 25u0 -:)39.2500 LL -:399.2500 SS! -~ ~"~. ? 30'j -~99.2500 glq5 -~99.2 500 -~99..2500 -939.2500 TH ~lS -9~9.2500 TSqS 3595. 5300 - (:~ 99. 2300 DT -939.2500 DT2] -779. 2500 - 9 -3 '9 · Z 5 ;33 -} 33 . 2 5'30 -999.2500 - 3533.25 O0 -99:?.Z530 -~9~.2500 -339.25!30 -'39q. -339.2530 -999.~500 -339.2500 -3?9.2500 -9~9. 2500 -9~?.2530 1419.5~75 -'? ? 9.2 5 O0 -9-?~. 25 -97'?.2500 -9~9.2500 -999.2590 -)~9.2500 -999.Z500 -999.2500 -~9.2500 -999.1500 -999.2500 -999.2500 -~99.2500 -999.2500 -999..~500 -999.2500 -999.2500 133.9.5375 -~999.Z500 -999 ~00 -99'3. £5 O0 -gSg. ZSO0 -9'99. 7500,_ -939.2500 -979.2500 -3~9.2500 -~99.Z500 -~9~.2500 36.~52~ -99g.25$D DTST IO~O0.$jOD LLS -9~.25DD SVD -3~9.250D DPt! - ~9 ~. g 3 O0 ~ S S -99~. 2500 -~99.2500 -999.250D 62.5742 -~9~.2500 LOlL -ggg.gSO0 D'TST 1030O.OO0~ LLS -~9.Z500 SVO -999.2500 -~9.2500. -999.2500 SR -999.2500 -~9~.2~00 -999. ZSOP - ~ 99.2533 -99~.25~0 HT2q -999.2500 THDR -999.2500 W3~3 - ~ ~9.2530 4T -~99.gJOJ DTL 39.7~49 -39~.~03 -~9 9.2500 OTS r -~ ;S. 2539 -~. ~ - ~ 3 · 431 ~ ~,5~17 T -~S -~g.2500 -9~9.2533 T = '~ S, . -9~g. 253~ -9 ~ ~. Z-9 O S' 9 -~}9.2503 CALl -~.2500 -9 ~ 9.250 $ -9~. 2500 TE'qS -999.2500 -999.2500 3.6D37 -999.2500 -999.2300 -999.!500 TE~S -999. 2503 Si -9~9. 2500 ~T~ -9~9 2500 -9 ~ 9. l 500 T -9'~9,2500 CiLI -9 )9.~'D 5 .~ 0 Li T -9~9. 2500 QLS -~ ~'9.2500 -'999. ,Z 500 -9~9.Z500 3 53A~ 3,5 ~ 75 T""4< . . ~ :, 00 S -9 ~9.2:3 O0 S - ? 9:3 . 2; 9J T E 'd S -9~'3.2~0~ :.. ,., -'. -99 ~. 250 :D -9~9.2303 W5~5 - 939.25 00 TE q S 436.I~35 NC~_ 3aJl.:~PO0 -399.CJO.D DT -9~9.1-:33 3T'' -:~ 9 5.2 3'3 3 S 3 -9 ~9.2 ~ 3 3 PV 3 -999.2300 -9¢9.2530 - 9 ~ ~. 150 J S S l - ~ ~ 9.2503 T ~'q S -999.2500 -9 a ?. 250 0 - 9 99.2500 -999.2530 -999.2530 T5 ~ S -999.2330 TE~S ~ :3 9, i ¢ 0,6 N C ',~ L 3435.5300 MDT - 9 ~ 9.2500 DT - 9 ~ 9.25 O O 3T' 3 -999.230 S ,S -9:~9,2500 OVO - 999.23 O0 T E X S -999,2500 NC ~ L -999.2530 -999,2300 -~ 99.2503 LL -99~9.2300 5 S! -999.2302 -'999. 250:3 N 1 ~'~ 3 -999. 2303 -999.230 $ -999.2 300 SE 507. I ~ 0,5 3 ~ 95.5 D 0 :S :',I L) r -95~.2500 or -9 ~ 9.2:30 3 DT 3 3 -'Y 99... ,~ 53 "'v -999.2500 -999. -9 ? 9.2500 - ~S. 2500 1510. 5975 -999.2500 -~99.1~33 -9:'9' .*:300 -,799.2530 -~9.2500 -¢99. 2500 - 99 ~. ! 500 -¢99. 2503 -9 ~ 9.2500 -999.2500 -999.2300 -999. 2300 -999 . 2500 1764.6¢75 -999. Z 5 0 0 -:939.25 O0 -999.2300 - 999 . 2500 -9¢9.2300 -99~.2500 -995.2500 -:~ 99.2590 -999. 2300 -999.2500 -999. 230O -999.2500 - 999.2 500 -999.2300 -999.25 O0 -999.2500 - 999.2500 - 739.2500 ~ :557.5~ 75 -9~9.2500 ~P ~RAT =C~L -U SS2 MRES ~,ALZ ~P,fZ LSDT JTL ~TSM DEPT SP 3R-13 LU SS2 ?cIT~ 1,']lOO. 0000 LLS -999.2503 SV~ -999,2500 GR -'~9.2500 -999,2503 LS -999.2500 -'~ 99.25ag TH -999.2500 W3N3 -999.2503 -999,2303 MRES -999,2500 OTL 41.,~D63 -999,250~ LDT= -999,2~00 TENS -999,2500 ~TST !0J91,5000 LLS -999.2503 SV3 -999,2503 -~99. 2300 -999,2~00 LS -999,2~00 '~ISS -~99,2~03 -99:9,2500 -9~R,2500 -".:, :~ 9.2 ~ O 0 -9~.2500 - 9 ~ 9.2502 -997.2500 -9~9.2500 -9'~9.2500 -'9 ~9.25 ~ O -999.2500 -999.2500 -9,~9.2500 3.5750 3 , 579 ? - ~ 99.253:3 3 V 3 -~.~5'J. T -~:~9.2~33 LL -~9.2503 SS! -99'~ 25:3~ - 99 ?. 2 303 T ~'4 S 339!.530.3 MDT - % ~ 9.2 53 5 CT -~)9.2503 DTZ] -?99,2503 -999.2500 SGr< -999.2~00 ~S -)9~,250J LL -999.2500 S S! -2 ::~ 9.2 500 T = W S -9~9.2530 CG~ -999.2300 WSq3 -999,2~00 $q -999,2500 T~WS -999,2S00 TENS 385. ! ~ 36 NC N ~ '~ :3'= 0 -9~9,2500 DT -999,2500 2T23 - 999..2 ~ 33 -?:¢9.2300 -9 79. 2:500 3V -.,~ <.~ :~. 2 ~ 00 -.99~.2500 -?~2.25J0 -9'99,2~00 LL - 9.$ 9.2 50 O S S ! -9:)9.2530 TEWS - 9 ~9.2 f O0 C3R -~99'.2:530 W1N3 -':~ 99.2503 - 9 '~ 9. ;l 5 O '3 -2'~9.2¢00 -999. 2300 -i~99.2~9J -999. 2500 - 999. 2500 -999. 2500 1597.5~75 - 9:;9.25 O O -999,2590 -999.2 5 O 0 -999.15:])0 -999,2500 -999,2500 -99'9,2500 -999.2530 -'99'9,25 O0 -999,2500 -999,2500 -999 :. 2500 - 999 . 2500 -999,2500 -999,2500 -q99.2500 -~99,2500 .i~17,6B'75 -~99.2500 -999,2500 -999,21500 -999.2500 -999. '2500 -999,2500 - 999.2500 -'799.. 2500 -9~9. 2500 - 99 a 250 a -9?9. 2500 -999.2500 -9~9. 2500 :I~E N~'4E :EDIT tERSIO~ ~ : )ATE : ~AXIMU'4 L~NGTH : :ILE TYPE .OJZ :NTRY TYmE · V~ O13.flO_ ~ V =~ ~Zi=IC~TID'~ ~ rSTr~,i.~- .o.,~i~- 21 i D ] R 3E R ~ tTE~ )E~T ~T E )EP iT E iT E .~TE 13173.4570 -999. 2300 13100.2910 335.3125 935.3125 13000.2)10 1035.5375 1335.5575 12900. Z,~lO 896-'B 125 1ZBO0.2~!O 867.81:2. 5 12700. 976. ,5125 12500.2910 533· 31P5~ 333.3125 1ZSO0.2~I0 ~22.3t25 82'2.3!25 513 ' KS J q"' T -tT~q MT~q H T :: '4 q T ': '4 MT:~q -9 ~9.2590 ~ T f',~'. -9:)9.2500 WT:,q 553.312~ HT=%l 1035.5575 HTE~ 751.8125 ~S.3125 6J!.8125 WTEq 975.5i25 953."'300 MTEN 755,9375 594.7500 S~L i i , I I 1 i 1 ! -99~.2530 -9:~9.oZ500 5 18. ;51 ~ 5 7 '44. '5125 - ~ 99.2500 ~,52.9300 55 S. 7500 - 99 ) · 25 O 0 493.1 !50 - 9 '!~ 9.2:50 0 5{ 5~ 55 5~ ~ T ~q HT: "'tT= X~ ~TE~ q T: '.i H T :: mROCESS (JCTaL) 30300330003030 03:]00300003000 33000000030003 933'30'300003000 ~30a000033000 09'300000300000 '~0~ 30093000 030000:00003000 93903330009000 -'9'}'3.2500 53!.,5406 936.3125 4:91.8906 1335.5875 755.3125 452.0000 ~67.q1~5 5:56.7500 ')76.8125 3'175 ,,~. .~= n~2.rt02 VEq!FICCTI3,,t LISTIN] ;a:]i 22 )E~l- 12-S00 tT-=xl 795 tT=_Xl ?95 )E°t 1~30~ tT~ 533 iT~N 533 )E:'T 12200 ~TEN ~TEq ~10 )E~T 12000 ~T [ q -)45 )EPT 11900 tTExl -9,99 ~T~Xl -999 )E P T ! 1,3 00 11700 )EPT I1500 tT'-xi -~99 tT-=Xt -999 ]E~T 11500 ITEN -999 tT FJ ',I -999 )EPT 11403 1TEN -999 tTE~ -999 }E~T I1300 iT .= N - .1TEN -999 ~TEX -999 )E~T 1110 .Z~lO .3125 .3115 .2)10 :~T~q .3i23 .8125 .2~10 ~TE~ .312~ .31!5 ~T~'~ .3125 .Z~lJ HT~ .S!Z5 .ZSOS .2500 .2~I0 ~TEq .£~00 .2910 .2503 .2~00 HT~ .2500 .2910 .!500 .ZS0O .2913 .2500 MT~I HTEi -t T E ~ .29!0 · 2503 .250J .2500 535. :il'Z5 ~5 ;4.31 25 5 ] 7. Z 50 O 5 '{-}. 0 j 00 -9~. 25J0 -9~'~. 2509 -999.1500 -9)9.2500 -9)~.2500 -9~9.2500 -999.£500 -9'~9.2500 ~T!q qT~'~ ~Tf~ JT~ ~TEq ~T~q HTE't ! 7 ".-. 3 -'~/; 9. Z 530 3 '~ ! ~906 - 999. Z 533 -999.2500 335.3~06 -~::~9.25 O0 343.!~06 ~T .... ~,4 ~T = q MT E '4 d T E '~ HTEt~ HTEq ~TE~ HTE~ 7~5.3125 437.0000 63B.,?125 ~26.0090 '~59. -,500 ~i0.3125 623. 0030 -"~ 9 9. 2500 -~'~9.2500 -999.2500 -9~9.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.g500 -999.2500 -:~99.25'~ 109 -9 )EPT lQ3 tTE~ -) )~?T 107 iT= ,~ iT-N )EDT ITEN )EPT tTZN )EDT ! T = N )E~T 103 ~'T F ~ -~ ~T: '~ - ~ }EDT dTE~ -9 tTE~ ) E ~ T I 01 ~TEN -~ 99.2 =~03 99.2500 97.2503 00.2913 00.2~10 HTZq 00.2910 9'9.2~00 O0.2~Ij 9 9.25 0 O -I T ~- ~,~ 0',]. 2 ~lO 99.2500 9:::).2503 HT~'~ 99.2500 OO.291D 99.3500 99.2500 99.2500 99.2500 2500 -999.2503 -? 9-?.. 2530 -9 .~9. Z.5 D 0 - 99 q ? c 00 -a 9 }. '2 S 0 J - 9 ) 9.25 O 0 -9~9.2500 ~tTZN d T '- W eT = HT ~N H T :' "J - g :) ~. 25!') j 314.3 .~:] 5 - ? ? 9.23 0 O - ~ :~9.25 J 0 29:3. ! ~:D5 :25 ]. 8 -:9 :)9.2 $ 00 2 .50 . 4 3, 75 ~T = dTE~ 'iT': HT E W HTSN WT.= ~J ~ T E '~] -999.Z500 -9 9 9 . 2 590 -939.2530 -'9 } } . 2 5 9 0 -) ?'9. Z 50 O -9.~'9.2 ? O0 -S ':)}. 2.5 iD 0 - ,) 9 '-9.2500 -5) :39 . Z .5 O 0 -999.~.~50, 0 - 99 '9 · Z 5 ",] 0 -NTRY 3LOCiS DA T J~,l :)EDT TPL E/ITT EP~i FVD ;VJ EPT FDT EF~T ~ ~]G TYox CI aSS = T 30 00 ~D 23 ~StM O0 132 Oi O 0 ~ 1 D B / ~ 00 t B 0 0 I 0 O 4 i V 90 000 OS ~ 0 4 l ,t O0 000 O0 O 0 ~ I 5~ S~ (:]STAL) OOOO00330000OO 09300000000000 OOOO00OO00OO00 :DO000000000000 00 D 0:3000000000 · ,-,- 3ATA :VD 13152. -0.'45~55 TPI 15.5~0! ~ATF ~-:~ ~, =406 =VJ -0.~14 27.9297 V3 :VD :VD )~T :V 3 )~f :VD )EPT )~T )EPT :VD :V3 : V 3 13100.1560 TPL -0.'+~$3 =VJ 1330:' ~.i~60 T? -0.&375 =',/3 12990.1563 T~L 0.3B77 ,=Vi !2330.1°53 TP~ 3.3142 FVj i ~ TO O. 1 ~53 T PL 3. 2503 ='vj 12530.1560 TP_ 0.2~Z5 1Z$00.15~0 TP 12~00. 1550 T~. 0.352S 12300.1550 TP~ 0.358~ FV3 1 ~ 203.1:550 TP L O, 290.5 F V J 12100,1560 TPL 0,277~ FVJ I2300,1563 TP' - 999.2500 =V J 1191!. 83Z 0 TP ~ -9 ~ ~. 2'500 ~V 3 !g.~+ili -0. '~575 12,7575 9,3.342 10.'~5~1 O, 2517 I0.2:~51 3.2,:'7~ 0.272.5 9. ~51 t0.5~$i O, 11,2575 0.2503 ~ .5425 -~9.25** -9~9. 2500 -999.2500 -9-~9. 2500 E~IrT fi' T T E~,TT EATT' TT 'E~TT -,- r~LE TR iLEq :tL= N ~ ~IE :EDIT .gO3 ;~VIC= NAvlE : ~SiON ~ : d&XlMg~4 L;E~GTd : 1024 ~JXT FILE '4~ME : :!LE NA'4E ::SDIT 4:53.393,3 73,1523 72,53°_3 I f 7.1 11~.1523 57,314~ -999.~,.O 4~.5816 17 7.95!3 5.$941 4.5410 5.02'93 9.&473 1'~. 2578 !2, -5300 5,7617 3. 0273 -~9'~ .2500 -999.2500 ~,PI SERZ&L NO: ~H = ll.~ ~Iq~ Cl~C STOP~'Z3: !103 'lAX RE~. TEMP. = 170. .OS}iNS UNIT .~ .q S i i"~.q UNiT :IELD .--. ~,~S I NE E R: ~ITTqESS_:3 ~Y: 57.3 5~ · 3 170. 170· :NTqY :~ ~-OC q S TYP )~TJM S~ECIFiCATIDN SE:qVi'E Sr_-qVlC'~ J~IIT &°l ~Pi iD OR3~ ~ L;]G TY~= CL:~SS vl]O t0. ~ R '] C _= :S S .LS .LD ;V3 ;i 3 ~N~ =C~i_ 4TE~ 'ALI )RqD .L .d .S .ITq ;S1 ;SZ ~LS ~R E S 'H3q ~3~5 4RES '~L! .3 L.. R 3LR '',,iR S~R L3R, L 3R L3R L3R L3R L3R L 3 R L ] R LDR ".,13R :.:_PR 3 ! 3 O i ? i 3 3 ! 03 ~ 3 333 33 f 6:~ 423 33 J 3 J 3!8 635 310 Si 2 :: :J 31 350 0 :: 355 01 :~ 9,3 33 33 :~ 0 i 35 ~ 31 35 ~ 0 35~ 354 O! O O 3 03 OOO O0 00 O 03 00 O 00 535 l 1 6 6 0 310 :31 7 i '~ 5 0 7 ~ 3 "33 310 Ol 310 313 01 3i 0 3 ~ ~ 323 :~ 0 650 53:5 Z ! '3 10 O l Z ~ 3 0 l ~ 2 3 ~ 0 }330:3330009003 03'300030003033 :~3~3OOOOnOO.~O0 .J0333333303903 33300030030300 00300330000000 '~O OhO 00:'~303OO 003000030000'30 33300000033000 0:3 } 03 O ] 30'330 C O 33:300030033300 3'0'300 O:3O O03 O00 03300030300000 0300 ] O 30:203000 033030303,30300 :33 JO J O00 O 0330 O ~n~03300 :33300033030030 :33303330003099 00003:330033000 30 ~ O 0 O 30300 O00 :}3JOOO3000OO00 3930~330039000 3 '~ ~ O 0 ..O000OO003~., 30000030030000 33000000000030 03303330039000 933000~0000000 <03300000093000 03300030000000 :30 O 00000:O00 O00 00000000000000 00300000000000 003333}0000000 30300030000300 00030030000000 03000930000000 DO000000000000 3003'0030000000 00000000000000 OOOO0000000000 30300000000000 O0000000000000 OOOO000000OO00 000000000330,~0 03300030000000 OOOO00OOOOOO00 03300000000000 03300030003000 03300030000000 00300000000000 OO:}OOO30OODOO0 OO30OO000OO000 33:303 O O 3 O0330 O vP nlO.~t02 VS~i'=iCarlDq ~ 13T!~'J3 ~,~_]- 3~ )EDT ~P :CqL 4TEM .U 4RES qRES )T 13187,5003 LLS -99-~,2.500 SVO -999,2590 -999,2502 - 999. Z S O 0 -:399. 2300 LS -999.2~00 ~SS -999.2500 TH]R -999,2500 -999,2503 gTL -999,2500 LSDT -999.2,500 37~ -999.2500 gTSq -999.2500 -9~9.2500 -999.2500 -999. 2530 -'9 )9.2,300 -999.2~J0 -:939. 2300 -9~ .ZSOO -999.Z500 -999.25O0 -9~.2590 -999.2500 -999.23O0 -999.2300 -9 ~ 9. g ~ 00 )EDT qRAT =CNL SSZ qR~S POT~ qR E S 13100.0000 LLS -22.2507 SV3 2!35.3000 iqRF. S 1,1'+65 RNR:~ 5Z75,ZSO0 5R !71.9375 SR 0.1~38 3PHI 331.3305 LS 0.1215 H'T E ',l 0.1233 q'T~ 3. 7575 2.9510 0.1!35 ~ 22~6 17. ~ ? '99 ~ 7.379 '9 i 0. S '3 '9 5 0.93~5 71,937~ 2.394:5 15.1035 S3 · 5.5'42 31 Oi !6 21 - 9'9,"9. -9'99. -'999. -~99. - 99,9 · - 9 99. -9'9 ~. -999. -999. -399 , -a9a -999. -:} 99 · -999. -999. -999. -999. 789 · 158. 5 9 £ 7. i:j . 5415. i 5~ 3330'J3:]0093300 i 55 303090300030J0 ! S~ 03333330003309 i 53 33300000930390 i tis OOOO~9900O3~JOO I 5{ 003.. '~'3~., ~39090000 I S:'~ O')3OCj30OOOOO9 i 55 JO0']OO33930000 i ~ 03300:33009:3003 I Sa 00 300009000300 ! 55 ]DDOOODO,gOOOO0 ! 5" ,3"3,]OOOOOOOO003 ! sS O00OOOJOOOOO00 i 5} 03300030000090 - . -~0900090000 7>_33 SGR Z3.5574 3125 3VO 16.87'.-99 5242 TEXIS 5~+15.Z500 ~, ~, 8 ]3 qC ~J: 6~57. Z 5 O0 2500 q:RES O. 1216 7 9,~ ~, R~55 2.5237 3757 LL 1~0. 5625 1523 S S I 275, g 906 0 355 TE q S 5 8 ~'7.2500 73~0 C'S~ 13 08 =0 ~3340 ~ I ~;3 79. $39 8 8772 g 5 ~',~ 5 3.5959 2500 ~ ~ '~ 9 9.~'~ 5 n,, 0 2500 OV9 -9)9. !500 2500 rEqs -999.2500 2500 ~RES -999.2500 2500 ~3~ -999.2500 2509 LL -999.2500 Z500 SSI -999.2590 2500 T~S -999.2500 ZSO, O CS~ -999.2500 2590 '~lq3 -999.2500 2500 W5~3 -9~9.2500 2500 SR -999.2590 2502 TE ~ S -~99,25 O0 2500 TE~5 -999.2500 2530 SGR -999.2500 ZSO0 SSR -999.2500 25 O 3 TE~S -999.25 O0 )T ~DT )T )EDT ~P ~R~T :Ci. 4T=.q .U ~S2 4RES {RES ]ALi )T )Tgi ~P :C'g~ 4TE~4 SSZ - .~ 99 . Z :::;,33 MRES 7,~.1523 3TL O.OOOO LSDT 83.5273 3TL 7.5.0273 ]TS4 13339.3303 -23.3375 SV3 1934.5375 'qR.E S 3. q, 333 'F72.31'>3 172.6375 0.029.~ 3PlZ 358.8~06 QSS 0 , 1 Z16 fit E 1.739J ThSq 95.2773 w3~3 0.1Z35 -'~99.2500 92.6523 3T~ 3.3003 LSDT 9~.2773 5~. 3 il 7 12900.O000 LLS -3E. 331'] S V 0 545.3i23 1.35:~7 553~.Z503 ?.,Fi 172.0525 -0.0i27 199.5375 LS 255,3~05 ~SS 0.122i 19.~2~ 0,1240 MT~q 52, O 117 0.0300 L S 3 55.3:~67 DT_ 5'3.0~1 7 12800.3203 LLS -85.7227 S'¥ 3 ti53.5575 MRES 2531.5000 S~ 171.0525 ~R 0.0107 DPdZ 207,937~ LS 3.1225 MTEq 7 ? 7.~ 53 137 .5 0 3 ~7 32 0 17° 7 37 -9 )9 I}..o,. 0 1 3 2~1 -0 172 ! 12 -9~') 51 .250C .0273 .6523 .5273 .3i25 .1235 .)~2 .7537 .3347 ·~- .8~06 .5~30 .73~7 .~500 .5523 .55~3 .7~45 .5)?~ .5~! ',~ ,!511 .ig?5 .1355 .5332 · :~ '3 '32 · 1;375 · 0034 . !{7=.~ ·1333 .9551 .gSO0 .~867 · 1357 · 02~.3 3.12~5 1.~500 10.7080 0.0~47 !?!.052~ S ?< STST LL] T~qS tlfd ~LS wq~'3 TJ~3 LOT~ 3TST LLD qT E '4 NP ~l TS~S CAL~' LZT-t TE'qS MT~q LDTL T~NS LL] SiS T~S CALl LZTq QLS SSR !8,~3 159 · ? 357 T = ~ S 34,57!03 46 ~ 1. Z 3 J 0 ~'! 4.02~2 LL 127.1522 SSi 75.7/73 49~7. 2503 3R -9~9,2500 TENS 72.5273 51,2517 5175,2500 i 97. O 52: T E N S 1F5.7 ~,'75 SSq 2i,~.I ~'75 3V3 !55.S367 TENS 4.3'~45 NCN~_ 5011.2500 MR2S ~ °~:I0 LL ~.~,0~30 SSi -0,0~4~+ T~qS ZT, E; ~i :~ CG ~ 5071.2500 24.7030 75.7773 51,59'92 : :'~7, ~SOO O.!il6 255,6~06 Z42,6~75 5257,2500 ~?,OlI7 233 .~375 9.33~8 -~9.2500 - -~'~.2500 ~911..~500 ~4.5273 76.7773 5~55, .~500 13.3521 37:5.3906 5111.2500 6127.2500 0.1221 2.64~7 101,33:~8 1~9.4375 50¢7,Z~00 9.6191 ~1.76!7 1.4395 -999.2500 4891.2500 14.2520 13.8591 49~!.2500 17.45B8 229.t875 ~!1.2500 33~3.5000 0.1226 ~.5~87 !34.7!~8 20,3.1~75 5011,2500 26,2080 lOT:, )l' 'I'DT )T )T5,3 )EPT ;P )i.3 IRaT .U ~RES IR'ZS )T )T )EPT ;P )13 IR~T :CNL )R 't 3 .U ;S Z 4RES ~RES ;ALI )T 4DT )T )TS] ]EDT ~P :CNL qT z - ~9 6 5 i270 -? 15 521 17 20 27 2 - ~9 5 5 1250 7O5 16 19 36 0 52 52 O.OOO0 LLS 1.0352 SV] 8,0525 1.1%3~ 9.2503 3R 3. I 575 S O.OD2~ 1.3!25 2.123~ qT~q 0.~395 TH2~ 8.1143 0.1245 MTEq 9.2500 3.2517 ]TL 0.0000 6.~92 DTL ~.0t17 DTS~ .ODO3 LLS .3125 .9702 .1 S75 gq .336~ 'DP~i .6~75 CS ,8905 355 .1233 .3305 .1367 .1150 HTi'4 .2D51 MR~S .5117 C, TL .3~367 DTL . 0117 tZSO0.O00O tLS -39.2383 SVD 1.0521 4707.2300 JR 167,:~t25 0.1505 2 2Z 155 57 .3799 .3367 . ~i. 17 .53 '5 7 .OT~Z .3!73 .174! .3555 .~79 . 337'9 .5!55 .03?3 .3125 j :j ~ .75!7 . 777'~ . i~92 .0273 5~2 .~JZO 35.2330 0.1250 1.0398 19 2 u !9,2~B5 i, 7090 1 93. 4375 0.01t~ 159 · 3125 7.2234 0.12~5 ~9.251~ 50. 751 ~ 52.!~9g ~9.0273 29 0 27 9 .1576 .1t43 .0351 .0361 .2235 M T: LJT~ 3. TS T LL~ SiD NP qZ 0.3774 2. I 5,53 W 5 5127. 2500 -7 ~ 9.230 O T f q S 20.3335 34.2 ~ 'T 3 3223.2500 SG~ ~ 05~~- _ ~. _3 ~3.7517 ]VD lt5.8117 Tm. NS 1.5525 NCN_ ~571.250'J ~.5332 LL ~.~30 SSI 22.~,31~ !.0 :!<B4 Wlq3 !.g~I5 ~SO7.ZJSO -9~9.2~00 T5qS 18.2393 TE~S 56.!3~7 5311.2330 230.0525 T~'qS 530.3521 37. O 273 rD V ] 15~+.9!17 TSqS 0.4353 NCNL 45~7,2503 M R':2 S 9.2051 RH]5 5.6 '~ 09 L t 33.2 ~'33 S S 1 -0'0!55 TENS 19.41,41 C37 1.21{6 ~i~~ I.~44 ~953,2300 3R 159.8125 TE~S 51.5117 5031.2500 SG~ 1 39. O 5,75 T.: q S 95.0273 3.5095 -9~9.2500 47~3.2500 25.5320 2~.7537 5127,2500 20.6893 ~3'9. 3305 3151.25,90 5)59.2500 3.1226 ,~. 5~,=7 134.2773 195.3125 ~535.2500 3.6895 56.2305 -999.2530 -999.25~0 ~07. 2500 !7. :5830 2.0. ~ O 1 ~q 5t5! .2500 17,1924 428.5~06 4~07.2500 7127.2500 0.1235 2.57~9 95.5898 190.6~75 50. :5 ~ 9 Z t.4~4~ 16.~17~ 44~7,.2500 4697.2500 20,3543 16.5205 4~53.2500 ~0 ~393 'q, 587 , 25,'2, 0 5315o2500 0 · 1250 2,5510 t 59. 3125 .VD 9!0,H02 V~RIi=i'-ATI]'~ LISTIN3 P~: ?~ .U qR~S qR=_S SP 295.1:~'J~ '-S 5~+4,3~05 .iS'3 3. t 25 S S.3905 3.1!65 13.534~ MR_:S 43.2517 DTL. 9.9000 LSD[ ~.0i17 46.~I17 ~TS4 12400,~000 LLS -12,5'~65 5V 152+,5~75 i070.5875 155 ~75 O.9JO0 3P~Z 315,3~05 0.5371 35, ~30 J3N$ 0,1274 MT~q 84,9~23 DTL O,OJO0 LS~ 73,1~23 DTL 5~, 0 273 9T S 12300,0000 LLS -15, g170 SV'3 1,8945 2315.5300 I65.~125 GR 0.3359 3PW'i 271,1~05 LS 0 · 1 Z~5 '4T~q 0,2930 T~]~ 25,8543 0,1274 10,~004 65. 4323 :]TL 0,0000 LS]T 67.$~9~ 3TL ~5,0!73 OTSq 12200,0000 LLS -26,~3g$ .SV) 1t0~.5~.75 1.0~3~ 306 0 157 0 !! 0 ~7 132 *.'2 0 2 ~15 0 i~7 3. t3 153 0 ~.$ .70 1 il 133 0 2 13 t5 255 0 155 1 152 0 55 55 i Z 5 133 0 1 37 ;' 3 3t23 ~,13 ,~7~ ,2357 .!253 5117 .3~57 '~57 ,0£73 .~734 .!27~ .8125 .3027 .7969 .5547 .034~ ,0523 .~OSB ,~92 .lg55 .5273 ,3~57 .$398 .0273 ,3922 ,5518 .!27~ ,i~37 .~252 ,3391 ,3906 ,~317 .931S .5299 .05.31 .$517 ,1205 .7773 .~$23 .~145 .027~ ,250t ,9893 ,1534 LZ1'M S:Sq w4,. q3 ~.! T: '4 3;, LOTL DT $ T LLD Si3 TENS Llrd QLS T~NS LOTL TENS STST ~LD_ M T ': q 37.573~ SG~ ~23,6436 153.3357 I0.~20 2,7755 LL 0.3115 T~xlS 25.~83 1.55§! 1.3563 W5~3 ~511,2500 157.5525 28,5172 TENS 57,027: S'~ ~4:~5.2500 ,SGR 2i7.0525 q- i 3.5 42;8 SGR ~ 5575 ~V3 1:5'2.5517 11,27~3 10.3223 RH]5 2. ~.i 0~5 LL 73.339~ S SI 0· 0005 50 · 2235 C G t,5915 WiNS 4423.2500 GR 17. $ 2 ~2 T E W S 55. ~ 323 S'5q 4,~3 I, Z 500 SS 203.1~06 4~27.2300 5.017,5 ?4.2773 ~. 71 '? 7 31.6~16 ~7.2500 4575,2500 ~!.~50~ 29,~515 54.527'3 ~727.2500 ~021.5000 0.12,50 2.3909 15'9.5875 213.~375 ~271.2500 11.9395 87.454 8 O,O000 Z4.~580 4427.2500 ~471.2500 26.4150 '"'~.7305 457!,2500 30,2236 34,1992 4~23.2500 a975.25o0 0.126.5 2..~514 1~9,9375 212.8125 4327.2500 11.25132 2.7~42 1~,9082 4151.2500 4367.2500 1'7.1875 2!,0205 4423.2500 30,9141 259,3906 45~7.25J0 5723.2500 :CX_ 532?.2500 IT: ',t !,55.i575 ,U EOS. 3125 LS ,S2 270.i~05 ~SS t2~3 53.2517 W3~3 IRES 0.12~ '~Li 9,55;52 )T 55,3S67 }T 61,Oi1T DTL }TZ3 55,01~T ~TEq t'-~'T. 1210'~,. 3303 LLS ;P -10.05~4 SV3 )13 1547.5375 IR~T 1.7~91 :C~L 2~15.5300 !T=~ 154.5125 .O 19,~. 9 ~ 75 L ;S2 Z71.8~05 ~SS IR:S 0.1279 'OT& 0.~395 'A L i ~. 0 ~01 ~q E S )T 60.5367 DT~ IDT O.O00O LSDT )T 6.5,3398 DT. )EPT 12OOO.OOO0 LLS ;P -599.250'3 SV3 )I0 -999.2500 IR'AT -99'9.2500 RNT~ :CXlL -~9:~.Z500 ~TS~ -~99.2500 )Rq3 -999.2500 .U -999.2500 LS ~S2 -999.2500 ~RES -999.250~ ~DT~ -~99.2500 TH37 ~2'~ -999. ZSO0 ~RES -~99.2500 ~A~I 20.4~2~ MR~S )T 91.2773 DTL ~DT -99:~.2500 LSDT )T -~99,2300 DT~ }TS] -~99.Z500 DTSq i 2.35 ! 3 31,2236 3.4!~0 238.5575 L!T~ 154.8125 I.~503 150. 3517 0,1289 59,0117 50, ~B67 L3F_ 53,1357 112,0273 giST -9:99,150J LL~ -999,2500 MT~M -999.2500 NPql -9 ~ 9.2 50 0 T ~ q S -9~9. 2500 CALl -999,2500 -999,2500 LiTq -9~9,2500 QLS -959,2500 -9~9,2500 -9~9,2500 LOTL -9~'9,2500 3TST 4.Z~90 LL &l,55~'? SS! 34.717~ 2,757{ 4,5~23 W5~3 ~537.2500 155.~125 32.~5~7 T~NS 57.5117 4727.2500 !04.0525 TENS 57,7i8<+ ~2O.lgO5 16!.2~7 T;NS l 0 ~ '~ 0 4653,2530 '~S B. 914 '~ L L 31 · 92 5 ~ C G 2,5530 3.4355 W5~3 ~315. 2500 154.{~!25 f~S 33.5530 T~qS 57.~957 SS~ ~795. 250n,~ SG~, 7 } 4,0525 r E q S -9~9,2'500 TENS -9~9.Z500 NCqL -~9,2500 MRSS -999.2500 -5~9,2500 Lit -9~9,2500 SS1 -.~99,2530 TENS -999,2500 -999.2500 -999.2500 -999.250:) 163.1575 TENS 105.9570 -~9.2500 SG~ -999.2500 2,5331 135, :3998 ! 94, :~ ! 15 I12,&023 32,3672 43~7,2500 3~,5357 ~)!.250~ ~ ~ 1541 Ii7.777~ 47~7. 2500 5339,2500 3 I~'79 2,5506 109. !5 23 --, · q-553,2500 1.2,9&57 104,~6~8 t,~741 30,2197 ~497,2500 4431,2500 55. ,5 055 31,3799 ~8!5.2500 -999.2500 -999,2500 -999.2500 -999.Z500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999.2500 -999.2500 -999.2500 107.777~ 4061,5000 4415.2500 -999,2500 -999,2500 -999.2500 )EPT !1908,0000 LLS -9.-~9,2500 LLD -999,2500 SG~' -999.2500 iP .U ~RES DT )T )TS2 - 9 2 :~. 25. 0 J I -~9.Z50} SS! -~}9.2590 -9'}9.2 5OO ~1~ -} 9'3.2 530 -9~9. 2500 -~}3.ZEO0 TEWS -~,~500 TENS -999,2500 -~9.2g00 - 93 :~. 25 J ;3 T ~ q S - 939. ZS'SO - ~'~ 9. Z 503 --)99.2500 - ~ ~ ~ . Z 5 O O - ~9'9. 2500 -~99,Z500 -'993,2500 -999,2500 -999.2500 -999, ,~5o0. - 999.2500 -~399. 2500 -9~9.Z500 ....-,,- FiLE TR&IL-R :iLE ~,',1 &. ',1 E :EDIT iE~vlC= Ne~q~ : /E~SIg~ ~ : )ATE : 4AXZMUM LENSTH :iLE TYPE : ~EXT FILE ~AM~ : FILE HE~DE~ E N & q E : E O ~EqVICE NA~E /EqSiJN ~ : }4TE : ~XIMUM LENGTH :IL~ T~P,r- : >R~qlJJ~ FiL~ .005 1024 .VP 313.~0£ V=RiFi-&Ti.3~,~ L"'$TiN..% P'..iS':. 37 'NT.iY 5LDj'(S -- ] INErt $=~VI'"E $=_:~V.iC,: F,. ;~ T TE;'4 ~L =f -5 1 1 1 7'3 ~DSESS (DSTAL) 03330333000000 00300030033000 OOO00330000000 OOOOOOO0030OO0 00000030003300 03300000000000 03300003003000 30000033000000 I1'_'- 3AT~ T T 1' T t' T T 13t80.~570 -999.2500 13100.2~10 HTE~ 102~.6575 !3000,2~10 962,3125 12900.2~13 967.8125 12800.2913 HT~W !2700.2~10 HTEq 887.8125 HT~ 12500.2910 909,3i25 HTE7 1ZSOO.Z~i~ HTE~ 930..8125 I02S.5575 1132..5~75 -9~9.~500 9~9.8125 -9)9.2500 919.3125 -9~9,2500 !0~5.5875 ~:8. $125 55').3t25 HTEq HTEN HT~N ~TE~ ~TE~ HT~ HTE'~ HT~ ~T~,~ ~T~q -~99.2500 !08!.6~75 i I!~ ~75 751.9t!5 943,3[25 531,:5125 937,8125 556,81215 13011.512.5 54-{,3!25 10,38.S575 ~3:0.~i25 594.3125 830.3125 HTE~ HTEN HTE~ HT~ HTE~ HT~q HTE~ ~TE~ HTE~ -999.2500 555.3125 1205.6875 597.8125 1081,6875 575.3125 .933,8125 656.8125 953.8125 630.8125 i035o6~75 602.3125 909.3125 594.3125 '~'30.~125 539.3125 .VO O1S.nO2 VE~ZFIC~,TI]:4 LISTi,~i3 D~.]~: )-EST 12300.£~13 tT-ZN 77~.5!25 ~T~ )L~T 1ZZO].Z313 ~T~ )~PT 12333.Z~tO ~T~ )E~T Ii900.2~1S iT~ -~'99.2503 JEST 11700.Z~13 )E~T 11500.2:;10 ]E~T 11300.Z313 ~T~ tTS~ -999.2500 )EPT IlZDO.Z~IO tTE~ -999.2500 HTS~ )EPT 11100,2313 )E ~ T 11000. Z :~ 10 1TEN -999.2500 )EPT 10900.2910 tTS~ -999.Z~03 }E ~ T 10 80 O. Z 910 tTEN -999,Z~00 MTS'~ }E~T 10703.1~10 ]EPT 10500.2513 5~.3.3125 77~. ~iZ5 437.3~06 935 , 3125 B,!Z.3125 ) 56. O :] O 0 5~9. _~750 -99~. 2503 -9 ~. ZSSO -9.)9. 2~OO -9~9.Z~00 -9 ~, 2'500 -9 ~9. ~ 500 -9 ~ 9.2 ~ 0 O - ~ :~9.2530 -':~.~9..~ ~50, 0 -9 ~ 9 . 2500 -9 ~9.2590 -99~. ZSO0 _.~ -9 ;:}9. Z500 -9 ~ 9.2 '~ O O 7:~5.SI:Z5 5 -~ 4. I 2 5 ¢,3:~ ~i~ ~9.8123 539.:~JOO ~20.~125 -39:9.Z500 -~. -9'~9. ~500 -~ :)9.2 5 -9 )9. Z 503 -9~9.2S00 -9 ~9 · 2500 - 99 9.250 O - 9 ~ 9. ~? -9,~'g. Z 5 O0 -9~9.2 5 O0 -999.2{00 -999.2500 -999. Z -999.2S00 -~9'9.2530 - ~.. 99 ~. 2 5 (} -"~ ~ '~. 2 5 ~,TEq HT .E- '~TSq :'iT _: ',t '~TEq 'iT = ~- T = kt HT~i HTEI HT~ HTEN HT5 q 8T~q ~T~ ~ ~TE~ HT'~ MT E ',J 73~.8i25 779. 31 25 539.3125 g&! .317,5 5'~9.5030 936. 5390 -9~9.Z530 -999 , 2500 - 999,2500 -9:99,2500 -999. ZSO0 -~99.2500 -999, ~500 -999.2500 - 9 g 9 . 2500 -~999,2900 -999.2500 -999,2~00 -999.2500 -999,2500 -999,2500 -999,2~00 -999.2500 -999,2500 -999,.~500 -999.2500 -999.2500 -999. 2500 -999.2 5'JO -999.2~00 -999.25'30 10500.2910 -999.250~ i0~00,2~i0 10309.2~13 10200.2913 lOlO~.~gO~ -999.2500 -iT = ,.~ 'IT :: HTEN :iL~. N~,qE :EDIT .005 ~E~VIC-' NAv~5 : tE~S!GN ~ : )ATE : qAXZMUq LENGTH : I02~ :!_E TYPE : ~EXT ~Z~E ~A~E : -999.2500 - 9'99.25 O 0 -999.2500 -:~99 · 2500 -9-)9,2500 -999.2500 -9~9.2500 ;=,,. FILE HF-&D-R:. :ILE N~qE :EOi¥ $ERVIC~ N&ME ~E~SION ~ : DATE : 4AXiMUM L~GTH =ILE ~TYP~ : >REVIOJ5 FILE .906 1024 .V; 010.H3Z V(21FiCafi3~ L!STIH" ~a~E 43 :NTqY ~LDC<S Ty~~ -- )At" JM 4N- ',4 I'PL. --ATT :VD :VJ ¥ ¥ 00 33 3O 73 033= =~CESS 00000000030000 00300933000090 30300033300000 00000030003,900 030;33030030000 03500030000003 ;-' ;',: ]AT~ )E~T =VD )E~T =VD' :VD }EPT =VD )EPT :V~ DEOT :VD )EPT :V] ]EPT 13154.3320 -999,2500 FVJ 13100. 1560 TPL 13300,1560 TPL -999,2500 FVJ !2",900.1563 TPL -999. 21500 FVj 12~00.1560 TP, -999.2500 1~700,t660 TPL -999.2.500 FVj 12500.. 1560 fP_ 0'335Z FVJ 12500.1553 TP~ 9.5 S 84 F V J 12~00,I$63 TPL 0.33'89 =Vi 12300,15.53 TPL -}99.2500 -999,2500 -999.2500 -999,2530 -999.o5,. -9)9,2~00 -9~9.2503 10.8301 0.2~37 i0.3}25 0.475:1 ii.I¢2~ ~ATT ~:~ TT EATT E~!fT EATT -999.2500 -~59,2500 -9~9.2530 -9'~9.2500 7 .~. ! 523 1)7.1523. . ~P~l -929.2500 -999,2530 -999,!500 -'299,2500 -999.2500 7.1777 !t,7575 17,43i5 ,v~ Oi3.~OZ V{~!PiC~Ti]~ LiSTiq] ~S~' il :VD 3.417J FVj ~T 122~9.1560 :¥D D.2725 )~T !2133.1553 :VD 0.2?93 )EPT 12000.166] )~PT !i:~I1.~3£j TP_ =VD -3.4Z97 i 02 ~ ~;;= TAP5 TR&iL,=.q_ .,.:,. SERV!C~ N.'& ~ E :EDIT ]AT~ :.35/05/15 ]RiSIN :FSI~ 'O~TINO&TiON ~ :01 SERVICE NAqE :ES'IT DATE :85/05/16 3RIDIN : ~E~L N~E :t4~3122 CO'4'T IN'J&Ti ON ¢ NEXT REEL NA'4E : ~O'4q~NTS :SCHLUqS;~RSER 53.~7~2 !.5.502 3.3273 7. "', 2 ,~ 5 5'3.35~4 W~bb NA~E FIELD NAME STATE APl NUMBER ~EF~RENC~ NO t P~UDHO~ BAY/LISBURNE POOL I IJ~A I 88109129 RFEL NAME : 72g46 REE~ TAPE HEADER OOS TA FILE HEADER : .00! ~ : 1024 : LO *SC~LUMBERGKR OFFSHORE SERVICES ANCHORAGg DIVISION COMPUTING CENTER :THI~ F~G~ COMTAIN5 REP~OCESS~D CNT-H NEUTRON POROSITY CURVE~ SFROM ARCO LISBHRNE bGI-8 ORIGINALLY RECORDED STHE CURVES INCLUDED .CA[,I.CnT - CALZP~R f.O~ bDT (~AIN $CAE, I,LDR - CALIPgR FROM LOT (REPEAT PASS SNpHI,CNb - NEUTRON POROSITY ~S ORIGINALLY RECORDED USING CSU ALGORITHM SNP~I,CNR - N~UTRON POROSITY AS ORIGINALLY RECORDED USING CSU ALGORITHM $ (REPEAT PA~S) $NR~T,CNL - NORMALIZED RATIO (~AIN PASS) SNRAT,CNR - NORMALIZED RATIO (R~P~AT PASS) Tape Verification Listing ~...Iuaberger Alaska Comptiting Center 2g-SSP-lg88 15{]4 W~THOUT HO[E'C~ORRECTION AND W~THOUT ENVIRONMENTAL COR~E~T~ON ~NPHi,TL2 - NEUTRON P~RO~TY $ C ) - '~NP~i.TL3 - NEUTRON P:OROSITY RECO~P!T:E~ $$. WITH CAIn!PER HOLE CORRECTIO~ AND W~THOUT ENVIRONMENTAL' CORRECTIO~ .T:L4 - NEUTRON POROSITY RECOMPIITED PRE:CNTiA~GORITHM $ ' WIThout HO~£ ~ORR~CTION~ND wfT~ ~NViRONMENTAL CORRECTIONS $ (MAIN PASS) - $'NPHt,TLS- ~EUTRON POROSITY RECOMPUTED USING.CONVENT:IONAb PRECNT AbGORIT'H:, , WITH BIT SIZE HOLE CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS $ (MATN PASS) - SNP~I TL6 - NEUTRON POROSITY.RE{OMPUTED USING CONVENTIONAL PR:E{N~ , "[~H CALIPE~ BOLE'~0RRkC~ON AND WiTH ENVIRONMENTA~ CORRECTIONS ~ (MAYN PASS) - SNPHI,TR1 - NEUTRO~ POROSITY RECOMPUTED USING CONVENTIONAL PRECNT ALGORITHM , WITHOUT HOLE CO,RECTION AND WITHOU~ ENVIRONMENTAL CORRECTIO N ~ (REPE~T PASS) *NpHI.TR2 - NEUTRON POROSITY RECONPUTED USING CONVE:NTIONAh PRECNT ALGORITHM ZB TION AND ENVIRONMENTAL CORRECTION * WITH BlT SI HOLE CORREC WITHOUT (REPEAT PASS) $NPHI,TR3 - NEUTRON POROSITY RECOMPUTED USING CONVENTIONAL PRECNT ALGORITHM , W~TH CALIPER HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION , (REPEAT PASS) *NPHI,T~4 - ~£UTRON POROSITY RECOMPUTE~ USING CONVENTIONA~ PRECNT A~GOR{THM * ~' ~ITHOUT HOLE CORRECTION A~D WITH ENVIRONMENTAL CORRECTIONS * (REPEAT PASS) $NPHI,T~5- gEUTRON POROSITY RECOMPUTED USING CONVENTIONAL PRECNT ALGORITHM * ' W~TH BIT SIZE HOLE CORRECTION AND WITM ENVIRONMENTAL CORRECTIONS * ("EPEAT PASS) *NPHI,T~b - NEUTRON POROSITY RECOMPUTED USING CONVENTIONAL PRECNT ALGORITHM , *ITH CALIPER HOLE CORRECT[ON AND WITH ENVIRONMENTAL CORRECTIONS $ (REPEAT PASS) PAGE~ iS Tape verlftcatl, on LIsting :hlOmherqer AlasKa Computing Center 2g-$EP.~O88 15:34 PA~E~ *NPHI,AL1 - NEUTRON POROSITY RECOMPUTED USING PRECNA ALGORITH~ ~ W~THOUT HOLE C(~RECTION AND WITHOUT ENVIR. ONMENT~[~ ON ~ (~AIN PASS) ~NP~I,AL2 - NEUTRON PORSSlTY RECO~PUTED USING P~ECNA AL~ORITH~ ~NP~I,A~3 - NEUTRON POROSITY RECO~PUTED USING PRECNA AbGORITH~ ~NPMI.AL4 - NEUTRON POROSITY ~ECO~PUTED USING PRECNA ALGORITH~ *NP~I,AL5- NEUTRO~ POROSITY RECO~PUTED USIN~ PRECNA ~ WITH BIT SIZE HOSE CORRECTION A'ND WIT~ ENVIRONMENTAL CORREC?I:ONS~ ~ (~AIN PASS) - *NP~I.A56 - N~UTRON POROSITY RECO~PUTED USING P~ECNA AbGORITHN $ WITH CALIPER HOLE CORRECT!ON AND ITH ENVIRONM:ENTA5 CORRECTIONS , (~AIN PASS) - ~NPHI,ARI - NEUTRON POROSITY RECOMPt!T~]D USING PRECNA ALGORITH~ $ WITHOUT HOSE CORRECTION AND WITHOUT .ENVIRON ENTA5 CORRECTION , (REPEAT P.~$S) $~P~I.~2 - NEUTRON POROSITY RECO~PUT~D USING PRECNA ~ WIT~BXT SIZE HOLE CORRECTION AND WITHOUT ENVIRONMENTAb CORRECTION ~ (REPEAT PASS) ~NPHI.AR3 - NEUTRON POROSITY RECOMPUTED USING PRECNA ALGORITHM ~ WITH CALI~ER HOLE CORRECTION AND ~ITHOUT ENVIRONMENTAL CORRECTION ~ (REPEAT PASS) ~NP~I.AR4 - NEUTRON POROSITY R~CO~PHTED USING PRECNA ALGORITHM $ WITHOUT HOLE CORRECTION AND WITH ENVIRONMENTAL CO~RECT~ONS ~ (REPEAT PASS) *NPHI,ARS- NEUTRON POROSITY RECOMPUTED USING PRECNA ALGORITHM $ WITH BIT SIZE HOLE CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS * (REPEAT PASS) ~NPHI,AR6 - NEUTRON POROSITY ~ECO~PUTED USING PRECNA * WITH CALIPER HOLE CORRECTION AND WITS ENVIRONMENTAL CORRECTIONS * (REPEAT PASS) , ! ati, on Llstino Center PAGE~ · NPOR,AL1 - ENHANCED RESOLUTION POROSITY RECDMPUTED USING PRECNA ALPHA PROCESSING · W~THOUT HOLE CORRECTION AND ~THOUT ENVIRON ON ~ (MAIN PASS) - ~NPOR,AL2 - ENHANCED RESOLUTION POROSITY RECOMPUTED USING PRECNA ALPHA PROCESSING · BIT SIZE HO5~ CORRECTION AND W~THOUT EN E · NPOR,AL3 - ENHANCED R~SOLUTION POROSITY RECOMPUTED USING PRECNR ALPHA PROCESSING · WITH ,CALIPE~ ~OLE CORRECTION AND WITHOUT ENVIRONM:ENTA~ CORRECT,:ON · (MATN PASS) :NpOR,AL4 - ENHAN..f,D RESOLUTION POROSITY RECOMPUTED USI G PRECNA ALPHA PROCESSING .i~.~:: ~HOUT HO~E CORR~CT~ON AND $ (~AIN PA~S) - ENHANCED R~$ObUTION POROSITY ~ECO~PUTED USING PR~CNA ALPHA ~TH ~IT :SI~E HOLE ~ORR~CTION AND (MAIN PASS) - · NPOR.AL6 - ENHANCED RESDbU_ION POROSITY R,E~OMPUTED U~ING PRECNA ALPHA PROCESSING · ~ITH ~ALIPER HOLE C~RRECTION AND m (~A~N PA~S) - · NpOR,A~I - ENHANCED RE$OtUTION POROSITY RECOMPUTED USING PRECNA ALPHA PROCESSING $ ~THOUT HO~E CORRECTION AND ~ZTHOUT ENVIRONMENTAL CORRECT,ON $ (~EPEAT P~SS) - · NPOR,AR2 - ENHANCED RESOLUTION POROSITY ~ECO~PUTED USING PRECNA ALPHA PROCESSING · HITH BIT S~ZE HOb~ COPRECTION AND WITHOUT ENVIRONMENTAL CORRECT, ON · C~EPEAT PASS) - · NPOR,AR3 - BNHANCED ~ESOLUTION POROSITY RECOMPUTED USING P~ECNA ALPHA PROCESSING · WITH CALIPER HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION · (~EPERT P~SS) · NPOR,AR~ - ENHANCED RESOLUTIO~ POROSITY RECOMPUTED USING PRECNA ALPHA PROCESSING $ W~THOUT HOLE CORRECTION AND ~ITH ENVIRONMENTAL CORRECTIONS ~ (REPE~T PASS) · ~POR,ARL- ENHANCED RESOLUTION POROSITY RECOMPUTED USING PRECNA ALPHA PROCESSING · WITH BIT SIZE HOLE CORRECTION AND ~ITH ENVIRONNENTAL CORRECTIONS · (REPEAT PASS) - · NpOR,~R6 - ENHANCED ~ESOLUTION POROSTTY RECOMPUTED USING PRECNA AbPH~ PROCESSING m W~TH CALIPER H~E CORRECT,ON AND WITH EN¥IRONHENTAL CORRECT~ONS · ("EPEA'f P~SS) , IS Tape Vertflcation LlStinQ ~hlumberqer AlasKa ComputinQ Center 29-SEJP-! 988 15:34 PAGE~ TABLE TYPE .' CONS TUNI ,,ATT VALU A PRUD:HOE BAY/bISBURN.E POQ~ NORTH Sb:O:PE ALASKA USA8, 118 ~ FSL & t668' FWL 1 11N ! 4E DEFi ame r ProVince WARNER ? I~ 5 52 TABLE TYPE : CiJRV N~HT NPHT N~HT NPHT NPH! NPHT NPH! NPH! NPH! NPH! NPH! NPHT NPHT N~H! NPH! NPH! NPH! DEFI D~PTH CHANN~b NAME Cai(per Caliper Neutron Ratio (ND/FD) Neutron Ratio (ND/~D) N~UTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROS!TY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY ~EUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY NEUTRON POROSITY 2 .c}~sEtP-1.. 988 15:~4 DEFI NEUTRON POROSITY PAGEI NPH! NEUTRON POROSITY POROSITY OUTPUT FROM AN APPb!C'ATION PROGRA.~ NEUTRON POROSITY OUTPUT FROM AN APPLICATION PROGRAH NEUTRON POROSITY OUTPU AN A:PP~ZCAT~ON:PROGRA~ ** DATA FORMAT SPECIFICATION RECORD SET TYPE .- ! 66 0 2 66 0 3 73 172 4 66 9 65 11 66 S 13 66 0 14 65 FT 15 66 68 16 66 0 66 0 ** SET TYPE- CHAN ** NAM~ SERV UN!T SERVICE APl AP1 APl AP1 FIbE NUMB NUMB 8IZE REPR PROCESS ID ORDE~ g bOG TYPE CLASS MOD NUMB SAMP EbEM CODE (HEX) PgPT FT 14g312 1 I ! 4 68 0000000000 CAb! ~DT I~ 149312 280 O! 0 i 1 I 4 68 0000000000 CAb! LDR IN 1493~2 280 01 0 i I 1 4 68 0000000000 Tape VerlflcatJ. on Listlno :hlumberger Alas~:a ComPuting Center ORDER ~ hOG TYPE c~A~s MOD NU~ SAPP ELEM CODE NPH! CNL NP 149312 PU 34931.2 PU 149312 PU 149312 N~OI~ AR4 NPOR AR5 NDO{~ AR6 )493 1493.12 149) 12 14! {12 PU t4~ P U PU PU I 312 PU 149312 PU 149312 PU 149312 pi! 149312 Pt) { 49 1 4 PU i49312 49312 PU PU 149112 2 Pti 149 2 P,! ,49112 PU 1,493 PU 14931~ PU I49312 2 0 Ol 0 1 90 oO 0 890 O0 0 890 O0 0 890 00' 0 890 O0 0 890 O0 0 1 890 O0 O 1 o° Oo 890 O0 O: l 890 O0 0 1 890 O0 0 890 O0 0 890 O0 890 O0 90 O0 90 O0 oo ~o oo g O O0 O 90 O0 0 890 O0 0 8go O0 0 l 890 O0 0 i 890 O0 0 1 890 O0 0 1 890 O0 0 1 890 O0 0 890 O0 0 1 890 O0 0 1 890 O0 0 1 890 O0 0 1 1 I 1 I 1 I 1 1 1 I 1 I 1 I I 4 68 4 68 4 68 4 68 4 68 4 613 0000000000 0000000000 0000000000 0000000000 0000000000 0000000000 0000000000 DEPT, 13150,000 CAhI.LDT NRAT,CNR 1,157 NPHI.CNL NPH~,TL2 28,756 NPHIi?L3 NPH ,TL6 33,020 NPH! NDH~,TR4 3,076 ~PH! NDH{,AL2 27,895 NPH! AL3 3 33 2 2 27 555 CAbI,bDR 2 105 NPHI,CNR 7 756 NP~{.Tb4 31 261 NP ,TR2 2 525 NPHI,TR6 895 NPH~,A~4 26 561 NRA~,CNb """l; NPH ,TR3 NPHI.Abl NPHI;Ab5 :744 Tape verl~f¢atlon Llstin~ hlu~berger Aleslca ¢o~:put1~O Center NP AR4 DFP~ NPA?:CNR NPHI,TL2 NPHT.TL6 NPH 4 NpHI'TR NPH!,AL8 NPH! AR4 NPO~ AL2 NPOR AL6 NPOP AR4 13100 000 15 I 8?6 ! 1300i3 O0 40 43 36 33 28 154 12900 000 ! 055 I 323 o 985 2 386 2 0 ~46 1. 42 12800,000 1,389 6 52! 6 515 6 531 9 586 6,9.53 5°064 12.248 9,340 5.399 CALI.LDT NPHI NPHI NP ~5 CAb! LDT .NPH! CNL NPH! TL3 NPHIi~TR! NPHI TR5 NPHX Ab3 NPH! AR! NPHI~AR~ NPOR AG NPOR AR~ NPOR AR CALI.LDT NPHX,CNL NPHI,TL3 NPHI,TR~ NPHX.TR NPH! AL3 NPHI:AR1 NPH~AR5 NP0R.Ab3 NPORoAR1 NPOR.AR5 CALI.LDT NPHI CNL NPH! TL3 NPH! TR1 NPHI TR5 NPH! AL3 NPH! AR~ NPHX,AR5 NPOR.AL3 NPOR.AR! NPOR.AR5 29-S~:;P-1988 15:34 3 779 2 455 2i 895 1,3 19 20 32 30 30 599 28 345 166 221 808 34i 665 485 294 880 6~7 51,8 176 894 767 320 020 787 038 23 ~49 372 NPH!. AR2 PH:I, AR6 PORTAL4 N POR, A R 2 NBOR · AR 6 PHI, Tn b I LDR Th4 CAb!. LDR NPH~CNR NPH . TL4 NPH~,TR NPH , NPH NPHX, AR6 NPOR.Ab4 NPOR,AR2 NPOR,AR6 CALI.LDR NPHI.CNR NPHI.Tb4 NPHX.TR2 NPHI.TR6 NPHX.~b4 NPHI.AR2 NPHI,AR6 NPOR,Rb4 NPOR,AR2 NPOR,AR6 558 NPHX.AR3 6' NPOR,:Abl 12,689 NRAT CNL 294 NP NPOR~ AR~ 9t9t6 NRAT. CNL 30 26 9 ,369 0 2 668 I 157 9.549 .395 .286 ~,767 ,675 ?,796 6,537 4,279 10,271 6,895 4,601 NPOR 3 NRA? CNL NPH! NPH! R3 NPHX NPH! NPHI AR3 NRAT CNL NPHI;~R3 NPH ,ALi NPH!,Ab5 NPHX~AR3 NPOR NPOR Ab NPOR AR3 PAGEI -3¸ 604 '2'9 2. ~,7 8 2,295 1.439 864 6~35~ ~S ?ape verification Listlnq :hlumberqer Alaska Computinq Center DEP?. N! DEP? NPH) NPH! NPHT Th6 AR4 AR4 6 AR4 TL6 AR4 AR4 CNR ?L6 ?R~ ~L6 CNR AL2 700-000 ! ! 1 O4 t 26O 0 0 0 0 0 0 -0 0 487 12500 1 1 2. -0, 1 486 2 853 -0 130 I 565 12400,000 2.342 20.945 21 37 22 266 ~2 276 26 204 22 283 21 12300.000 2,379 , 44 ,950 .448 CAbT.LDT NPHI,CN[, NPHI.TL3 NPHT.TR1 NPHI.AG3 NPHI,AR NPOR.,A~3 NPOR,AR1 NPOR,AR5 ~A.R i N P:OP ~ A R 5 ~D NPHI Th3 NPH! TR1 NPH! ?R5 NPH! .Ab3 NPH{ NPH AR5 BPO~ AR. NPOR AR5 CALl LD~ NPHI NPHZ TL3 NPHT TEl NPHI TR5 NPHI AL3 NPH! ARI NPOR A 3 NPORiA~'. NPOR AR5 CAbI.LDT NPHI.CNL NPH! Th3 NPHI:TR1 NPHI.TR5 NPHI.RL] 29-SEP-1988 15~34 PA. GE{ ,244 CAblibDR 025 NPHI, CNR 54. t iNPOR. A:R:6 970 NPHi iAR6 : :0 490 062 8O8 ?R6 Ab4 P'H.I.RR2 PH{~AR6 N:POR.A'4 NPOR,AR6 0 275 9 1 20 25 22 23 21 830 189 860 001 758 171 200 417 275 DR PH , NPH! ?~4 NPHZ~TR2 NPHZ,TR6 NPH~.A~4 NPHI AR2 NPHI:AR6 NPOR,Ab4 NPOR,AR2 NPOR,AR6 9 I8 22 2O 2O 23 24 20, 213 .46 6 6 NRA? NPH! NPH! NPH! NPH! NPH! NPOR NPOR NPOR ,TR3 9.932 12;64b 13,677 20,603 22.39~ 16,51 NPHI.¢NR NPHI,?R6 NPHi. Ab4 t0,322 18.213 1~,505 2 ,603 21,024 14;934 NRA?,CNL NPHI.Ab) ! ! 22,788 26,$60 23,812 il 974 582 15 041 Ye ! 29-8EP-1988 15;34 PAG~ lO NP( DEP? N~'A? NPH! NPH! NPH! NPO~ DFP? NRA? NPH! NPH! NPH! NPHI NPH NPH! NPOP NPOR NPOP ,2 6 AR4 AR4 TR4 AR4 CNtR T. R4 AL6 AR4 AR4 R4 AL, 2 AI,,~ AL6 AR4 :ion List, ino putin4 Center 18,846 1220~, 000 , 094 2, 049 i; 398 8?8 ]210~i000 8 12000 000 -999 25 3'5 50~ 30 797 -999 250 33,98i 23,~92 999,250 33,344 22,593 999,250 11950,000 -909,250 41.118 44'022 -999,250 38,534 36.417 -999,~50 38. 34 36.417 '999,250 CA b NPH ~PO~ NPOR AR5 CALX,LDT NPH! ~b NPHI,TL3 NPHX NPH! Ab3 N'PH! NPH! AR5 NPOR,AR1 NPOR.AR5 CAUI.LDT NPHI.CNL NPHX.TL3 NPHI,TRI NPHi.?R5 NPHI.Ab3 NPHZ,AR1 NPH~,AR5 NPOR.AL3 NPOR,AR~ NPOR,~R 2.1 1 21 19 NPHI,AR2 NPOR AL4 NP NP 10 ] 072 CALI.bDR 12~ ~pPH'I:.CNR 17 :{ HZ'Th4 9 025 CAL 992 17 27 27 -99? -999 -999 -999 27 -999 -999 563 250 250 211 250 NPHX,CNR NPHX,Tb4 NPHZ,?R2 NPHi,TR6 NPHI,Ab4 NPHX,AR2 NPHX,AR6 NPOR,A64 NPOR,AR2 NPOReAR6 , 40 -999 -999 -999 -999 38 -999 -999 775 8 ~0 2~0 16 NPH),CNR NPH~,?b4 NPHX,TR2 NPHX.TR6 NPHI.ib~ NPHI.AR2 NPHI,AR6 NPOR,Ab4 NPOR,AR2 NPOR,AR6 20.983 16'651 15.895 AR3 9 822 NRAT, CNL 9 04i NRA?,CNC -999 -99:9 38 -999 -999 250 50 NRA! CNL NPH ~ NPH NPH~ .i,',' NPHI flPOR NPOR. AR3 '999,250 -999,2~0 45,670 :999,250 999,250 -999~250 -999~250 NRAT,CNL NPHX'~L~ NPH~., NPHX, eT'R3 NPHI,RL! NPH!,AL5 NPH~IAR3 NPORiAUI NPOR,RbS NPOR,RR3 19 1 o, 3 . 999,250 ,,,999 250 93O :hlUmberoer AlaSKa Co~uutlno Center 29-SEP-1988 15:34 PAGEt END OF r~ATA ** **** FILE TRAILER F~b~ NA~E ~ EDIT ,001 E : rbIC ~001A02 REC S~Z~ : I024 TAPE TRAILEP **** : 8 /29 NAME # : 1 US TAP~ MT : EDIT LIS,ARCO PRUDHOE BAY/LISBURNE POOL- bISBURNE bGI-8, APIN ~** REEL TRAILER ~ERVICE NA~E g : 29~6 iON # : ~L : COMMENT : ~DIT LIS,ARCO PRUDHOE BAY/LISBURNE POOL, VP OiO.H02 VE~iFiCATION LIST!N3 P~S~ i REEL HE~$:ER E2ViCE NA'4E :F. SiT &YE :851051 3 S I N : ~EL NAME :i~93!22 QNTINJ~TI~N REVIOUS R~EL : TAPE ERV!CE NAM~ :EDIT ,~TE :85/05/ 3 RiGiN :FS!A AP~ N~ME :, ~NTINU~TION REViOJS T~PE : SMMENTS :SCHLUq~ERGER gELL S~RVtCES ILE N~= :~O!T .001 E,~VICE NAq5 : ERSI~N ~ : ATE : AXiMUM LENGTd : 1024 IL: TYPE : REVIO~S FIL~ : CO~T~.NTS N E M C C ',~T E NT S Ii~ RES: E PR~PRI=T~R~ FIELD PR3PRIETARY FIELD JNiT J :%', 'l T 030 000 O00 gOO TYP5 000 3'00 000 01~ 005 025 00~ 004 O02 O1Z 005 SIZE 065 055 O55 0-55 355 055 O65 055 ~OOE NUMBER ~T ACC: 71505 PERM~N'ENT O~TjM: MS~ ELEVATIONS: ~1, DATE LO3GED: 28-M~Y-86 ELEV OF PERM. OAT~M: .0 F KS: 52.0 L. B. ~UDNi:Y LDG msASJR~ ' S ~ ' ,_ ,.u F~OM. R~B OF: t.0 D~LG ~EAS:~'RE~ FR~: ~K5 GL: 13.0 P! SE~!~L NO: 5002921SSZ EPTM-DRILLER = 13423.0 = CASiNG-DRILLER = 11955.9 F EPTH-LDGGER = 1317!-0 F CASING-L~GSER = 11950.0 F TM. LgS !NTERV~L= t315~.0 = :C~SING = 9.625 " O~ LOS INTERVAL= 11950.0 F WEIGHT 47.0 LB/~ .V,~ OIO.HOZ VEqlFICATID),~ LISTINg ~A~E 3 SiT SIZE : 8.5 $~TH : 13~+23.0 'YP5 FLJID : ~IGN3 SALT 'iSCOSITY = ~3.0 S 'H : 11.2 :L.JiP L~SS : 7.,5 ~'~.3 'IqE C!RC STOPPED: 2100 (5-!6) 'I'45 LSSGE~ 3N 5Tq.=13~ (5-2?) ~AX REC. TEMP. : 170.~ DF SSURCE OF SAMPLE : CiRCUL4TEO R',I : .413 ~ 59.0 DF R~F : .393 ~' 57.0 P= RqC : .6!8 ~ 59.0 DF CDjoCE,., RM~IR~C,. : 'N~EAS/ME~S., R~ AT 5~T = .154 ~ 17D D: R~F ~T ~HT : .I10 ~ 170. O~ RM: ~T SHT : .230 ~ 170, DF IATRIX : LZM2STDNE tOeN : 2.71 GxC3 ~ : NONE !C : C~.LI :LJID D[NS!TY : 1,0 $M/S3 ',EM~RKS: t/2" STAr, DOFFS ~S'ED.. 3N DLL AND ARRAY Sm-Ni~''~;:~. DID 'NJT 30 T~] BST'TO~ AT CLIENT'S '¢~J;ST .... A 2" ~gLEFINDER A~D 3~' WH;~L~ US5~.~ ON BmTTO~ T3~L C:, ALL LOGSINo' ~JIPMENtT N:,JMSERS$ DLE E 789 DLS F 75~ .~L~, u 751 TCC & 123 SLS VS 81 ~M.'q AA 950 THER qE~SJREMENTS &ND JE C&NNOT~ ~.ND D3 NST GUARANTEE THE 6CC3RACY ~R ORRECTNESS OF ~NY ZNTE~P~ETATIDNS~ 6ND WE SHALL NDT~ EXCEP~ 'IN THE CASE ~F RISS 3R WZLLFU~ NESLZSENCE,.~N 3Uf~ P6RT, BE LIABLE OR RES¢] SISLE FDR ,ANY OSS, C~STS, OAq&G~S OR EX~::~ SES INSURRE9 OR SUSTAINED 5Y ANYONE R~SULTiNG RDM ANY ZqTERD~ETATI~N MAD:E SY 6NY OF OC,~' .DFFZCERS, AG~ENTS~ OR ~I'PLOYSES. mESE ZNTERPRETATZGN.S ARE ALSO SUBJECT TO CUR SE~ERAL T~RMS ~N3 C~3MDIT~NS S SET 3UT IN OJR CJRRENT mRZ'CE SCHEDULE. ' '" "' '~' '" " - .:,.:x..~ THIS DATA HAS NOT.,. SSHLUqS~SE~ LOgS INCLUDE3 N.ITH T.~iS ~: DiaL LSTE~L'BS (~ · ,- L3NS SP&SE~ S3NIC LOS (LSS) ,',~ LITHD DENS TY COMPENSATED L3S CLOT) :;~ C3NPENS~TED ~EUTR3N LOS (CNL) C2M¢a:qSATED ~EgTR]N LOG ~N~LO3 ARRAY SONZ~ (SDT) ARRAY SO~iC CST.C) ~ATJH SPECI~!C&T!ON 5L3SKS INEM SERVZ'E SEqVICE J~IT APl &P.i ~ot ~Pl FiLE SiZE SPL REaR PROCESS ID ORCER ~ LSG TYPE CLASS MiD NO. C335 COST&L) EPT FT O0 OOO 30 9 3 ~ ! 58 90OOOOOOO0000O ,LC DLL 3~MM O0 220 O~ O 3 ~ I 58 OOOO0000000000 ,LD 3LL DHMM O0 220 10 O O b i 5~ 00300000000000 'GR DLL S&PZ O0 310 01 O ;P DLL MY O0 013 O! 0 0 ~ 1 58 00000030000000 RES TE~ C, qL RES TEH R ~LI L U S ITH S2 LS H3R T ~ '4 R ;T ~TL OLL DLL DLL :.~ Lb DLL ~LL ~. NL CNL C ~ L ;'~L L LDT L)T LDT L~T L~T LDT ~ 9T LDT LDT L DT ~ DT L ~ 'T NST ,'~ S T )~ 3 T q ~ T N ST q ~ T q ST EPT EPT SPT LSS LSS ~ aa 000 3 ~ M ~ 00 823 50 0 kS O0 635 21 00 4gO 0.I O0 000 O0 O ~ O0 890 CO 0 S~S O0 330 31 0 C P S 0 0 33 0 3 ,S~:~ I O0 310 O1 L5 O0 835 21 O' D~$~ O0 560 50 '~ 0 u Z 80 I 3 S/C3 O0 355 Ol O O0 35~ O1 0 ~PS O0 354 C ~ ,S 00 354 01 O C ~ S 00 35 ~ CPS O0 354 Ol 0 :SPS O0 OOO O0 0 O0 000 O0 O0 000 O0 0 ~J O0 719 30 0 P ~M O0 793 P ~ M 00 792 50 O "~S OS 310 31 3 ~S O0 310 31 -PS OS 31'~ "~S O0 313 O1 3 ~S~, O0 31u O1 0 ~ '3: 30 5:50 50 _ 3. 03 535 21 3 i ~ o i O O ~ 10 l '~ } C l ~33 3 ~:4Z 30 ~.Z ? 50 O D: G F 00 56 0 dst= O0 523 J ~/f O 0 52 O ~ 0 O 3~Pl O0 310 Oi 0 00300000000000 00900000000000 .vOOO000000O O000OO00000000 00000000000000 03000000000000 00000000000000 00000000000000 O0000000OO0.O00 ~3~0000 0 jO000~" 0 00300000000000 O000000000OO00 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000000000 00000000030000 O00000OO000000 00000000000000 00000000000000 O00000OO000000 OOO00000000000 00000000000000 30000000000900 00300033000000 00300000000000 O~O0000aO0000a OOOO0000000000 O000000000OO00 0030<}300000000 V? OiO.MOE VE~:I-iC~,TiSW L.£STZN3 PAC,~ 7 420 '330 330 310 520 520 52O 520 635 000 RaT CN~ $2 RES R E S T R .$]T ;TL iTS'q t3187.0000 LLS -999. Z 500 SVO -999.2500 MRfS -99 ~. 2 500 RN~ ~ -999. 2500 GR -999.25 O O gA -999.2500 LS -999.25gO ,~ S.S -999.25 O0 ~3 N ~ -99'9.2500 MT a'4 53.0117 DTL -999.2~00 -9~9.2500 -~9;.2500 LJTL - 999.250 O TEN S -999.2500 3TST -99 -99 -99 -99 -99 -99 -92 -9 ~ -9 '9 -9~ -9') -99 :9. 9. 9. 9. 9. 9, 9, 9. 9. 9. 9. 2, 9, 9, 9, Z. O. 2. 54. 263. O. Ol 3J 31 Oi ~0 Z1 ~O ~ 0 Ot BO BO 2i Ol O0 15 2i 5OO 50O 50O 5O0 50O 5O0 500 500 50O 50O 5OO 517 500 5 75O 230 025 37 ~ LLD SZO MTEM NP~I TENS C~' Z L 'l T ~ ~L S TE '~ S g R F C N ~ T~NS T ':N $ C~iLZ LiT~ ~L S SJ ~ - 999. -9 ~ 9. -999, -~9. -999 · -999, -999, -~99. -999. -999, -999. -9 :~ 9. - 999. -9-)9. 17. -999. -9~9. i 7:3, 19. ~33, I3. 3. O. 00000000003000 03300300000000 OOO00OO0000000 00300330000000 00000030000000 O0000OO000OO00 = $~ 00000000000000 I 58 I $~ OOOO00~O~O00000 I 68 00000000000000 i 58 00000000000000 1 58 00000000000000 i 6~ 1 $g O00OO000000000 1 55 00000000000000 i 68 00000000000000 I 6B 00~00000000000 i 6~3 O00OOOOO000000 2500 SGR -999.2500 :2500 DVO -999.2500 2500 TENS -999.2500 2500 NCNL -999,2500 2500 MRES -999.2500 2500 RHOB -999.2500 2500 LL -999.2500 2500 SS! -99'9.2500 2500 TE~S -99:9,2500 2500 CGR -999.2500 2500 Nlq3 -999,2500 ZSO0 W.5~S -999,2590 2500 Gq -999.2500 ~500 TE~ -999 ~500 1299 T~NS 1870.6875 250~ NCN -99'9.2500 2500 ~gT -999.2500 2500 ST -999,2500 2500 DT"] -9~9.:2500 2500 3125 1992 8i42 2300 9150 8713 0029 1357 SGR 61,1367 S'VO 15.7~5! TENS 5103.2500 NC'~L 2285,5000 vRES 0.1221 ~HDB 2,~94c LL 137.9375 SSI 20'9.4375 TENS 4~93,2500 CGR 37.3:~67 VP OlO.H02 VEqiFICATION LISTiN~ P43E ~3 OT'A 1.2207 THJ~ RES 0.1~30 ~Til ali 12.53'95 MR~S T 73,5273 3TL SDT 93.1523 LDT_ ~TL 80.~323 TENS TS~ 1~5.0525 DTS~ ,EPT 13000.0000 LLS .P -30.9014 SVO ~i O 1788.6 ~J 75 :CNL 855. 3125 GR ~T~ 3~5. 3125 ~Rq] 0.1577 3PHZ ,U 500.6~06 LS ;S2 ~52.5~05 ~SS IRES 9.1225 MTE~ '~T~ 1.9043 T~O~ ~2N3 13~R.~375 ~RES 9.1235 MTEq ' A.L i 9.9150 MR E S )T T.5007 DTL ~P~I -999,2500 NRAT ;R - 999,250 O R .SOT 106.2773 LDT~ )T L 64.0273 TE )TSN! 153.0525 DTST )~ ~ T 1290 ~. 30 O0 LL ;P -51.925~ SV3 )13 ~8.1~06 ~RAT 1.051i RNR~ :C~L 5~31.2500 ~T-M 344.1B75 )RH] -0.0083 .U 203.8125 LS ;S2 270.6~05 ~SS iRES 0.1225 MT~q ~OT~ 0,3~15 THOR ~2N5 19.2080 ~ R E S 0 · 1235 'ALt 9.3591 ]T 52.5117 ~i -999.2530 NR~T ;R -999.2500 RNR~ .SCY 53.2517 LDT- )TL 55.07a2 ~TSM 102.0273 C, ST 4.7468 UR'AN 31.5830 W4NS 170.!992 TENS 0. 1216 >ITEM 76. 5523 SR -999.:2500 FCNL -999.2500 TENS -999.2500 SGR 5133.2500 SGR .229.0625 T~NS i7.3738 LL3 5.8406 Si0 0.1235 ~TEM 3.519~ NPHI 58.0892 TENS 58.0895CALZ 27.0508 533.3125 LiTH -0.024'9 QLS 355.3125 SGR 7.2525 UR&N 39.5~30 W4N$ 170.~242 TE~S 0.1216 MTEq 37.1367 GR -999.2500 FCNL -9~9.2500 T~N,S -999.2500 5623°2500 220,4BTB T~NS 739.054~ LLD 35.2930 $!0 0.1235 MT~M 1.!0~6 NP~I 12.7520 TENS 12.7520 CALl 3.~551 29~,3125 LZTm -0.0029 QLS 3~4.1375 SS~ ~.Bi3'5 ~B.2353 W4NS 170.4242 TENS 0.I22! ~T~q 52.5117 Gq -9~9.2500 FCNL -9'~9._750m~ TENS 5157.2500 t99.0525 TENS 5103.2500 JR 171.9375 TENS 93.6523 TENS -999.2.500 NCNL -999.2500 MDT 51.1367 DT 51.1t367 D'TC~ 5t03.2500 26.0523 SGR 473.8~06 OVO !70.4242 TENS 34.1309 NCNL 4~71.2500 ~RES 10.2129 3.8535 LL 132,8125 SSI -0.044~ TE~S 77,714:~ 2.1448 WING 12.9395 5523.2500 172.~875 T~N5 81.7773 TENS -999.2500 NCNL -999.2500 MOT 77.71~ DT 77.71~8 DTZ3 5623.2500 880.3812 SG~ 59.2773 OVO 170.4242 TENS 1.2207 NCNL 5453.2500 MR~S 9.1560 RHC~ 5.1~0~ LL -O.OtSI TENS 13.9004 CGR 0.2539 :41N3 0.5~60 WEW3 5167.2530 GR 172.1575 TENS 14.0B79 TE~S -999.2500 NCNL -929.2500 MDT 13.9304 DT 13.9004 DT'3 5157.2500 219.8125 3.4338 27.3799 5027.2500 51~'3.2500 -999.2~00 O.O000 8!.~64~ 73.0273 77.7148 52.4180 56213.2500 3097.5000 0.1226 2.2463 2~2.890.5 284.5406 ~87!.2500 ~8.2305 250.1406 8.6270 55.'7773 461!.2500 49~3,2500 -999.2500 0.0000 54.8398 91.0273 !~.9004 443.1406 5157.2500 5003.2500 0.1226 .2.6409 122.9023 192.1875 5463.2500 12.3145 45.9805 2.05~8 13.55,56 5047.2500 4923.2300 -999.2500 O.OOOO 54.1367 51.0117 ]EmT i2800.0000 LLS 156. 55,$6 Lug 152.7752 SGq 28.5768 VP 010.~02 VERi-ICATI3N LiSTiNS ~AgE 9 P -53.7695 SVO I 0 i 377.5575 )IR f S CNL 2333.5000 GR T ~ ~ 3 ~ Z. 83, 73 ~ R ~RHO O. 0393 ~'~I U 20~.1375 LS S2 265.3905 ~SS RES 0.I225 MTf-~ OT~ 0.7324 TH3~ 2N3 35.~2~2 'NSN3 T 57.5117 3TL PM~' -999, ~950O NR&T R -999.2500 RNRA SD? 57,2517 LDTL TL 54.32&2 T~NS TSM 104.0273 DTST EPT 12700.0000 LLS P -49. 7383 SVO l 0 20. 3330 MR E S R~T 1.3577 ~N~A ~,NL 5957.2500 SR TE~ 340.5575 GR R~C -0.0005 Omni U 198.~375 LS S2 268.1g05 ~SS R~S 0.1230 MTE~ ~T& 0.3~18 T~3.~ 2NS 26. 7735 WSN$ R~S O.!2~O MTE~! ALZ 9.3~25 MRE~ T 5.5. B~57 DTL PHi -999.2590 NR&T R -999.2500 RNR& S~T 54.7517 LDTL TL 54.5367 T~NS TS'4 102.3273 OTST EmT 12500.0!303 LLS P -4t.:~323 SVO IS ~!.5355 MR[S :R&T 0.9712 CML 7019.250J iT:M 333.7~75 ~2 0.002~ J 189.13'75 LS ,SI 26~.$~06 ~.S'~ :RES 0.1240 ~T~ ~3T& ,3.3:905 TMDR Zq3 23.7703 ~3N5 21.1924 0.~'~3~ 1.~516 24.1143 ~4 I1~3 3.1738 235.3125 0.0439 34.2.8375 !.695~ 20.5758 159.g7~2 0.1226 57.$367 -999.2500 -999.2300 -999.2500 50~7.2500 20!.0~25 1252.7532 39.5055 0.1240 1.1329 15.4785 t5.~785 2.3435 198.6375 340.5875 1.6241 7.9578 0.1230 '54.3 $ 57 -99'9.2~00 -99:~. 2500 -9~9.2500 5235.2500 199.0625 434.3177 30.ti~3 0.1245 !.0~21 !7.1143 i7.1143 0.0176 339.7~75 9.=51~ 157,72~2 MTE~ TENS C~Li LI TM QLS W~ TENS MTE~' FC~L TENS SG~ TENS LL] MTEH NPWl CALl Li'T~ T~NS MTEM TENS SG~ SGq TENS LCD SIO ~T5~ TfNS C~Li LITd NLS T~S 196.3125 169.9742 TENS 5.175~ NCNL 5007.2:500 MRES 9.5176 RHSB 5.0335 LL 44.1367 SSI -0.0~98 TENS 28.6768 1.3350 WINS !,3780 5047.2500 t71.0525 TENS 31.301~ TENS -999.2500 NCNL -999.2500 MgT 28.6768 DT 2:8.6768 DTg.3 25'72.7236 SGR 45.~05 OV3 153.5242 TENS 1.0254 NCNL ~'75.2509 MRES 9.2~41 RH33 5.2~95 LL 40.8367 SSi -0.01~I TENS 16.0574 CGR 2.1702 5235.2500 GR 170.3125 TENS I?.8955 -999.2500 NCNL -999,2500 MDT 16.0574 OT i6.057~ DTS2 5235.2500 5.52.~319 SGq 105.0273 157.7242 TENS 0.5371 NCNL 4~27.2500 ~RES 9oi~26 5.~539 LL 39.3242 SS1 1~.77~5 1.353,5 1.4~35 'NSN3 282.5906 5047.2500 4323.2500 0.1225 2.65-45 201.9375 5007.2500 1~.I143 90.9648 2.0567 20,7080 5011.2500 52~3.2500 -999.2500 0.0000 54.82~2 54.0117 16..057~ 61.0430 5235.2500 5753.2500 0.1230 2.6582 99.4548 195.0625 4875.2500 11.5438 ~5.5742 1.4464 19.7549 4635.2500 4875.2500 -~99.2500 0.0000 54.251'7 ~3.0117 18.7705 38.9~92 4947.2500 7319.2500 0.1240 2.6917 95.5273 195.~375 4427.2500 3.2598 62.66~0 0.7202 19.39~3 VP 0i0.M02 VERIFICaTiON LiSTIN$ ~a!EE I0 ALI 9,2207 MRES T 50. '3367 ~TL ~HI -~99,2500 N~AT R -99'~.2500 ~NR~ SOT 50,1357 L~T~ TL 53.~242 TENS TS~ 101.0273 OTST EPT 12500,0000 LLS P -23,4326 S¥0 lO 504.$125 MRfS RAT I,t006 RNR~ CNL 45,39.2500 ER TE~ 335.7525 GR R~9 0.1~45 DP:~i U 253.6g05 LS S2 335.5~05 ~SS RES 0.1250 ~TEq OT~ 0,2930 THOR 2NS 4:9.4492 W3~S RES O.lZ55 MTS~ ~Li 11,£12~ q~ES T 5.~. ~. ~ 6 '7 uT~ Pill -999.2500 NR~I ~ -999,2500 RNR2 SDT: 50.3~67 LDTL TL 45.3567 Tf~S TSM 97,027~ DTST !0 CqL d RES !RES ~T 1Z40O.O000 LLS -16. 7507 S'Vg 122~.5875 MRES 1065. 6575 33~..5!25 0.D~29 304.3905 LS 305.3~05 ~SS 0.1255 MT~~ 0.5343 YmOR' ~4.0i17 ~3N3 0.1255 ~2.0273 DTL -999.2 50 } N R & T -999 . 2500 92.5523 LOT~ 69,0273 TENS i13.0273 DTST 12300,0000 LLS -12.7012 SVO 796,3125 MRES 1.9737 ~NRh 0,1235 50.1357 -999.2500 -9~9,2500 -99'9,2500 49~7,2500 199.0525 5~5.i741 30-1455 0.1255 1.1368 28.6~55 28.6455 6.2988 275.6~06 0.0542 335.7525 1,8380 13.5270 156.9367 0.1250 50.38,57 -9~9.2500 -9~9,2500 -9)9.2500 225,0525 39,9304 8,2353 0.1255 2.8323 27..B799 t7.8799 19,2B71 0,0322 334.5125 2.4768 22.7549 0.1250 B3,2773 -999,2500 -999.2500 4657.2500 225.0525 20,1758 0,i270 2,0508 ~CN~ TEN S SG~ SG R TE NS LL~ MTE~ NPql YENS C4LI LiTH QLS SGR URAN W4~S TE~S MTEM FCNL TENS SGR TENS LLD N~Hi u A L r_ LZTH T~NS FCNL T~NS S-q SS~N TENS LL3 SI.] ~T E .159,1.875 TENS !J:.7549 TENS -999,2500 NCNL -9:99,2500 MOT 18.7705 DT 15.??05 DTSS 4947.2500 715.7229 86.:5273 DV'D 156.9367 TENS 0,2~30 NCNL 4555.2500 MRES 12.5332 6.$i01 52.6~7 SSi -0.0~5~ TENS 33.6367 2,8772 W1NS 6.0554 W5N3 4507.2~00 GR 167.8t25 TENS 35,6367 TENS -999.2500 NCNL -999,2~00 MOT 33.6367 DT 33.6357 DTC3 ~B~7.2500 72,~g06 SGR 299,3906 DVO 155,6992 TENS !9,!~95 NCNL 4355.2500 MR~S 9.8301 2.72:~8 LL 92.3398 551 -0.004~ T~NS 19,41ii 1,3799 3.7932 WENS 4667.2500 157.~525 TENS 40.41~0 TENS -999,2500 NC~L -999,250~ 29.4111 ~557,2500 393,6270 Si3R 217,5525 DV3 16~,7992 TENS !2,5~65 NCNL 4547.2500 ~755.2500 -999.2500 0.0000 51.324'2 51.0117 33,5367 ~85,t406 4807.2500 5153.2500 0.1250 2.6018 143.8125 253.3125 4555,250O 12,2958 109.0273 3.0276 27.0049 ~27,2500 4647.2500 -9~99.2500 0,0000 46.2617 48.0117 29.4111 I00.1523 4557.2500 3019.5000 0.1255 2,3792 170.~125 2t5,5875 ~35~,2500 19,5674 92,5898 ~.7932 23.8955 ~583'.250~ 4587.2500 -999.2500 74.5273 50.0117 17.95~3 352.3906 ~407.2500 3453.5000 C~iL 1574,6375 T~'4 332,71215 R"I2 0,0718 O 324,~906 LS 5 Z ~34. :B ~05 ~S 0.1270 D~ 0,4883 THDR 2N3 23.0~86 ~3N~ ~55 0.1270 ALI 10.3223 T 76.7773 DTL PHi -999. 2500 NR~,T R -999,2500 RNR~ SDT 65,6523 LDTL TL 66,7773 T~NS TSM 122,0273 I0 RAT CNL TEM RHO d S2 RES LtT~t 2N,.q RES ALI T R SDT TL ITSM 39.2'930 39.2~30 17.773~ 3~4.3906 332.7125 0.9253 10,8301 154,7992 0,1255 78.2773 -999,2500 -999.2500 ~, 07.25.00 229.0525 12200.0000 LLS - i 3.3730 S V 746.312:5 MRES 1.1'407 573!.2500 530.9125 SR 0.0~15 DP~Z 206.5525 LS 275.3~06 ~SS 0.1274 MT~g 0.~8~3 Td3R 70.5273 W 3"45 0,1289 MTE~ 9,8223 MR~S 58,5117 ~TL -999,2500 NR&T -999.2500 RNR& 55.1367 57.5~67 TENS 103,0273 DTST 223.1026 23. 8543 0.!2~9 :1.1309 24.7236 24.7235 3.9062 207. 5625 0.0083 330.9125 ! .6797 17.2705 154,1242 0,1265 57.1357 -'99'9.2500 -999.2500 ~1.5523 4835.2500 209.0525 12100.0000 LLS -13.7402 S¥0 209.1~375 ~RES !.~704 3267.5300 GR 329.3375 0.0145 DP~I 2i5,6~75 LS 283,1~05 ~SS ~.T~13 58,1550 W3~3 '3,1279 :~TEq 65,1523 DTL -993.2500 59.6685 13.9707 0.1279 !. 6905 2a.2236 24.2236 5.3223 22!.0525 0.325¢ 329.3375 1,1501 15.0332 152.7742 0,1279 55. 5273 -9~9.2500 TENS CALl L! TH QLS UR~,N TENS GR ~CNL TE~S SGR TENS L L D SiO NPfil TENS C'~ LI LITH ~L S UR&N TENS GR ~CNL TENS T~N$ LL3 T~NS C~iLZ mE,= Llrw .ILS W4~S TENS FCNL ~+175.2500 9. 9316 4.4578 LL 55. 2773 SS1 -0,0137 TE~S t7.8,543 CGR 1.39,55 WINS 0-7217 165,93'75 TENS -999.2500 NC.'q L -999.2500 MDT i 7. 8543 DT 17,8543 9733 4407,2500 334,5773 SG~ 155,0625 DVO 164,1242 TENS 1,12.30 NCNL 4207.2500 MRES I0,0723 RH]B 5,3562 'LL 42,4,805 SS1 -0,0215 TENS 38.4180 CGR 2. 978~ W1N3 4,3171 NS'N3 4:835.2500 GR 155.1875 TfiN5 19,8:330 TEN S -999.2500 NCNL -999.2500 MDT 3~.~180 DT 3~,~180 DTS3 ~:335,2500 $3.4201 SGR 2~0.8905 DVO 162.7742 TENS 7.714~ NCWL 4335.2500 9,0254 3.~245 LL 51.32~2 SS1 0.0035 TEtS 36.6055 C,3~ 2,67~1 3.9202 ~35.2300 GR 15~,8125 T~NS 2~,35a3 TEWS -99'9.25S 0 NCNL 0,1270 2.4045 182.0625 240. 9375 4175,2500 i1,6650 54. 8555 !.4~34 i 4.04,88 4327,2500 4~3,2500 -999,2500 0,0000 58,4023 66,0273 38.4180 322.3906 4835.2500 6~83.2300 0.127a 2.6428 loa,2148 198.4375 4207,2500 14,6504 13~,9375 3,59'99 21,09~6 ~495.2300 4571,2500 -999.2500 0.0000 51.3857 $0,0117 36.6055 20.0830 4835.2500 3527.2500 0.1284 2.617a 113.2148 207.5625 4335,2300 18,8643 !29,4375 1,3067 21.3955 4683.2500 4553.2500 -99'9.2500 VP O10.HOg V~RI,=IC~TID'q LiST'IN3 P~$~ 12 R -999.2500 RNRA SDT 60..8~67 LDYL TL 67.7773 TENS TSM I12.0273 DTST EDT 12000.0300 LLS P -22.9232 IO 525.B125 R~T 3.2355 RNR~ CNL ~04.3t25 T5~ 326,5375 GR RM~ 0.0972 OPqI U 30t.t~06 LS S! 335.8~06 QSS RES 0.1!74 MTEq OT~ 3.5545 TH3~ 2N~ 202,312~ W3N~ RES 0,127~ MTEq ALI -999,2~00 MRES T 113.2773 ~TL P~! -999,2500 R -999.2500 SOT -999,2502 LDT~i TL 100.~023 TENS TS~ 160.0525 OTST EPT P lO R&T CNL ~.TEM ,O S Z IRES 'JT& iR£S .AL1 ~T R SDT TL TSM tR~T :CNL 11900,0000 LLS -'9'99.2500 SVO _99~.~~ ~ ~OO MR~:S -9'99,2~00 RNR~ -999,2500 G~ -999.2500 ~R -999.2500 DPHZ -999.2500 LS -999,2500 ~SS -~9:9.2500 MTEq -99~.2500 TH3~ -999.2500 ~3N3 -999.250~ MT:M -999.250~3 MRE5 -999.250~ DTL 42.6751~ NR~T 50.7930 RN:R~ -~9.2500 LDTL -999.2500 TENS Ili~O0.JOOD LLS -999.2500 SVO -999.250~ MR~S -999.2500 RNR~ -~99.2502 :3R -999.2500 $~ -~99.250P PP~i -999o2500 204.0625 4.7534 2.1702 0.127~ 3.t975 108.~023 lOS. 4023 13.5254 0.0¢59 326,5375 11.408! 74.5273 152.2t17 105.2773 -999.2500 -9~9.2!500 -999.2500 48~3.2500 !9!.0625 -999,2500 -999.2500 -9~9.2500 -999,2500 -999.2500 -9~9.2500 -999.2500 -99'9.250O -9~9.2500 -999.2500 -9~9.2500 -9g~.2500 3.7444 4.0007 -9~9.2500 -999°£500 -999.2500 -999.2500 -999.1500 -999.2500 -999.2500 -9~.~00 T:'NS~ SGq T~NS LLD $iO M'TE~ NPHI TENS C~L! LITH QLS TENS MT~ ~CNL T~NS SGR T~ENS LLD SIP NPMi TENS CALZ LiTH QLS URaN TENS MTE~ FCNL TENS S:3R TEqS LLD MT~M NPql T~S ~&Lv -999.2500 MDT 36.6355 DT 35,6355 DTZ3 4835.2-q00 5,5:282 SGR $50,8125 DVO 152,2!17 TE~S 27.9297 NCNL 4371-2300 MRES 17.2D80 RH3~ 80.8398 SS1 -0.0093 TENS 1i9.0393 CG~ 2.5155 N 1 N ~ i2, 2988 WS~ 48~3. 2500 GR -999.2500 TENS I07.0898 T~SNS -999.2~00 NCNL -999.2500 MDT lIg. 0~98 DT 119.0~- ~ 98 DT ~ ~ 3 4843.2500 -999.2300 SGR -999.2500 DVO -99~.2500 TENS -999.2500 NCNL -999.2500 MRES -999.2500 RH~5 -999.2300 LL -999.2500 SSi -999.2500 TENS -999.2500 CG~ -~9.2500 ~IN3 -999.2500 WENS -999.2500 GR -999.2500 TE~S -999.2500 TENS 37D.8~05 NCNL 3931.5000 MOT -999.2500 ST -99~.2500 DTCJ -999,2500 -999.2500 SG~ -999.250j gVO -999.25D0 TENS -999.2590 NCN~ -99'9.2500 MR:S -99'9.2300 0..0000 5 ~B. ? 14 8 51.0117 I19.0898 3'~6!6 48&3..2500 1932.$~75 0.1274 2.4768 157.5525 244.9375 4371.2500 99.2?73 38,2.8906 ~.8848 -999.2500 -9'99.2500 4527.2500 -999.2500 0,0000 99,9648 g?,0273 -999.2500 -999,2500 -999.2500 -99g.2500 -999.2500 -9'~9.2500 -999.2300 -999.~500 -999.2500 -999,2500 -999.2500 -995.2500 -999.2500 -99~.2300 -999.2500 1483.6975 -999.2500 -999.2500 -999.2500 -'999.2500 -999.2500 -99'9.2500 -99'9.2500 -999.2500 -999.2309 .V=: 010,H"'2.:,¢ VERZFiC~T~.S~v L,.STiNS'r PA~,~E~' 13 .U ~RES ~RES ~T .SST ~TL ~TSM -99 -99 -99 -99 -9.9 -99 -99 -99 2 3 -99 - 99 -99 9,2500 L .S 9,Z~OO QSS 9,2500 9.2500 THOR 9,2~00 W3~:3 9 . 2500 MT 9,2500 9,2500 gTL 9,53~7 4, ~92 ~,2500 LDT. 9,2500 TE~S 9,2500 OTST 11700,0000 LLS -999,2500 SVO -999,2500 MRES -999,2500 RNR~ -999,2500 GR -999,2500 GR '-999,2500 DP-t! -999,2300 LS -~99. 2500 QS S - 999.2 50 ~ MT-:_'4 -999,2300 TH.]q -999,2500 W3xI3 -999,2330 MTE>4 -999.2300 MRES -999.2500 OTC 28.4150 NRAT 27.67,58 RNR~, -999,2500 LDTL -999.2503 TENS -999. 2500 gTST 1 1,50 O. -999. -99 9. -) 99. -999. - ~99. -999. -999. -999, -999. - 999. -~99, -")99. - 999. -9'99, 25. -999. -999. 3000 LLS 2500 SVO 2500 2500 2300 2500 GR 2500 25 ~ 0 L S 2500 ~SS 2500 MT5~ 250~ THJq 2309 ~3N3 ZSOO ~TEq 250~ MRE3 2300 3TL 3~5 RN~ 2 500 LDTL Z~O0 TENS -9~9.2500 -999.2500 -999.2500 -999.2500 -9::99.2500 -9:-)9,2500. -9:)9,2500 -9~9, Z5 O0 3.0295 3,3'309 -9:~9,2300 -999.2500 -9:)9,2500 - 999 · Z 5 O 0 -999. 2500 -999.2500 -9)9.2500 · -9 ~ 9. 2500 -999.2500 -999.2300 -9~9,2500 -999. 2500 -999.2500 -999.2500 -999.2500 -9 99. 2500 -9~9 -999.2500 2. 9531 3.2815 -999.2300 -999.2500 -999.2500 -9~9.2500 -9~9.2500 -939.2500 -999.2303 -999. 2500 -999.2500 -999.2500 -99'9,2500 -999.750~ -999.2500 -9~9.2500 -999. 2300 -999.2500 -999.2500 2.~538 2.9~56 -999.2500 -'999,2500 LiTH QLS S~3~ ORaN ~ENS M T .E M FCNL TENS SGR SGR TENS LL~. ZTE~I NPqi TENS CALl LITt QLS T E N S ~T5'4 FC'~L TENS SJ~ SS~. -999,2500 SS1 -999,2500 TENS -999,2300 CSR -999. 2500 WINS -999, 2 500 WSN~ -999,2500 GR -999,2500 T!fNS -999,2500 TENS 456.1~06 NCNb. 39~+5.5000 MP% -999.2300 DY -999,2500 DTCO -999.2500 -999,2500 SGR -999,2500 OVO -99'9. 230.0 TENS -999.2500 NCNL -999,2300 MR!SS -999.2300 -999,2500 LL -999.2590 SSI -999.2500 TENS -999.2500 CGR -999.2500 WIN~ -999. 2300 WS~$ -999.2300 -999,2300 TENS -99'9.2500 'TENS 53.~,8t25 NCNL 3'935. 5000 -999.2500 2T -999,2500 -999,2300 -9'99.2300 SS -999.2500 DVO -999. 2500 T_:~S -999.2500 NC'4L -99'9.2500 ~4R:S -999,2500 RH~5 -999. 2500 LL -999,250~ -999. 2500 TENS -999,2500 -999.2500 W i ~3 -999,2500 -9~9,2500 -~ 99. Z 500 TEq S -999,2500 TE~S 519,3!Z~ NC~L 3951· 5302 -999,25~0 ~T -999,2500 OTC] -999.2300 -999.2500 -999.2500 -999.2500 -'999.2500 -999.2500 -99'9,2500 -999.2500 !547.6875 -999.2500 -999,2500 .-9~9,2500 -999.2300 -999,2500 -999.2500 -999,2500 -999,2500 -999,2500 -999°2500 -999,2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 1768.6875 -999.2500 -999,2500 -9~9.2500 -999.2300 -999.2300 -999.2300 -999.2500 -99:9.2500 -999.2500 -999.2500 -9;99.2500 -999.2500 -999.1500 -999.2500 -99'9.2500 -999.2500 -9'99.2300 -999,2500 1824.6875 -999.2500 -999.2500 -9'99.2500 VP OtO.H02 VERI=iC~Ti:3q LZSTIN3 PAGE TS~ -999.~'' 0 , ~,0 9TST EPT 11500.0000 LLS ? -999.2502 SV3 ZO -99'9.2500 MR~S R~T -999.2S00 RN~ CNL -999.2500 SR TS~ -999.2500 GR RH] -999.2S00 DPHZ U -999.2500 LS S2 -999.2500 QSS RES -9~9.2300 MTSq ~T~ -999.2500 THO~ 2N3 -999.2500 W3~S RES -999.25,20 MT~iq ~Li -999.2500 MRES T -999.2~0S ~TL P,q! 15.9665 NR~T $DT -999.2500 L~T~ TL -999.2500 TENS TS~ -999.2500 CT:ST !!~00.0000 LLS -9'~9.Z500 SVO - 9 g 9.2500 -999. 2500 -99 ~, 2500 S -~99.2500 -99~.2500 LS -~ ~9,250 ~ C,S S - ~ '99 '~ ' M T - 999.2500 W 3N -999.2500 -999,2500 -99:~,2500 12.1~9~ NR~T -~99.2500 LDTL -999. 2500 i-~T P :CNIL IT =_ .b -9 ,~ 9 · '2 500 -999,2500 -999,2500 -999.2500 -939. 2500 -9 ~9.'25 O0 -9 ~9, !500 -99'9. 2500 -9~,2500 -9~9.2500 -999.2500 -999. 2500 -9~9,2500 -999,2500 2,2112 2.2522 -9 ~9. 250O -99'.9.25:30 -999.2500 -939,2500 -9-~9.2500 -9~9. 2500 -9~9.2500 -999,2.500 -999,2500 -9:29, .'3500 -999,2500 -'~ ~ 9.25 O0 -9g9.2500 -~) .9 ':~ . 250 -9~9,2500 -9 ~'9. 2500 1. 9258 Z, ¢3508 -999.2500 -~ ':)'~ · Z 53 O -939. -999.2500 -9~9.2500 -9~9.2500 -9~9.2500 -~.2500 -9~9.2530 -~9.2500 -9~9.2500 -999.2500 SIO M T E NP~ ! TENS C ~L l t-lTd QLS SG R UR~N TENS MT~q S R ~CNL T~NS SGR T~NS LLD MTEM NPHi TENS C~LI LiTH ~LS TENS MTEM FCNL T~NS SSR SSq TENS C~Li Llfq QLS -999.2500 -999.2500 SGR -999,2500 OVO -999.2300 TENS -999,2500 NC>'4L -999.2500 MRES -999.2500 RHO5 -999,2500 LL -999,2500 SSI -9~9,2500 TENS -999,2.500 CSR -999,2500 ~IN3 -9~9.2500 ~EqS -999.2500 GR -999,2500 TENS -999,2500 T~qS 922.3125 NCNL 3925,5000 MOT -999,2500 DT -999.2500 DTC3 -999.2500 -999.2500 SG~ -99~.2500 OVa -999,2590 TENS -9~9,2500 NCNL -99~,2500 MR=S -999,2503 -9'~9,2500 LL -999,2500 SS1 -999,2500 TENS -999,2500 -999.2500 ~iW3 -R99.2500 -999,2500 GR -999.2500 T~N$ i099.5~75 NCNL 3911,5900 -999,2500 DT -999.2500 -9~9,2500 SG.q -9-59,2500 DVO - g 9'-), 2503 TENS -999,2533 NCNL --)~9.2500 HRES -9~9.2500 ~H35 -999.2500 LL -999,2500 SSI -999,25~0 TENS -999,250O -999.2500 -999.2500 -999,2500 -999,2500 -999,2500 -99'9,2500 -999.2500 -9~9.2500 -9~9.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 2079,5000 -999.2500 -999,~500 -999.2500 -999.2500 -999,2500 -999,2500 -999,2500 -99'9,2500 -999,2500 -999,2500 -9~9.2500 -999.2500 -929.2500 -999,2500 -999.2500 -9'99.2500 -999,2500 2257.5000 -9~9.2500 -999.2500 -999.2500 -gg9.2500 -999.2500 -999.2500 -999.2500 -999.2500 -9~9.2500 -9~9,2500 -999.2500 -'99'9,2500 -99'9.2500 Vo OlO.eO2 VERiFiCATiO~ LISTIN3 PAGE RES ALi T SST TL TSq EDT P i0 R & T C N L U S2 RES RES ALi T PHi R T L TSM E- ~? RaT CNL. ,U S 2 iRES iZNS ~RES ,ALi tT . S ] T ~T~ -99 -'99 -99 -99 -99 2 I -99 -99 -'~9 9.2500 T~:D~ -~9 9.2500 W3NS -999 9.,¢500- .MT=q~ -9~~ 9.2500 MR~S -9~9 9.2500 PTi -~9~ 2.2556 NRAT Z 8.B018 RNR~ 9.1500 LDT~ -999 9. 2500 T=~S~. -999 9.2550 DTST llZO0.O~OO LLS -9~9 -999.2500 S¥~ '-999 -999.2500 ~R~S -999 -999.2500 RNR~ -9~9 -999.2500 ~R -999,2500 SR .-9~9 -999.2500 DPHI -9~9 -999.2500 ~SS -999.2500 qYF~ -9~9 -999.2500 T~ -999 -999.~500 W3N$ -999 -999.~500 ~T~ -999 -999.2500 9R~S -999 -999°2500 DTL -999 ,o~25 NR~T 127,0B98 RN~ -999,2~00 L~T~ -999.2500 T~NS -999 -99~.1500 DTST -999 ! 110 O. 0000 LL S -9 --}99.2500 SV3 -9'99,2500 MRES -999 -999,2530 RNR~ -999 -99~.2505 ',3R -9~9 -999.2500 SR -9'99 -999.2500 DPql -999.2500 ~SS -999,2~00 MT~4 -9}9 -999,2500 TH3~ -999 -999.2500 W3qS -9~9 .~ TE'~ -999 -'999.250 O -999.2~00 CTL 57.2266 NR~T 93.7773 RN ~ ~ 4 -999.2500 LOT_ -9~9 - } 99. Z S 00 T -999.2503 DTST -999 .2500 .2500 .2500 .2500 .2500 .6252 .97!3 .2500 ,2500 ,2500 .lSD0 .2500 .2500 .2500 .2500 .2500 ,2500 .2500 ,ZSO0 .~5~0 .2500 .2500 ,2500 .5218 .5~53 .ZSO0 .2500 ,2500 .2500 .2500 .2500 .2500 .2500 ~sno .2500 .2500 .PS0'~ .ZSO0 ,2500 .2500 .~.O0 ,2500 .2500 .5~37 .555~ .2500 .2500 .2500 TENS =CNL 'T~NS TENS LL3 SiO MT £ q NPMI TENS CaLl PEF LiTM UR~4 WCN.S ~ENS T=NS~ S $ ~ SG~ TENS LL3 SI9 qmHI TEqS CALl LiT~ :;LS TENS' MT~M FCNL TEWS SSq T~NS -9'99,2500 wiN5 -999,2500 WS~S -999,12500 GR -999,2500 TENS -9~9.2500 TEqS 576,8125 NCNL 3865.5000 ~DT -999 2500 nT -999,2500 DTC2 -999.2500 -999,2500 SGR -999.2500 DV'O -999.2500 TENS -999,2500 NCNL -9'99. Z500 MRES -999.2500 RHD5 -999.2500 LL -999,2500 $Si -999.2.500 TENS -999.2500 r -999.2500 W1N5 -~9.2500 WS~S -999,2500 T~N5 294,390~ NCNL 3~71,5000 MOT -999,2500 $~ -999,2500 DTCD -999,2500 -9'99.2500 -999.2500 DVO -9'99. 2500 TENS -999.2500 NCNtL -999,25~0 '4R~S -999.2500 RHDS -999,2500 LL -999,2500 SS! -'~99,2500 TENS -999,2500 CGR -999.2500 WiNS -999.2500 NSN~ -999.2500 -q~9,, .2500 ~NS -999. 2500 T~NS B01,8906 NC~L 3751. 5020 -999.2500 DT -999.2500 DTC] -999,2500 -999,2500 -999,2500 -~99.2500 -999,2500 -999,2500 19~3.68'75 -999.2500 -999.2500 -999.2500 -:999.2500 -999,2500 -999.2500 -999.2500 -999.2500 -999,2500 -999.~500 -999.2500 -999.2500 -999.2500 -999,2500 -999.2500 -99:9.2500 -999.2500 1367.6875 -999.2500 -9'99.2500 -999.2500 -999.2500 -999,2500 -999,2500 -999,2500 -999,2500 -999,2500 -'999,2500 -999,2500 -999,2500 -99'9,2500 -999.2500 -999.2500 -999.2500 -999.2500 -9:9'9.2500 1375,6875 -999.2500 -999,2500 ,-~DT itOOO.OOO0 ~ LS, -q~9,~, ._PSO0 ,,_' 1 S -999.250v~ Sj~, -999._~500 Vm~ OiO.HO! V~,qlFI~ATi~~ LISTiNS, PAS:~ 16 P -999.2505 i0 -999.2500 MRE$ RAT --999.2500 RNR~ CNL. -999.2500 SR TEM -999.2500 RM3 -99:~,2500 OP~i U -999,2500 LS S 2 -99 9.2500 ~S S R~S -999.2500 OT~. -999.2500 2NS -999.2500 RES -~99. 2500 ALi -999.2500 T -'999. 2500 S~T -999,2500 LOT~ TL -99~,2500 T~NS TSM -999,2500 3TST EPT 10900.0000 LLS P -999.2500 SVO 13 -999,2.500 !,iRES R ~T -'~)99. Z 500 R CNL -99~9.2500 GR Tfq -999,2500 R~] -999.2500 DPql U - 99'?. 2500 LS S 2 -999.2 $OJ ~20 S RES -~9 .2500 MT OT~ -~99,2500 ALI -999,2300 T -999,25 O0 DTL S 3 T - ~ 9 ~, 250'3 LDT .TL -999,2500 TSM -999.2~90 DTST E~T 10'300.0000 LLS P -)99,2500 SVO ~. 3 - 999.2500 Mq ES ~R~T -99~.250J tT:~ -~99.2503 .U -999.2~05 LS S2 -99~.2500 ~SS R'ES -999,250j 3T& -999.2503 2t3 -99~.2500 W3W3 tR~S -999, ZSJO VlT=~ -9~99,2500 -9 :)9, :2500 -9.99,2500 -959,2500 -999,2500 -999,2500 -999.2500 -999,2500 -9:79,2'500 -999,2500 -99'9,2500 -9~9,2500 -999. 2500 3.9221 -999,2500 -999.2500 -9 ~9. 2500 -99?.2500 -9~9,2500 -9~)9, -9 :~9, Z 50O -999,2500 -999,2500 -'~, ~ 9. £.~00 -999.2500 -9 ~9. 2500 -~9.2500 -9~.2500 -9 99. 2500 -9~9.2500 -9~.2500 3.7737 4.0~76 -9?9.2500 -999. 2500 -959.2500 -999. 2500 -9~9. 2500 -993.2500 -99:9,2500 -9~9,2500 T;.NS -999,2500 NCNL -999.2500 ~RES -299.2500 RH25 -999.2500 LL -999. 2500 SS1 -999,2500 TENS -999, 2~00 CG~ -999,2500 Wl'~3 -999,2500 -999,2500 -999,2500 TENS -999,2500 TENS 3!9,3906 NCNL 3761,5~00 -999.2500 DT - 999,2500 -999,2500 -999,2500 SGR -9')9, Z 500 3VO - 999.2500 TE'?,tS - 9 ~ '9.2. 530 N C N t -999,25'20 MRES -999.2300 RH3~ -399.2500 LL -999.2~00 SS1 -99'9.2~00 TENS -999.25~0 -:)99,2500 WIN~ -9~9.2500 -.299, ~nn GR -999,2500 TENS -999. 2500 TENS 350,652~ NC'~L 3705,5000 -99~.2500 ']T -999.2500 -999,2500 -999,2500 C. V3 -9~9,2500 NCNL -9)7.2500 -999,2500 -999.2500 LL -9~9. 2500 SSt -99~,2500 T~NS -9~9.2500 CGR -999.2500 wlq3 -9~9.2500 WSNS -999,2530 SR -999,2500 -!~ 9:9 . 2500 -999.2500 -999.2500 -999,2500 -999,2500 -9'99. 2500 -999.2500 -999,2500 -999.2500 -999.2500 -999,2500 -999,2500 -999,2500 1260,5875 -9'99. 2500 -9')9.2500 -99'9. 2500 -999.2500 -99'9,2500 -~99.2500 -999,2500 -999,2500 -999,2500 -9!~9,2500 -999,2500 -999,2500 -999,2300 -999,2500 -9'99,2500 -999,2500 -999. 2500 -999,2500 1419. 6875 -9~9.2500 -999,2500 -999... ~' 500 -999,2~00 -9)9,2500 -999,2500 -999.2500 -999.2500 -999.2500 -999.2500 -~99,2500 -999,2500 -99'9.2500 -999.2500 -999,2500 -999.2500 VD OlO,~'Og VEP, IFiC'~TIO~ L!STiN3 ~PAGE i? ALI -~99,2500 MR~S r -999.1500 DTL R 76,0 ITS 5DI -~99,2500 TL -999. 1500 T~ -?99,2500 ~PT 10700,0000 LLS P - ~99.2530 SV O ZO -~99.2539 R~T -999.2500 RN~ C~L -999,2500 T 5 ~I -999. Z500 U -99-9.2500 S2 -999,2500 QSS RES -~99,250~ 2 N 5 -~9.25 O0 W 3 R ES - ~99.2 5~ $ ALi -999.2500 MRES T -999, .-'2500 ~,~T~ Pdl 46.0449 NR~T R 57.0117 SDI -999,2500 LDT_ TL -9:~9.2500 T-NS TSM -999.2500 DTST ~T 10500.0000 LLS P -999.2500 SV l~ -999.2500 C~L -999.2500 TS'~ -99~.2503 R~, - -999.2500~ U -999.2503 LS S ~ -999.2503 20 S ,R E S - 999.25 O 3 ,'J T ~ -993.2 ~ O0 TH ]R 2t,3 -999.2500 RES -999,250~ MT~q ~ L l - ~ ~ 9.2300 T -999.2500 P~i 42.2353 R 73.4J23 S 2 T - ~'39.23 SG L] TL rL -999.2~00 TSq -~99.2502 DTST E~7 10500.0000 LLS ~ - 99 3.2500 S V O 13 -999.2500 ~4q:S q~T -999.2500 -999.2500 -999.2300 3.5530 3.4507 -999.2500 -999.!500 -939. 2500 ,-939.25 O0 -9~9.2500 -9~9.2500 -'999. 2500 -999.2500 -999.2500 -9?9.2500 -999.2500 -999.2500 -999.2500 -999.2300 -9 ~9,. 2500 - 999.2500 -999.2500 3. 9299 3.5956 -999. 2500 · -9 ~9. 2500 -999.2500 -999,2~00 -999.2500 -999.2500 -9~9.2500 -999,2500 -999,250O -9:;9.2500 -999.250.2- -9?9. 2500 -997.2503 -9")9.2503 -999.2500 -937.2.500 -9?9.2500 3. 7209 4.2117 -9 ~9. 2500 -999. 2300 -999.2500 -939. 2500 -999.2300 -9~9.2330 -999. 2500 '4 T ,E q TENS T :E >4 S L L D .S lO NPdl TE~4S CALl LITq QLS W4~3 TENS ~T ~Cq~ TEqS SSq SG~ TENS S l 3 k?4l -999.2303 T5'4S -999,,2500 TENS 616,6~06 NCNL 35:~5.5300 ~DT -999.2500 OT -999, 2500 DT33 -999.2500 -9'99.2500 SS -999.2500 ors -999.2500 -999.2500 NCN L -999. 2500 MRE S -9:99.2500 LL -999. 2500 501 -999. 2500 T E ~'4 :S -999.2500 -99'9.2500 -999.25 O0 W 5~'3 -999. 2300 -999.2500 TENS -999.2500 T~NS 384.1~06 NCNL 3585.5000 MDT -999.2500 -999.2 500 DTCO -999.25 ~ 0 -939.2500 SGR -999.2500 3V3 -939.2500 TENS -~99.2500 -3'99.2500 MRES -9'39.2530 -999.250~ LL -999.2500 SSI -999.250~ TENS -939.2500 -999.2500 Wl~S -~99.2~00 -=39. ~SuO - 999 . 2 5 O 0 -999.2503 T:5~S 323.5~05 NCNL 3595,5J00 MDT -99'?.2530 CT -999.2500 ]TC2 -999.250~ -999.P:0:~ OV-~ -999.2503 TENS -~99.2500 NC~L -999.2500 -999.2500 1450.6875 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -99'9.2~00 -999.2500 -999.2500 -999.25:00 -999.2500 -999.2500 -9'99.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999.!500 1419.6875 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999.2500 -999.2500 -999,2~00 -999.2500 -999.2500 -999.2500 -999.!500 -999.2500 -999.2500 -999.2500 !3~5.5875 -999.2500 -9'9'9.2500 -99'9.2500 -999.2500 -99~.2500 -999.25,30 -999,2500 VP 0!0.,~02 VERIFIC~.TZD'~ LiSTiNG PAGE T E M -999. ZEO0 SR O - ~99,2500 LS S2 -99'~,2500 aSS RES -~)99,2~00 :qT~ OT& -999,2500 TMON 2~S -999. 2500 W0~S R~S -~99,2500 MTE'~ ~Li -999. 2500 M~ES T -999,2500 D TL 2 q i 35.9529 N~ ~.~ S~Y -999.2500 LSat TSM -999.2500 DTST ~PT 10400.0000 LLS P -999,2500 SVO I0 -999,2500 MR~S R~T -999,2500 ~N~ C NL - 999 · 2500 $ ~ :TEM -999,2500 GR R~J -999.2500 DPt! O -999,2500 LS 2~S -999.2500 MIEN ~T~ -999.2~00 THOR Z~S -999. 2500 W3N:3 R ES - 999,25 O'S MT~ q ALI -999.2500 MRES T -999,2500 DTL P~! 37,01!7 NRiT R 62,5742 RNR~ SET -:999.2500 LDT_ TL -999.2500 TENS TS~ -999,25D~ DTST =~T 10300.0000 LLS ? -999.2500 SVO lO -999.2500 MR=S R & T -3 ~ 9,250'J RN 2 ~ CNL -~9'~.2300 TE'q -99~.2500 'R~] -999,2500 DP~l U -9~,2503 LS SZ -999,25S0 QSS RES -~99.2500 MTE'q 'jT~ -999.250~ '2N' -e9'9,2500. ~3N~ ,ALI -99~.2530 MR~S ~T -999.2500 DTL -9'99,2500 -999,2500 -9~9. 2500 -999,2500 -999.2500 -9:::)9. 2!500 -999,250~ -9)9.2500 -9)9.2500 -999,2500 -999.2'500 3,4319 3.5917 -999,2500 -999. 2500 - 999 . 25 O 0 - 999.2500 -999, i500 -999,2500 -9)9,2500 -999,2500 -9 ~9. 2500 -9~9,2500 -999.2500 -9~9.2500 -9.~9,2500 -9~9,2500 -999.2500 -9~'9,2500 -999.2500 -999.2500 3.4358 3.6057 -9~9.2500 -999,2500 -999,2500 -999. 2500 -999.2500 -9~9.2500 -999. 2500 -9~9.2500 -9~9,2500 -999.2500 -999.2500 -9~9.2500 -999,2500 -999.2500 -999,2500 -9?9.2500 -9 ~9. 2500 -9~9.2500 3.5~62 TENS C.A L l LiT~ QLS S S ~ T~NS GR FCqL TENS S G ~ SSR T~NS LL '3 MT EM T ~.~ :S. CALZ LZTq FCNL TE NS TENS LLD ~TEM CALl , LZTq QL S UR~N TENS ~CNL -99c,2500. MR~S -999,2500 RH3$ -999,2500 LL -999,2500 SSI -999.2500 TENS -999.2500 CSR -9)9,2500 WINS -999. 2500 WENS -999.25.30 -99'9, :2500 TE~S -999,2500 a3'6. I~06 NCNL 3~31,5000 -999,2500 -999,2500 DTS3 -999,2500 SGR -999.2500 DVO -'999,2500 TENS -999,2 50'0 NCNL -999,2500 MR~S -999.i500 RHD'~ -999.2500 LL -9'99.2500 SSl -999. g 500 T EN5 -'999. 2500 CGR -999,2500 WlqS -999,2500 WSq'3 -999,2530 Ge -999,2500 TENS -999,2500 TENS ¢89.!~06 NCNL 3~0 5. 5000 qD~ -999.2500 DT -999. 2500 DTZ~ -99~.2500 -?~.2500 -999. 2500 3V3 -999.2500 TENS -999,2500 NCNL -999,2520 MRES -999.2500 RH35 -99'9.2500 LL -999.2500 SSi -999. 2500 CGR -999.2500 NtN3 -999.2500 W5 N $ -999.2500 GR -999.2503 T~N5 -999,2500 TENS -999,2500 -999,2500 -999,2500 -999,2500 -999.2500 -999.2500 -999,2500 -99'9,2500 -999,2500 -999,2500 -999,2500 1610.5875 -999,2500 -999,2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -'999,2500 -999.2500 -999.2500 -999,2500 -999,2500 -999,2500 -999.2500 -999.2500 -999,2500 -99'9,2500 1754.5875 -999,2500 -999,2500 -999,2500 -'999.2530 -999,2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999,2500 -99~,2500 -999,2500 -999,2500 -999,2500 -999.2500 -999.~°500 1857.5875 R ~7.5s30 RN~:i SDT -999.2300 LDTL TL -999.2500 TE~S TSM -999.2300 DTS~ 10200.0000 LLS -~99.2500 SVO -999.2500 -999.2500 -999.250:2 GR U -999.2500 LS S2 -999.2500 RES -999.2500 ~TEq OT~ -999.2502 THOq 2N3 -999.2~00 RES -999.2500 ~TEq A~Z -99'3.2500 P~l 37.5000 ~R~T R 61.~555 RNR~ SDT -~99.25~0 LDTi TSM -999.2500 EOT I0100.0000 LLS P -999.2503 SVD lO -999-2500 MRE$ RAT -999.2500 CNL -~99o2509 TE~ -~99.2500 ~ ~3 -99~. 2 ~00 3~1 U -999.2500 LS S2 -999. 2500 ~SSS RES -999.2500 ~T& -~99.2500 2NG - 999. Z 500 W3 N3 ~S -~99.250~ ~T~V~ ALi -999.23D0 MRES PHI $1,$083 NR&T R 57.5742 TSM -999.2500 3TST 3,5975 -999,2500 -9~9,2500 -999,2500 -9~9.2500 -999.2300 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999.2500 -999,2500 -99~.2500 -999,2500 -999,Z5~0 -939,2300 3.~512 3.2561 -999.~500 -999.2500 -999.25J0 -9'99,2500 -999,2500 -999,2500 -999.2500 -99'9,~ -9~9.2500 -999.2500 -999.2500 -939.2500 -99'9.2500 -99'9.25;00 -999.2300 -9~9.2500 -999,2500 -939,2300 ~.6760 3,5799 -99'9,2500 -939.2300 -999.2500 -~99,25J0 -999,2300 -999.2500 -999,25D0 -939.2500 -999,23~0 -939.2300 TENS SS ~ SGR TE :~i S LLD Si~ TENS CALl LiT~ QLS SG~ URAN TENS GR mCNL TSNS SGR SG~ TENS MTEM Nmql T~qS CALl LiTM ~S SSR JR~N W~N3 TEWS MTEM FCNL T~S S5~ TENS SZ3 NP~i TENS C~Li 3'395.5000 ~,Jr. -999.2500 DT -9'99.2300 DTC] -999.2500 -999.2500 SGR -999.2500 DVO -999.2500 TENS -999,2500 NCNL -999.2500 MRES -999.2500 RH35 -999.2500 LL -999.2500 SS1 -999.2500 TENS -999.2500 CGR -999.2500 WiNS -999.2500 NSN3 -999.2500 GR -999.2500 TENS -999.2500 TENS 521.312:3 NCNL 3391.5000 MDT -999.2300 OT -999.2500 DTCD -9~9.2500 -'999. 2500 SGq -999.2500 DVO -999.2300 TENS -999.2300 NCN -99'3.2500 MRES -'999,2500 RH05 -999.2500 LL -999.2500 SSi -9'99. 2500 TENS -999. 2300 -999,2500 ~I~3 -999, ~50~ -999.2500 -999.2500 T-~S -939,2500 TENS 335,1~ NCNL 3325. ~OO - 999.2500 OT -999.2330 DTC3 -999.ZSOS SGq -999.2500 DVJ -999.2500 TENS -999.2300 NCNL -999,25~0 MRE$ -999,2500 ~H]f - ,~ ih - 99:9. 2500 -999.2500 -999.2500 -999.2500 -999,2500 -999,2500 -999,2500 -999.2300 -999.2500 -999.2500 -999,2300 -999.,2500 -999.Z500 -999.2500 -999.2500 -999.2500 -999.2500 -99'9.2500 1697.6875 -999,2500 -999.2500 -999,2500 -999.2500 -999,2500 -999,2500 -999,2500 -999,2500 -999,2300 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999,2500 -99'9,2500 -999.2500 -999,2500 1417.5975 -999.2500 -999.2500 -999.2500 -599.2500 -999.2500 -999.2502 -999,2300 -999.2500 -999.2530 -999.2500 VD OlD.H02 VERiFICATiS~ LI3TIN3 'PAGE 20 U -999,250S LS S2 -999.2300 QSS RES -999.2500 ~TE4 ]T~ -999.2500 TH]~ 2N~ -999.230D W3~3 RES -999.2500 MT~q ALI -999.2590 M~ES T -999.2500 31'L ,PHI ~I.1133 NR&T R 38.~803 RN~ SDT -999.2300 LDTL TL -999.2300 TE~S TSM -999.2500 DTS? -9)9.2500 -999.2500 -999.2500 -9~9.Z500 -9~9.2500 -999.2500 3.650~ 4,1257 -999.2500 -9~9.2500 -9~9.2500 LiTM TENS MT~ FCNL T~NS SG R T~NS -999.2500 SSi -999.2500 TENS -999.2500 CGR -999.2500 WiNS -999.2300 W5~S -9~9.250.:) GR -999.2530 TENS -9~9.2300 TENS 420,1~05 NCNL 33~I.5000 MDT -999.2500 DT -999.2300 DTC] -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -'999.2500 -999.2500 -999.2500 -9:~9.2500 1733.6875 -999,2500 -999,2500 -999.2500 :4: FILE TRAILER ~: :ILE N '& !4 E :EDIf .OOt ERVICE NAME : ERStON ¢¢ ~TE : AXZMUM LE~GTd : lOZZ~ ILE TYPE : EXT FILE N~,ME : . .302 ~ 0?4 ,VD OlO.HOZ VE~IFiC~TI~ Li3TiN3 O,a~ 21 'NTRY 3LOCKS TYP_ = Z IN~ SP::~,IFICATZ3N SL]C SERVICE SEqVIC tD 3RDER KS l T ~ ~ Z O0 O0 O0 O0 O0 O0 i! 00 S Z ZE 1 t 1 1 TYPE 000 000 OOO 000 000 OOO 000 000 000 uL~SS O0 ~0 0 0 0 O 65 73 65 66 FiL~ 0 0 0 0 0 0 0 0 0 ENTRY O i 5 .lin t 0 SIZE SPL: REPR PRDCESS CSDf (8CT&L) 1 58 O000OO00000000 I 5~ 00000000000000 I 58 OOO00000000000 i 5~ 00000000000000 i 65 gO000000000000 t 5~ OOOO00OO000000 ! 68 O00000OO000000 I 58 00000000000000 1 58 O00000000000OO .-,- DATA ~E~T 13178.4570 !TEN -999.Z530 ITEN -999,2500 )EDT 13100.2910 HTfq !T=N :936.3125 HTE~ tT:N 936.3125 )E~T 13000.2910 iTEN 1035.5B75 !T=N 1033.5575 )E:T !2)00.2)10 MTEq ~.TEN 896.8125 -i T :',,t iTEN ;396. B125 )E~T 12800.29i3 HTEN ~TE~ 367.5!25 HTE'~ ~TEN .957.3!25 )E:T 12700.2910 MTf'~ ~TEN 976.8125 HTExi ~T=N 975.8125 }EDT 12500.Z910 4T-N 833.3125 HTE~ iT:N 333.3125 -9~9.2500 .-9~9.2500 936.3125 555.3125 1035.6~75 5~7.~125 ~96.5125 .5D!.8125 B57.$i25 555.$!25 975.8125 B33.31.25 632.3125 HTEN MTEN Hlr=N HT£N HTEN MTEN HTEN -999.2500 -999.2500 502.6505 -999.2500 ~91.8906 -999.2500 755.3125 -999.2500 452.8~06 -999.2500 565.~125 -999.2500 ~3.3~3~ -999,2500 HTEN -999.2500 MTE;~ -999.2500 HTZN 502.5406 HT:~4= 935 . 3125 HTE~ 491.8906 HTEN 1035.6875 HTE~ 7:5.3125., HT=N B96.$125 HTE~ 452.8905 MTE~ ~57.B125 555.81Z5 975.9125 ~TEN 423.3905 HTEN 5'33.3125 VP, OiO.HOZ VERiFi~'',.,~T~'~.3',t LIST~'NS~. ~A~,=E. " 22 EPT 12500.2910 TEN ,~22,3125 T ~N 822.3125 EPT 12~00,2910 HT E ~,~ T _=N 796, 3 ! 25 HT:: N TEN 796' 3125 EPT 12300.2910 HTE~ TEN 633.8125 HTEq TEN 633.~125 EPT 12200.2910 HTE~ 'TEN. 8~4.3125 HT5~ T~ 8~.3125 EPT 12100.2:}10 TSN 910..3i25 TEN 910.3125 EPT 12000.2910 HTEN TEN 946.:~125 HTE~ TEN 9~6,$125 E;~T 11900.2910 T-=~ -999.2500 TEN -999.2500 ~T 1i~00,2~13 HT~ TS~ -999.25~0 ~T~ TEN -999.2500 E2T !ITOS.2~IO T E'4 - 999.25 O0 TEN -99~. 2503 'EPT 11600,291~ TEN -;99.Z500 TEN -999. 2500 E°T 11500. 2910 -~99,2500 ~T~ -999.2500 11~30.2910 -~99. 2500 ~E~T ii33J.2~I0 ~T~ ~TS'~ -999.2500 ~T E~q - ~ B ~. 2503 )E~T 11200.2910 ~TE'q -999.2503 ~22,3!25 594,.3125 795 · 31 Z 5 6:~4.5125 633.8123 5 ~96. L.~i 25 8¢4.3125 6~8.3125 9110.3125 5~39.8125 -9:99.Z500 -999.2500 -9~9.2500 -9~9.2500 -999.2500 -999.2500 -;~9.2500 -9~9.2503 -9~9.2503 -999.2300 -999.2500 -9~9.2500 -999.2'500 -999.2500 -9~9.2500 MTEN HT~N HTEN HTEN HTEN HT E N 497.8906 -999.2500 -999.2300 370.3~06 -999.2500 ~,26.3906 -999.2500 490.3906 -999.2500 :536.8125 -999.2500 -999.2500 279.3906 -999.250S 290.1306 -~99.2500 321.~06 -999.2500 333.5~6 -999.2500 340.3906 -9~9.2500 335.3305 -9~9).2500 332.6~05 -999.2530 343,1~q5 HTEN HTEN HTEq H T E N HTEN qTE~ H'T~ HTEN HT~ HTEN HTEN HTEN HTEN MTEN HTEq ~TE~ HTEN 497.3906 822.3125 ~Z0.8906 796.3125 370.3905 ,533.8125 426. 3906 8~4. 3125 490.3906 910.3125 586.8125 9~6.8125 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -~99.2500 -939.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 VP OlO.H02 VEqI;iCATiSN LISTiN5 o~&$E 23 TEN -999.2500 11100.2910 HTE~ TEN -999.2500 HTE~ TEN -999.2500 EPT 11000.2910 HT5~I TEN -999. 2500 !fit -Z ~; TEN -999. 2500 EPT I0~900.2910 HTi~ EPT 10~00.291~ HTE~ -999.£~00 HT5~ TEN -999.2500 Emi' 1 0700.2:~)10 HT E'xi TEN -999.2500 HT E ~,1 TEN -999. ZEO:J EOT 10600.2910 HTEN TEN -~9~.2500 HTE~ TE~ -999.2500 E?T 10500.2910 HTE~ TEi,~ -~99.2500 HTE'q TEN -999.25~0 TEN -999.2500 HTEq TE~4 -999.2500 EPT IOBOO.ZglO TEN -999.2500 T~N -~99.25D0 EPT 19200.2910 ~TE~ TEq -999.25~0 HTEq TEN -999.2500 IE~T 10111.3320 HTEq ITEM -999.2500 HTEq !TEN -999.2500 :ILE N~ME :EDIT .~02 iER'VlC= .N 'A ~E : 'ERSiOq .~ : ':~.XI~4U~4 LENGTH : 1:324 :iCE TYPE -999.2500 -999.2500 -9~9,2500 -999..~_500 - 999. -2:5,00 -9'99. 2500 -999.2500 -9~9.2590 -999.2500 -999.2500 -959.2500 -999.2500 -99~.2500 -9~g.2500 -9~9.2500 -9'99.2500 -9~9.2500 -g~9.2500 -999.2500 HTEN HTEN HTE~ HTEN HTEN HTEN HTEN HTEN HTEN HTEN HT2N HTEN HTE~ HTE~ HTE~ HT ~TEN HTEN -999.2500 316.8906 -999.2500 -999 o 2500 308. -999.2503 284.8~06 -999.2500 314o3~06 293.1 ~0 6 -'~'99.25DO -.999.2500 250.~906 -999.25~0 23!.8125 -999.2500 -999.2500 234.3125 HTE~ HTEN HTEN HTE~ MTE~ HTEN HTEq HTEN HTE~ MTE~ HTE~ HTEN ~TEN MTE~ HTE~ -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -99:g.2500 -999.2500 -999.2500 -999.2500 VP OIO.~OZ VE~IFIC~TIO~ LISTIN3 oaGE Z4 fXT FiLE NAM~ : iL~ N~ME :EDIT ERViCf NA~ : ERSiON ~ : ArE : AXiMUM LENGTM : ILE TYPE : REVIOJ$ FILE : .003 NTRY 5LOCKS }ATJM. S~rIF~C2Ti~N, ~ ~ !NE~ SERVi'E S:EqViC5 ID O~DER ~ ~E:T 'DL ~DT ATT EPT DMI --PT VD EPT Vj E~T 3L]'KS J~IT ~PI ~Pl APi ~mI miL2 SiZ~ S~L LSi; TYP~ ~L&SS =T O0 OOC CO 0 0 4 I WS/M O0 132 O!~ n O 4 1 ~ ~, OD 130 PJ OC ~90 O0 0 0 ~ 1 ¢ O0 000 OS O O ~ 1 V O0 SO0 O0 0 0 4 I 5 ~ 5~ PROCESS COCTAL) OOO0030OOOOO00 O00000OO000000 OOOOOOO0000000 00000000000000 OO3000OO0000OO V~ O1S.H02 VE~IFIC&TZS!~'LISTIN5 PAG5 25 13152. 3320 TPL -0.~3~5 FV~J 13100.1560 TPL 13000.186D TPL -0.4,395 FVL} ~Z900.~560 TPL O, 3877 FVJ IZ800.. ~550 TPL O. 3140 FVj 1Z700.t550 TPL 0.~500 12500.I~60 TPL 0.2925 mV'~ 12500.i550 TPL 0.5~25 1.2~00.1569 TPL 0.3526 ~VJ IZ]00.!560 TPL 0.3539 12Z00.t560 TPL ~.2g05 FVJ 12100.1560 TPL 0 · 27T~ FVd 12000.1~60 T~L !1911.~320 T2L -~9~.Z500 .003 15.5801 EATT -0.4~14 19.~!1i EATT -0.4395 16.3~48 EATT -0.4399 ~.~551 EATT 0.2~17 10.2051 9.8926 EATT 0.2725 9.9551 EATT 10.5~01 EATT 0.5000 11.5~01 ~ATT I!.Z6T$ 5ATT O.2998 10.0801 E~TT 0.2803 9.6926 E~FF -9~9.Z500 E~TT -9~9.Z~00 ~TT 486.6¢06 585.3125 96.6523 73.1523 88.5523 72.5523 1.12.5~98 127.i523, 114.1523 52.3242 85.6523 -999.2500 EPHI EPHI EPdI EPHI P H I PHi EPHI P H I E~dl 27.9Z97 ~8.6816 31.3965 7.8613 5.$94t 4.5¢10 5.0293 8°4473 14.2578 12.5000 5.'7617 3.0273 -999.2500 -999.250~ VP OiO,HOZ VERZFZCATZS~ LiSTINS P~.G5 25 · ~ FILE HEADER ILE NA~E :EDIT ERV!CE NAM5 : E~SION ~ : ATE : ~XIMU~ L~GTM : 102~ ZLE TYPE : R~VIOUS FiLE : COMMENTS 'UN ml, D~TE L2:SGE,]: Z~-MAY-85 .DP: L. ~. CUDNEY PErMaNENT 34TJH: MSL ELEV OF PERM. D~TiJ:~4: .0 F ~JG M~ASJ~E~ :~OM: RK5 ELEVATIONS: K3: 52.0 DF: 51.0 V= OlO.H02 VERIF!CATI3~ LISTIN3 oAGE 27 P! $,-Z~iaL NJ: 5002921542 GL: 13.0 F EPTH-DRILLER = 13423.0 EmTH-LDSS~R = 13171.0 TM. L3G INTERVAL= i31=~.0~, OP LSS .INTERVAL: 1!950.0 C~SiNG-DRiLL~R C~SING-LOGGSR ~Sl~'~N ~ N~iGHT ~!T = 11)58.0 = I1950.0 = 9.52!5 = ~.5 " = !3~23.0 'Y:~E FLJiD = LIGN3 SALT EN$iT¥ = 9.~.0 ISSOS!TY : ~.0 .S H : 11.9 LdlD LSSS : 7.5 lqE CIRC STOP'E3 IlO0 IME LJ~SfR 3N 5TM.:13~] (5-2'7) AX R[C. T~MP. = 170.0 O: SS'JRCE i3~ S,~.P~ =. = CiR'ULATED R'~ : .~i3 S 59.0 DF R:IF : ,303 ~ :57.0 P~ q~t~ : .51~ ~ 59.0 D~ CD'JRC~ RMF/RMC = ~,:~.StNt~S Rq AT SMT. : . 154 ~ 170. u~= q'~; AT BHT : .110 ~ 170. OF RqS AT BHT : .230 S 170. OF OSGiNS UNIT NO: 3290 .DSS:lNG UNiT LO': PRUDHSE :iEL3 ;NSZNEER'_ . ,O. NAR" iiTTNESSED ~Y: SCHUMACHER/~RZYS~SZ~SK:/O~]~SET iC = C~LI :LJID DENSITY = 1.0 1/2" ST~DOFF3 USSD DH QLL ~ND =~RaY SONIC. D~D ~OT 3~ TO BD~T~M ~T CLIS~T'S ~5~JEST. ~ Z" q~L~FIND~q :~O 3" ~L$ USED ON ~OTTOM TOOL 3F aLL L~GGiNG )~SC~NTS. 15003 ~PM CL. i~ ~FTER C~L!)~TiON CN DLL~ CA~I~RATiON 2~L~Y =AIL~ N~ILE ATTemPTING TO G~T 3LS ~ 754 NG3 B 742 DLC 0 761 ICC ~ 123 SLS VB 81 ~M A.~ 950 ~LL INTErPreTATIONS A~E OPINIONS ~A$50 ON !NF'-_',R~NCES F~DM 5L~CTq!CAL OR )'THER MEAS:JR~M~NT'S ~ND N~ C.~.NNOT, ~NO DS NOT GU~qA?~TS~5 TH~ ~CCJ~CY OR ;ORRECT~6SS OF ~NY iNTERPR~TA'TiONS,~ AND WE SHAL~ N~T~ 5XCmmT~ !N THE CASE .CSS~ LOSTS, OAq~ES Oq EXPENSES INCJRRED OR SUST~i~ED 3Y A~YONE ~ESULTZNG :RO~ ANY INTERmqETATiON MADE ~Y ~NY OF CUR ~I;~RS, ~G~NTS~ O~ ~MPLOY~ES, 'HES~ !NTERPR~T&TIONS AqE A~SO SUBJECT [0 OUR GEN~L TE:qMS AND CO'~glTIONS ~S SET OUT iN OJR CORRENT PRIC~ SCHEDULE. VP OIO.HOZ V~iFIC~T!Qq LISTIN3 P,~GE 29 :~ 2~T~ FORMAT RECORD..~ NTRY ~' OCKS~ TYPE :SIZE 2 i REPR Ct:DE ENTRY 5.5 D 66 73 60 VP OlO.~Ol VE~iFIC~ri]'~ LISTIN~ o~S5 30 ATOM SPECIFICiTI2N N-=M SE~ViC5 SS~VIC~ 15 JNiT ~'PI AP1 AP1 LOG TY~E CLASS S ~ M M 00 220 09 :3:4 M M 00 ' G ~.; I 00 3 ! S, 0 Mv O0 010 Cl U~ O0 000 U~ 90 OOO OO 2 ~ M ~ 0 0 8 23 = O DEG~ O0 5SO 5,? L ~ 00 635 2 O0 000 O0 ~J O0 g90 O0 C ~ S 00 330 3 CmS O0 330 30 GAPI O0 310 L3 O0 635 O.iMM O0 823 5~ D~G~ O0 660 50 3 ~ P I 00 3 ! 0 01 i ~ 00 Z g ? 0 :3 / C 3 0 ,O 350 02 G/C3 O0 355 00 3 ~ 3 01 ~S O0 35~ $ ~ S 0 '0 3.5 ~ ~ I '~S O0 95~ Ol S~S O0 354 Ol C~S O0 000 - ~ S 30 090 03 0~'~ 000 O0 000 93 L5 JO 635 21 3=GF O0 660 50 S~'~i O0 310 O1 ~J 'O0 719 50 ~ ~ M 00 793 52 ": 5 00 310 0 . - > S O O 313 31 - a S :30 31 ? 01 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 O 0 0 0 O 0 0 0 65 66 FrLiE 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ,.3 0 O 0 . lin SiZE SP L 1 i I I I i I 1 1 1 I 1 1 ! 1 1 t t ! 1 i I I I ! ! 1 I 1 1 I 1 1 I i I ! 1 I ! 1 1 ! ! P~OCESS (OCTAL) 003000000,00000 00000000000000 OOOO0000000000 O0000OO0000000 OOOO0000000000 O0000OO0000000 00000000000000 O000000000OO00 5~ 0'3000000000000 6~ 00300000003000 5~ 00000000000000 58 00000000000000 5~ O00000OO000000 58 OOO0000000OO00 5;~ 00000000000000 6~ 00000000000000 5~ OOO00000000000 5~ O0000000000000 5~ OOOO0000000000 58 O000OO00000000 58 00300330000000 58 00000000003000 5~ OOO000000OO000 5~ OOOOOOOO000000 58 O000OO00000000 58 3,3000030000000 58 O000000000OO00 58 OOO300OO000000 53 OOO00000000000 5~ 300000'30000000 5~ OOO00000000000 58 O00000OOOOO000 5:~ OOOO000OO00000 5~ :3OO00000OOOO00 Si OOOO00OO00000O 68 OOOOO30OO000OO 5~ 00030030000000 55 OOOO00OO000000 5~ 53 00300000000000 55 6S 55 $~ 5~ 6~ OOOO000OO00000 53 OOOOOOOOO00000 V~ 010.~02 VERI~=!C~TiO>~ LiSTiN3 P~!3E Bi EPT P 20 R~T CNL T~ U S 2 RES ~T~, R E S JT T T~C ~.~T R&T C ~IL 13~$5.0000 LL$ -999.250~ SVO -~9 . 2530 -99~.2500 RNR~ -999.250~ -~99. 2500 -99'~.2530 -999.2503 LS -99:~.2500 -999.2500 MT=q - 999 · Z 50 O T -999.2500 W3N3 -999.2500 MT2q 54.7517 DTL -:~9.2500 LSDF -999.2500 DTL -~99.2500 3~MM O0 523 3~37 O0 5,50 L. 5 O0 535 G~PI O0 3'10 C mMM 00 ~ Z 3 3=GF O0 550 L~ O0 535 :J S/~ O0 520 :jS/F O0 520 ~I O0 310 L5 03 635 US/F O0 520 US/= 30 520 3&PI O0 310 O$/P O0 520 JS/~ O0 32O L~ O0 ~Pi O0 310 J$/~ O0 530 U~ O0 000 L B 03 53 5 -99 -'99 -99 -99 -99 -99 -9 ~ -9~ -9)' -99 -9~ -9~ -9~ 9. 9. 9. 9. 9. 4.. 9. 9. 9. · 2. 3. I. 7. 7. 0. 250O 2500 2500 2500 2500 ,:.500 2503 2500 2530 25.00 2500 2500 ~SO0 5t17 2500 2503 7675 05!0 1235 2255 3799 3799 Ol O1 5O 21 OI 21 O 0 8O Ot 21 O0 16 O0 2i i 5~ 03300000000300 i 5~ 00000000000000 58 00000000030000 1 58 00000000000000 I 58 O0000000OO0000 I 58 00000000000000 i 5~ O00OOOOO00000O 5~ 00003030000000 I 5~ 90000000000000 ! 58 00000000000000 I 58 O0000000OO0000 i 5~ 03000030000000 I 5~ OOOO0000000000 1 68 O000OO00000000 i 58 OOOO0000000000 i 5~ 00000000000000 i 5~ OOOO0000000000 1 58 00000030000000 1 5~ OOO00000000000 I 5~ O00000OO000000 i 5~ OOOO0000000000 ! 5~ OOO00000000000 5;~ O00000OO00OO00 i 5~ OOO00000000000 LL] 5.7233 SG~ 2~.7050 SIO 7:59.3125 DV3 16.37'29 !4T=~ 158.62~2 TENS 5415.2500 hiP~i 0.4'~3 NCNL 6¢57.2500 T='~S 5327.2500 MR~S 0.i2!$ C~LZ 12,5595 ~HS~ 2.5256 P~= 4.2742 LL 175.6875 LL3 -999.2500 SG7 -999.2500 :SlO -999 ~59 ' - . · ~ 0 OVO 999 2500 MTf~t -999.2500 T~NS -999.2500 N~i -999.2500 NCNL -999.2530 TENS -999.2500 MRES -9~9.2500 C~LI -999.2500 RH3~ -999.2500 °E; -999.2500 LL -999.2500 LZTd -999.2500 SSI ~LS -'99'9.2500 TENS -999.2500 SSR -9~9.2500 CGR -99'9.2500 UR~ -999.2500 WiN3 -999.2500 W4N$ -999.2500 WSNS -999.2500 T~N,S -999,2503 S~ -999,2500 ~TEq -999.2500 TENS -999.2500 G2 17.3330 TfN$ 2151.5000 LOTL -9~9.2500 SSq -999.2500 TENS -9'~9.2500 SG~ -9~9.2500 JTST -99~.25J0 T=~S HOg VF_RIF-iCATI2~t LiST~', ~ U 323.3906 L$ 32 352.8205 QSS RES 0.1216 MT-q O]'~ 0.5371 THDR 2~ 29.4893 W3N3 R E S O. 1235 ~,~T ~ q AL1 -999,2500 MRE5 T 7~,~523 DTL DT 0.0000 LSDT ~'T 83.5273 DTL ~TC3 76,0273 DTSq ,EPT i3000,0000 LLS .P -24,4~82 SVO ~iO 2245,5000 MR~S iR~,T 3,4338 RNR~, "CNL 772.3125 SR ITE~ I72.6~75 GR ~RH3 0,029~ O,~i ,d ~66,1~05 LS ~S2 373,5g05 ~SS ~R~S 0.1215 MTn'4 'OT.& 1.7390 TMDR 12NS 95,2773 W3N3 IR~S 0.,I235 M'TEq ;AL! -99~,2500 MRES ~T 92,5523 DTL IDT 0,0000 LSDT IT 94,2773 DTL ~TCS 62,0117 :3TSq )EPT 12900,0000 LLS ;~ -52,9~83 SV2 iR&T 1,05~7 RNR~ :C~L 5523.2500 3R ITE'q i72,2575 GR ~Ri] -0.0127 DP!Z .O t99.5575 LS ~S2 255,3905 ~SS ~RES 0,1221 MTEq ;2N$ I'2.~2~ W3N3 IR~S 0,1140 MT~I '.~i -999.2500 MR~S )T 52.0117 DIL !37 O,O00O LSDT )T 55.2517 JTL )733 52.01!7 DTS'4 -20.1502 SV3 i14.~75 MR:=q ! .38~7 337.3906 0.0015 17 !. 9375 2.3948 158. ,5242 -999,2500 7~, 02?3 79,6523 83.5273 137.3125 8.4.2,:O9 ~ · ~ 33 ~ 0.1235 3.7249 55 · ~773 55,7773 32.5195 0.00~9 1 72,5875 '7.8406 37.5430 158.7 3 6 7 -'~ ~'9. 2500 9.3,5523 95.6523 g4.714~ ! 1 O. O 273 736. 0712 C .1240 1.1505 13.5566 13.5556 3.4658 23 !. ! 375 172.1575 1 · 20C 3 15~ · 2~67 -999.2500 ~I.~57 53.1367 57.g7~2 132.0273 lg3,7696 !0.4393 LIT1 ~-S N~NS TENS MT~ LDTL T~NS DTS T LL] MTE~ TSNS LIf~ URAN N~NS T~NS LOTL TENS DTST LLD TENS C~L: L IT ~ SSR UR2W TENS MTE~ L~TL TENS CTST L'3 SZO 86,0273 SSI -0,0352 TENS 24,7380 CGR 0.8340 5~15.2500 -999.2500 TENS 96.5~98 4.7.7517 5675.2500 23~.4375 i0.3~31 SGR 591.3125 153.7367 TENS 34.:5703 NCNL 4611.2500 MRES 9.9160 4.2039 LL 134,0525 SSi -0.0234 TE~S 70,9023 !.8~9'7 W1N3 4947.Z500 -999.2500 TENS 77,7773 TENS ~!.25t7 SGR 5175.2500 SG~ 195.0525 TENS "240,1465 SGR 75.5273 JVO ! 5 8.2 ~67 T E N S 0,9277 NCNL 30~7. 2500 '9.3591 5,0 320 LL ~! ,9992 S$I -0,0093 1 ~, 0176 C G O. 6 Z O 1 W I W 3 4.3171 5~7,~ .250'3 -999.2500 TzNS i~. 4551 ~E~5, 56.!367 52 11 · 25 O 0 199.0525 TENS !73.3335 SG~ ~05,~525 ~V3 !56.9~67 TENS ~.3~45 NC~L 270,8906 5027.2500 18.0830 79.8398 ~.~' 5959 -999.2500 -999. 2500 507t .2300 69.5898 24.7080 5415.2500 70,9023 25,0830 4947,2500 2877.5000 0,1216 Z,15Z6 259,8906 2~2,5625 4811.2500 57.0117 233,9375 9,3848 -999.2500 -999,2500 4911.2500 ~!5.3398 70,9023 ~9~7.2500 I~,0176 422,3906 5167,2500 6083,2500 0,1221 2.5~87 101.3398 19'9.43'75 5047.2500 9.6191 ~1.75!7 !.~395 -999.2300 -999.2500 4891.2500 13.5098 14.0176 5167.2500 29,1143 213,3125 5127,2500 35~3,300J .Vm OlO.HO2 VE~i~ICATIO~ LISTiN3 °AiS~ 33 :CN~ IT E.~4 .U ~RF:S 'ALZ )T >TC3 ;P ~R~T :CML ~TE~ .d qRES ~OT~ iRES :ALZ )T )T ;P :CML ~TEq .U ;S2 ~2NG ~R_:S ' A - Z )T )TC2 263 17 ZO 27 -99 5 1270 -6 ~3 17 Z? - ::)9 1250 16 19 26 1250 1.500J GR 1,0525 GR 0,0107 ?,9375 LS 0,1225 MTE~ 1,025~ T~Dq 2,6355 N3NG 0.12~5 9,2500 MRES 5,2517 OTL 0,0000 LSaT 0,~2~2 DTL 5,0i17 DTSq 0,0000 LLS 9,2227 SV3 2,6~05 MRES 1,1221 3,2~00 0-3125 0.002~ DPHI 1.3125 LS 0.1230 MTfq 0.4395 THJ~ 8.t143 WSNS 0.1245 MTE~ 9.2500 3.2017 DIL 0.0000 LSDI 5.4 ~ 9 '2 D T L 5.0117 DTS~ O.O00J LLS 2,3949 SVD 3,3125 MR~S 0,9702 RNR& 5,2500 ER 9,1375 GR O.OOOO DP~l 3.5525 LS 0.1235 ~TE~ 5.13~7 WSN3 0.1250 MTf~ 9.255t 9.5117 DTL 2.3B57 DTL 2.~I17 9TS~ 0,0000 LLS 2O 3 0 171 2 22 156 -9 ~9 37 5O 103 ~Z 0 I t9 19 3 0 0 7 155 53 327 26 0 i I9 19 1 192 159 1 7 0 50 .5155 .5525 .0525 · 5061 ,3'7'99 .9357 · ~-.~ 0 O .51t? · 5357 .0742 .02'73 .5193 ·1245 .2051 .7509 .7549 .5156 .9375 .0073 .3125 .6~63 . ~30~ ,2500 .76 I7 ,7773 .1992 .2i4~ .7943 .6511 .1250 .0098 .!130 .6375 · ~J155 .1875 .0059 .9117 .12~5 .2517 .7517 . .0273 ,5~0~ TENS C~LI LiTH ~] L S SG~ UR~N W4NS T~NS MT~ GR LOYL TENS DTST LLD MTE~ NPHi TENS C~LI LiTm ~LS UR&N TENS MTE~ GR LOlL TENS ~ST LLD GlO NP~Z TENS C&LI LZTH QLS TENS L&TL TENS OTST LLD 5011.2500 4.13 Zt0 LL ~4,0¢30 SSI --0:.024~ TENS 29.1 0 · 377 2,1553 WENS 5127,2500 GR -999,2500 TENS 23,2705 TENS 94,2773 SG~ 5223.2500 SGR 201,0525 TENS i!54,9~48 70,71~8 155,9242 TENS 1,3672 NCNL ~535.2500 .MRES 9,3926 4,5~82 LL ~4.5~30 SS1 0.0~54 TENS i6.2705 1,0284 WINE 1,4~15 WSN3 4B07,2500 GR -999,2500 TENS 19,083D TENS 56.135'7 SGR 5311,251)0 SG~ t59,0525 TENS 3133,0225 SGR i17,95~8 DVO 154,9117 TENS 0,48~B NCNL 4.547.2500 MRES ).2207 5,552~ LL 38.~1a0 SS1 -0.0215 TENS 19.7393 CG~ 1.Z285 !.4~44 WEN3 4953.2500 169.8125 T~N$ 20.2393 T~NS 51.5117 5031.2500 199 m$25 792.0~90 SG~ 0,1226 2,5457 134,7148 203,t875 5011,2500 25,2080 95,0273 3.6096 -999.2300 -9~9,2500 ¢743.2500 26.489,3 29.1143 5127.2500 16.2705 435.390:6 4807.2500 5357.2500 0.1230 2.8487 104.2773 195.3125 4635,2500 9,8~95 55.2305 0.7207 -9~9.2500 -999,2300 ~907.2500 18.0361 16.2705 19.7393 4963.2500 7127.2500 0.1235 2.6897 95.9023 I94.3125 45~7.2500 10.21.29 50.5992 I.~444 19.8143 ~4~7.2500 4537.2500 20,3543 19.7393 4953.2500 3~.'3013 VD OIO.H0! VfRi~iC~TID'4 C!STiN3 PAGE 34 o -39. P.320 SVO IO 546,3125 ~R ES R&T 1,0521 RNR~ CNL 4707.2500 G~ ~T~q 157.9125 ~ U 295,1~05 LS S2 34~.3~0~ QSS :RES 0.1250 MTEq 2N3 49.6580 WSN:3 :R~S 0.t265 MT'~ ~ ~Li I0.53~3 MR~S T ~].2517 OTL Dr O.OOOO LSDT T ~9.0117 QTL ,T~'3 ~5,0:117 DTS~I 5PT 12~00.0000 LLS P -11.052~ SVO IO 135~.6~75 H~S CNL 1164.6~75 ~ T5~'i 167.0525 GR R~S -0.0053 DP~I O 253.$375 LS S2 2~.3~05 QSS RES 0,1260 HTEq OTa 0.5371 TMSR 2 N3 35.5 ~3 ~ WSN$ RES 0.!27~ MTE~ ALI 9,775~ X~ES T ~4,9023 DTL or O.O00O LSDT T 73.1~23 DTL T S2 54,3273 37 S ~ 5mT 12300.,3000 LLS P -16. 4170 SVO ? ~0 73.5393 MRZ-.S RAT 2.3792 CN. i~05.5~75 TE~ 165. 9375 U 271,1405 L5 S2 297,3905 R~S 0,1265 MT~'q OT~ 3.293J T~]~ '2N3 25. 3543 WSNS ~R~5 0.1274 MT~.I ALI 10.4004 MR~5 ~T 55. ~23 ~3 T O. O0 O0 L S ] r ~T 67.8393 5TL 36,1580 0,1265 1,1290 ~ ~ 0049 27,0049 9.2295 0.0723 157,8125 0,3413 11.5176 154,2~67 0.1250 47.5117 ~ ~. 3:857 ~+ 3. '3 ~ 67 132.0273 !07,5705 18,4~24 0. 1274 2, ,5061 Z 3, :89 55 13,9160 26'8,3905 0,0176 157,0525 i3,6660 163,4~92 ~, 527= ~8. 3867 70.~398 111.0273 ! 33,8922 20.55i8 9,1274 2.5081 14,0~8~ 14,0~9~ 15.0391 2;35.3906 0,0317 155,9375 1.6299 13. OBO1 152,5617 0,1265 55,7773 56.~023 56,21'48 SiO MT~ TENS CALl LiTH ~LS UR~N W4N3 TENS MTEM LDTL ~:TST LLD SIO MTEM NPqI TENS CALl LiTH ~LS UR~N T~NS LDTL TENS ~ F$T LLD MTE~4 NPqi TEN S CALl L!T~ N~.S SG~ TENS ~,T ~ v! L&~L TE'~S '99.4023 OV3 154.2367 TENS 0.3~18 NCNL ~427.2500 M~ES i1,212g RH]5 8,1660 LL 57.5117 SSl -0.0!93 TE~S 30.30t~ CGR 3.0~91 W!N3 · 4.317! W:SN$ ~23.2500 15~.5525 TENS 33.1580 TENS 48,2517 SGq. 455!,.2500 208.0625 'TENS 205.8~65 SSR 2~8,4375 DVO 163.4~92 TENS 18.2129 NCNL ~583.2500 MRES 3.3577 LL ~7.1~30 $$! 0.0155 23,~!68 CGR 1.6561 W1NG 1.3563 W~N$ 4571.2500 GR 167.5525 TENS 33.g~92 TENS 57,0273 SG~ ~495.2500 SGR 217.0525 TENS ~13.6~28 SGR 222.6~75 DVO 152.6517 TENS 18.2129 NCNL 4327.2500 MRES 10.3!23 2.8108 LL 73.3393 SS1 0.0~05 TENS 21 0~05 1,6216 ~lW3 2.7542 ~423,2500 3R 156.5525 TE~S 37.5&~0 TENS 55.&023 SGR 4431,2500 486.1406 4923.2500 5315.2500 0.1250 2.5510 1'59.3125 253.I~06 ~27.2500 8.0176 94,2773 0.7197 30,8174 44&7.2500 ~575.2500 31.6611 30.3018 ~923.2500 23.4268 314.1406 4571.2500 2919.5000 0.1250 2.4709 141,3125 204,!87~ 4583,2500 11.9395 B7,~648 0.0000 24.0361 4427,2500 4471.2500 25,3018 23,4268 4571,250'0 2~.. 0205 34.1992 4423.2500 3525.5000 0.1265 2.4514 1~9,9375 212,B125 4327.2500 11.2~32 58,g398 2,7542 i4,9032 4151,2500 4357.2500 21.0205 VP OiO.M02 VE~I~iC~TI!]~ r!STiNS D~GE 35 T'3 55.0273 3TSq EmT 1ZZO0.O000 LLS P -26.4325 SVO I0 1104.6~75 T~M 165.1~75 ~3 -0.0~4~ DP~i U Z05.3t2~ LS $2 270. i ~06 ~S S ~ES 0.12,55 MT~ OT~ ~.2~41 Z~ 53.2517 RES 0.128~ ~T~ ALI 9,5582 ~RES T 55,365? DTL DT 0,0000 LSQT T 61,0117 DTL TCD 57.0117 DTSq E ~T 1 2100. OOOO LLS P -6.9719 SVO I0 12¢5.6~75 MRES RAT 1,7'491 RNR~ CNL 2815,5~00 G~q U 1S3 937~ 52 271.S~06 QSS RES 0.127~9 HTEq OT~ 0.4395 TH~ RES 0,128~ qTEq &Li 9.0~01 M~ES T 50.8~67 DTL DT 0.000~ T 55.~398 OTL ~u 61 0117 D T'S ~I E°T 12900,0000 LLS P -999,2503 SVO iS -999,250.3 ~R ..1T -999.2300 CNL - 99-). 2,500 q~] -99~.2500 .U -999.2500 LS '52 -999.2503 QSS Iq~S -999.2~0~ )OT~ -799.2500 ~Z'~S -999.2300 IR~S -999.2500 HTE~ ;ALi ZO,~Z~ 133.2501 Z0.9393 0.1284 !.153~ Z1.09~6 Z07,6875 155.,157~ 1,9571 161.6~92 53.2517 75,0Z73 51.3~67 106.0273 ~3.5083 14,9~98 S,lP84 !,8956 21.3955 21.3955 3.~180 23:5.6875 164,8125 1,&503 I0.99~! 150.8517 0,1289 5'9,0117 S3,1307 112,0!73 -999.2500 -9)9.2500 -999.2500 -999.2500 -9~9.2500 -999.2500 -999.2500 -999.2~00 -999.2500 -9~9.2500 -99'9.2500 -999,2500 -999.!500 0,i~74 OTST LLD .SiO NPHi TE~S LI T~ QLS Uq~N TE~S MTEM LDTL TE~4S DTST LLD S.i2 NPHi TE~S CJLi PEF LIT~ TE~S MTE~ ~R ~T~ DTST LLS Si~ qTE'4 TENS LIT~ SS~ TE~S ~Tfq 236.0§25 TENS 208,9911 SGR 228.4375 DVO 15!,6:~92 TENS 0,9!77 NCNL 4495,2500 MR~S 9,8223 R~$~ 4.2390 ht 41.6.580 SS% -3.033~ TENS 3~,1255 CG~ 2,70'7~ Wl~ 4,6323 WENS ~6~7,2500 GR 155,8125 TEqS 22,7B61 TENS 57,5117 SGR 4727,2500 SGR 209,0525 TENS 98.461! SGR 243.9375 t50,8517 TENS 10.4304 NC~L ~6~3,2500 M~S 9,0410 3,9143 LL ~8,32~2 SSI 0,0556 TENS 31.3799 CG~ 2.5530 3.~350 4815,2500 SR 154,8!25 26.$51~ TENS 57,8~57 SS~ 4?95,2500 S~ 2~4,0525 TE~S -999,2500 :SG~ -99'9,2500 OV2 -999,2530 TE~4S -999.2500 NC~IL -999.2500 M:R~S -999.2300 RH~3 -999.2500 -999.2500 SSl -999,2500 T~S -99'9.2500 -9'99,2500 -999,2500 WE~S -~9.Z53:3 GR 163,t~75 TE~S ~ZS.2500 34.1055 259.3906 ~687.2500 6723.2500 0.1265 2.5331 105.0898 194.3125 4495,2500 1!,9755 112,4023 3.9436 17.5936 4387.2500 4~71,2.500 33.2617 ~ 1055 46~7,2500 31,3799 137.6875 4815.2500 5339.2500 0.1279 2.6506 109.1525 202.0525 4583.2500 12,8457 104,~$48 1,3741 27.9~24 ~487,2500 4431.2500 23,~955 31.3799 -999.2500 -999,2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -999.2500 -99'9,2500 -999,2500 -999,2500 105,777.3 405!,5000 CiO.HOg VERIFiC~T.IS',,~ LISTiNS ~'aSE 35 >T 91 .Z773 9TL !DT -99~R.ZSO0 LSDT iT -999.2500 DTL !T33 -999.i500 3T3'4 )EPT 11910,5000 LLS .? -99'9,2500 SVO tR~T -999.2500 RNR~ :CNL -999,2500 3R ~T~M -999,2500 GR ~RqJ -999,2~00 .O -999,2500 LS ,S 2 - 999.2503 DSS ~R~S -999,2500 MTEq ~OT~ -999,2300 THJ~ ~2N'3 -99:9.2500 N3NS ~R~S -999,2300 ~ALi -999,2~00 MR~S ~T -999,Z500 DT~ ~D T -999,2 ~0 ~ L SDT ~T -~99,2500 DTL ~TSS -999,2500 DTSq 90,0i73 -999,2500 -999,2500 -999.2500 -'999,2500 -99'9.2500 -999.2500 -999.2500 -999,2500 -999°2500 -999,2500 -999.2'500 -9~9.2~00 -9~9.2500 -9~9.2500 -999.2500 -999.2500 -999.2500 -9~9.2~00 GR LDTL TENS DTS'T MT~M T~S LZT~ QLS SG~ UR~N TENS MTEM L2TL TENS CTST 101.02_73 TENS -g99.2530 SG~ -999,2500 SGR -:999,2500 TENS -999.2500 SGR -999.2500 DVD -999.2500 TENS -999.2500 NCNL -999.2500 MRES -999,2500 LL -'999,2500 SSi -99'9,2500 TENS -999,2500 CGR -999.2500 WiNS -999.2500 W5NS -~'~9,ZSOO GR -999.2500 TENS -~99,Z300 TENS -999,2500 SGR -999,2500 SGR -999,2500 TENS 4415,2500 -999,2500 -999,2500 -999,Z3'00 -999,2500 -999. 2500 -999. 2500 -999.2500 -999.2500 -999.2500 -999,2500 -999,2500 -999,!500 -999.2500 -999,2500 -999.2500 -999.2500 -999.2500 -999,2500 -999,2500 -999.2500 :iL~ N&qE :EDIT ~¢iCE NAME : ~TE : i~XiMUM LENGTH : :iL~ TYmE ~V'ZJJS ~ZLE : ~ · '- 3N L.13TiN3 Pa.~E 37 V~ 010 HO2 VERi~I~,.~TI ~ ' ~ ~;~ JATA =.3~'~,.% T,, ~ EC ~,.l'.n~, .,."';;~ NTRY ~LOC~S TYOE SiZ= ~ 1 ATLJ SPECIFICATISN SERVICE S;RV~CE_ ~ T E N D L R 'TEN LOR TEN CNR TEN NGR TEN -:~R TEN SIR TEN STR BLDSKS LOG TYPE CLASS ~F OO 000 OD L~ O0 000 O0 L5 O0 OOO L~ O0 000 O0 LB O0 000 O0 La O0 000 ~ O0 00~ O0 LS O0 OOO 03 ~T 13178.¢570 HTEW TEN -999.2503 HTE~ EPT 13100.2~10 HTEN T:N I02~.5~75 HTEN E°T 13000.2910 TEN 962.3125 E~T 12900.291.9 T=N 257.5125 ~°T 12300.2910 HT~N TEN 953.:~125 HTE'~ i~T 12700.2910 iT=~ 557.;~125 ,EPT 12500.2~1J HT:~ -929.2500 -999.2500 1028.5875 -999.2500 952.3125 -999.2500 9 57.81 Z 5 -'99 "9.2500 953. ,~125 887,~12~ 999 ~ - - · ,.DO0 939.3125 HT E ~,~ HTEN H.,. r.N HTEN ~TE~ HT~N rOD= ,~ :i. ENTRY 65 0 65 1 73 5 55 .lin 65 t FILE SIZE SPL 0 4 t 0 ¢ 1 0 4 1 0 4 1 0 a 1 0 4 1 0 ~ 1 0 ¢ 1 -999.2500 2~7.1375 555.3125 1112.6875 597.8!2:5 943.3125 601.8125 9~1.8125 656.81 Z 5 !0g!.3125 5~8.'~125 i 03:~. 5 {75 502.3125 · R~R PROCESS CDDE (OCTAL) 5S O000000000OO00 58 00000000000000 5~ OOO00000000000 5'~ 00000000000000 5S 00000000000000 5~ 00000000000000 $~ OOO00000000000 53 00000000000000 HT~N -999.2500 HTEN -999.2500 HTEN 555.3125 HTEN 1028.6~75 HTEN 597.8125 HTEN 952.3125 HTEN 60!.~125 HTSN 967.8125 HT~N 953.B125 HTEN 648.3125 MTEN 887.81!5 HT~N 502.3125 Vo 010 HO~ VERTF!CdT~2q LISTiNS PaGE ~TEN E~T T~ ~PT TEN ~PT !TSN ~T ~PT iT~N T~N ITSN t~DT IT~ ~T~ ~T~ ~ )~ PT ~T~N ~T~N 4TEN 909,3i25 H'TEN 12500.2910 qTE~ 930.8123 HTS~ 12400.2910 HTEN 234,$125 HT~N 12300,2~10 778,8125 HT~N 12200o2910 935,~125 12100,2910 9~6.,$123 HT~ 12000,2910 -999,2500 H'T~ 11900,2910 HT~ -999,2500 -999,2500 ll700,Z~IO MT~N -999,2500 11500o2910 -999,2500 HTEN i1500..2910 HT~N -999,2500 11400,2~I~ -999,250J 11300,2~10 -999.2500 ii£03.Z~IO ~T~:~ -999,2500 I!IO0,29IO MT~N -999.2500 ~TEq -999,2500 -999,2500 10803,2913 532.31i5 '930o~125 559,3125 834.8125 778.8125 4~7.3906 935.$125 522°3125 936.B125 599. 8125 -9 ~9. 2500 6 ~ 4.8125 -999.2500 -9~g,2500 -999.2500 -999.2500 -9~9.2500 -999.2~00 -9~9,2500 -9~9,2500 -999,2500 -999,2500 -'999.2500 -929.25~0 -999.2500 -999.2500 -9~9.2300 -999.2500 -9~9.250C -999.2500 -999,2500 -999,2500 -999.2500 HT~N HTEN' HTEN HTEN HTE~ MTEN HTEN HTEN HTEN HTE~ HTE~ HTEN HTEN ~TEN HTEN MTEN HTEN HTEN ~T~N HTEN MTEN HTEq HT~N MTEN ~T£N 891.8125 594o3125 830.8125 6~.8I,Z5 7:96.8125 586.8!25 $94.8125 608.3125 849-8125 589.8125 920,8125 -99,9.2500 -999.250D -999.2300 -999.2500 -999.2500 -999.2500 -929.2500 -999.2300 -999,2500 -999.2500 -999.2500 -9'99. Z 300 -999. 2300 -99'9.2500 -999.2300 -999.2300 -999.2300 -999.2~0~ -999.2~0 -999.2300 -999.2500 -9'39.2300 -393.2500 -999.2300 -939.Z300 HT~N ~T~N HTEN HTEN HTEN HTEN HTE~ HTEN HTE~ HTE~ ffTEN HTEN MTEN HTEN HT~N HT6N H'T~N HTEN HT~N HTEN HTEN HTEN MTEN HTEN HTEN MTEN MTE~ HTEN HTEN HT~N ~TEN HTSN HT~N MT'EN 909.3125 594.3125 930.8125 5~4.8t25 834.8125 586.8125 T78.8125 $05.3!2~ 935.8125 3B9.8125 996.8125 -999.2500 -999.2~00 -999.2500 -999.2500 -999.2500 -999.2500 -999,2500 -999.Z500 -999.2500 -999.2500 -999.2500 -999,2500 -999.2500 -999,2500 -999.2500 -999,2500 -999.2500 -999,2500 -999,2500 -999.2500 -999.2500 -999.2500 -999.2300 -9~9.2300 -999.2500 Vm 01~ HOg V~RI~ ~C~TID'NI L!STIN3 OAGE 39 I'T EN -99~9.1500 HTE N -999.2500 -999.2500 -999.2500 -999.1500 -9~9.1500 H'TEN -9~9.2500 HT~N -999.2500 -999.2500 HT~N -999.2~00 HTEN -9~9.2500 MIeN -999,2500 -'999.2500 -999,2500 HTEN -9~9.2500 HT~N -S9~9.2500 HTEN 10700.29110 ~T~i~ -999.2500 HT~ 10600.2910 HT~i -99'9.2500 ~TS~ 10500.2910 HTSNI -999.2500 HTEN1 ~EPT t0~00.29!0 HTS~ IT~N -99'9.2500 HTEN ~EPT 10300.2910 :HT.: N iTEN -999.2500 HTEN sEmT 10200.2910 !TEN -~99.2500 10111.3320 HTS~ -999°2500 HT~q ;EqVICE NAME ~ERSION ~ : IAXIMU'4 LENGTH :I~ TYPE : ~XT FILE ~A~ :iL~ N~ME ;5RViCE N~ME : ~E RSiON ~ : )ATE : 1AXiMUM LE)~GTH : :ILE TYPE : ~REViOUS FILE : 1JZ4 -999.2500 HT~N -999.25D0 -999.2500 HTEN -999.2500 -999.2500 HTEN -999.2500 -999.2500 HTEN -999.2500 -999.2500 HTEN -999.2500 -999.2500 HTEN -999.2500 -999,2500 HTf~ -999.2500 -999.2500 HT~N -999.2500 -999.2500 HT~N -999.2500 -999.2500 -999.2500 ~T~ -999.2500 -999.2500 MT~ -999o2500 -99~.2~00 HT~ -999.2500 -9~9o2500 ~ -999,2500 .VO OIO.M02 VE~IFIC&TIO~ C!STINS O~G5 40 DATA FgRMAT :Ni'RY :,i,,_O,-KSu ¢ 1 15 1 ~ATJ'M SPECIFiCATIi]N ~:LSZKS CO~5 ENTRY 6:6 0 65 t T 3 2 O 65 .1ZN. 66 65 APl APl API APl FILl SIZ2 SPL LOG TYP9 CL.ASS O0 000 O0 O 0 ¢ ! O0 132 gl 0 0 ¢ 1 O0 130 O1 0 0 ~ 1 O0 ~90 O.G 0 0 ¢ i O0 000 O0 O 0 ~ i O0 O00 O0 0 0 ~ 1 REaR PROCESS CODE (OCTAL) 5~ OOO00000000000 5~ O00000OO000000 5B O000gO00000000 58 OOOO0000000000 53 00000000000000 58 O000OO00000000 :"' DATA )EPT 13152.3320 TPL :V3 -999. 2502 )EOT 13100.1660 T~L :VD -999o2500 >E°T 13000.1660 TPL :VD -999.2500 FVJ )~T 12900.1560 T~L :VD -999.2500 FVj ~:PT 12~00.~560 :V3 -999.2300 =VJ ~T IgTOO.I550 TPL :VD -99~,2530 FVJ >=OT 1~500 i~60 :VD O. 2 ' 51 )~OT 12500,1560 TPL -999.2500 -9~9.2500 -999.250D -9~9.2500 -999.2500 -9~9.2500 -9~9.2500 -999.2500 -9~9.Z500 -9~9.2500 -999.2300 -999.2500 9.9551 0.2915 t0.3926 EATT E~TT EATT E~TT EATT EATT EATT -999.2300 -999.2500 -999.2300 -999.£500 -999.2500 -999.2500 53.07~2 127,1523 EPHI -999.2500 EPHI -999.2500 EPqI -999.2500 fO~i -999.2500 ~PHI -999.2500 EPHI -99'9.2500 ~zP~T. 5.0293 E~Hi 7.1777 V0 010.~02 VE~'I~iC~TI3'~ LISTIN3 ~5 ~1 O. 538~ F¥'J 0.4751 ~mT 12400.1560 TPL V.D 0.33B9 FVj 11 · 1 ~ 2.'5 EATT 0.2~27 ;PT 12300.1560 TPL VD 0.4170 FVJ 112..2051 E ~ T T O. 3384 IZ200.1560 TPL O. 2725 r-Vd 9.3925 ~ATT 0.2705 EPT 12i00.1660 T~' V3 0.2793 9.5~26 EATT O.2BO3 E~T 12000.1560 TPL V9 0.5~89 FVU 12.8~26 ;£&TT 0.5303 5PT 11911.8320 TPL VD -3.4297 ~VD 21.0361 ~EATT -0.4307 ILE N~ME :EDIT .OO6 E~VICE NA~E : E~SI3N ~ : ~TE : AXiMU~ L~NGTH : iOg~ !L~ TYPE : ~XT :IL~ N~M~ : TAPE TRAILER ERVIC:. NAME : EDiT ~AT5:85/05/ 3 ,~R I$1N :FS!A ig>~IINUATiJN ~ : ;O~ENTS :SCHLUmBErgER ,4=LL SERVICES PRDP~IETAR¥ ;RI"iN : i~':_t N~ME :1493122 '3"',ITINUATISN ~ :O1 iEXT REEL NAME : ,,J2LL S~q~'ICES P;~DPRI=T&~f 115.5398 157.3125 53.5742 89.1523 513.312 5 25B. 5 EPHI E.PHI il.7676 17.4315 1.5602 3.0273 7.2266 58.35'94. .VP OIO.HOZ VE~Z~ZC~Tii]~ LZSTY. N?~ P~GE ~2 ~bASK~ CO~PUT..I~ CEnTeR WELL ~A~E FIELD ~T~T~ ~ ALASKA BOROUGH ~ USA ~PI NUMBER I 50-029-21562 REFERENCE NO ~ 72946 Tape Verification [,istlr~g SehlU'm.her~er A!as!<a Computind Center 14-DEC-1988 10146 PAGEI I 88t~21t, 4 ~EE[,, ~ANg I 72946 C:~NTINUATION # REEb ~" ' ' ARCO t :.,DI~ [,IS, PRUDWOE BAY/LISBU~NE POOL, bI~RURNE LGI~8, APIN 50- 8' ~2t14 DATE I 8/ O~ENT ECl? LZS,A~CO PRUDROE BAY/LISBURiqE POOL, blSBURNE 5GI-8, APIN ~0- FILE HEADER DATF = 88112114 I LO *SCFLUMMERGER OFFSHORE SERVICES~ *aNCHORaGM nlVI$IOM COMPUTING: CENTER- ,THIS FIEE CONIaINS REPROCESSED CNT~H NEUTRON ,~OM ARCO [.,ISBUR~E LGI-8 ORIGINALLY RECORDED , *THF CURVES INCL{tDED ARE: *CA['I,bDT - C~bIPMR FRO~ [,PT *CALI,LD~ - CALIPER FRO~ LDT *NPHI,CNL - NEUTRON POROSITY * (~AYN P~SS) - *~PPI,CNR - NEUTRON POROSITY * (REPEAT PASS) *NR~T,CNL - MOR~ALIZED RATIO *NRAT,CNR - 'NORmALIZeD RATIO POROSITY CURVES 27-~AY-86 (~AIN PASS) (REPEAT PASS) AS ORIGINALLY RECORDED ~S U~IGINALbY RECORDED (~AIN PASS) (R~PEAT PASS) US Ir,~G CSU USING ALGORTTH~ ALGORTTHm ~IS Tape veriflcatio. SchlUmberger AlasKa Com~st . uti~ Center , , ;NPMI,TI, I - NEUTRON POROSITY RECOBPUTED USING CONVEN'TIONAb PRECMT ABGORITH~ * ~ITMOUT MOLE C[)RREC[ION AND ~ITHOU~ * (~AiN PASS) - mMP~I,TL2 - NEUTRON POROSITY ~ECO~PUT~D USING CONVENTIONAL PRECNT ABGORITHN '~NP~I,TL3 - NEUTRON POROSITY RECO~PUTED :~SING CONVENTIONAL PRECNT AI~GORITH~ * WITH CALIPER OLE CORRECTION AMD WITHOUT *~PHI,TL4 - INVABID - NOT INCLUDED * , *NP~I.TL6 - '~{ NEtTRON POROSITY RECO~PUTED USING CONVENTIONAL PRECNT AbGORITH~ * WIIH .~AbIPER ..{OLE CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS , * ;NPW'I,TRI - NEUTRON POROSITY RECOMPUTF[" ) USING CONVENTIONAL DRECNT ALGORITHM * WITHOUT HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION * (REPE~T PASS) - *NPWI,TR2 - NEUTRON POROSITY RECOMPUTED USING CONVENTIONAL PRECNT ALGORITHM * wiTH BiT SiZE HOLE CORRECTION ..~u WiThOu~ mNVIRONMENTAL CORRECTION * (REPE~T PASS) - * *NPMI,TR3 - NEUTRON POROSITY RECO~PUTFD USING CONVENTIONAL PRECNT ALGORITHM * ~ITH CALIPER HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION , (REPEAT P~SS) *NPMI,TR4 - INVALID - NOT INCLUDED * *~PWI,T~5- ~!EUT~ON POROSITY RECOMPUTED USING CONVENTIONAL PRECNT ALGORITHM * WITH BIT SIZE HOLE CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS * (REPEAT PASS) * *NPMI,TR6 - NEUTRO~.~ POROSITY PECOMPUTED USING CONVENTIONAL PRECNT ALGORITH~ * WITH CALIPER HOLE CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS * CREPE~T PA,Si * T'a~e Verification L Center 14-DEC-t988 10~46 AL2 - NEUTRON POROSITY RECOHPUTED ~I'rH .... IT SIZE H05~ CORRECTION AND WITHOUT ENVIRONMENT~5 CORR'ECTION (~AIN PASS) - :NPHI,AL3 - ION : (gAIN PASS) $1NP~I:,AL4 - NEU,TRO~!. POROSITY RECO~PU ~ WITHOUT HOL~ CORRECTION (MAIN PASS) N:PHi,AL5 ~V POROSlTY.R~COMPUTED_U~ING~PRECNA AbGORITHM ITS BIT SIZE HObE CORRECTION AND WiTH ENVi~ONMENT~b CORRECTIONS - ~UTRON POROSITY,RECOM.PI{TE~ USING PRECNA. ASGORITH'. ,NPHX,AL6 wITH CALIPE~ HOLE CORrECT,ON AND' WI'TM (~AIN PASS) - $ *NPHI,A.R{. - NEUTRON POROSITY' RECO~PUTED USING PRECNA .A.~GORITH~ , WITHOUT HOLE CORRECTION AND WITHOUT ENVI'RONMENTAb CORRECTION ~ (REPEAT PASS) - ~NPHI AR2 - N...UTRON POROSITY RECO~PUTE~ USING PRECNA AbGORITHM * WITH BIT SIZE HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION * (REPEAT PASS) , *NP~I,A~3 - NEUTRON POROSITY RECO~PUT~D USING PRECNA ALGORITHM ~ WITH CALIPE~ HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION * (REPEAT PASS) *NPWI,AR4 - NflUTRON POROSITY RECOMPUTED USING PRECNA ALGORITHM * WITMO!~T HOLE CORRECTION AND WITW ENVIRONMENTAL CORRECTIONS * (REPEAT PASS) *~PM'I,AR5- NEUTRON POROSITY RECO~PUTED USING PRECNA ALGORITHM * WITH BIT SIZE HOLE CORRECTION A~D WITH ENVIRONMENTAL CORRECTIONS , (REPEAT PASS) ,NPHI,AR6 - NEUTRON POROSITY RECOMPUTED USING PRECNA ALGORITHM ~ WITH CALIPER HOLE CORRECTION AND WITH ~NVIRON~ENTAL CORRECTIONS ~ (REPEAT PASS) lis Tape Verificatio~ Listing Chlumberger Alaska Co~puting Center i4-DEC-1988 I0~46 $ :NPOR,ALI :~POR,AL2 WITHOUT HOLE CORRECTION A~v ~.ITHOUT ENVIRON~ ENT:{L C RREC:TiO~.' (~tlN PASS) - - ENHANC~';D RESOLUTIC3N P{]ROS]'TY RECO~PU~ED USING PREC:~A ALPHA PROCESSING (~AIN PASS) - - ~ ,, ~ WIIHOUT HOL .... CORREC,PION AND WiTH ENViRON~E.NT.iL CORRECTIONS : (~A!N PASS) N 0 ' EWITH BIT ~IZE HOL~ :..'P,~,AL5 :~NHANCED RESOLUTION POROSITY RECOMPUTED USING PRECN,A ALPHA PROCESSING ~NPOR, AL6 *NPOR,ARi - SNPORoAR2 ' *NPOR,AR3 - ,NPOR,A~4 - ~KPeR,AR6 (~AIN PASS) ENHANCED RESOLUTION PO~OS!TY RECO~PUTED USING PRECNA ALPHA PROCESSING WITH CALIPER HOLE COR'RECTION AN,~ (~AIN PASS) - · ~NHANCED RE~OLUTION PORO$.I~, RECOMPUTED USING PRECNA ALPHA PROCESSIN~ WITHOUT HOLE CORRECTION AND WITHOUT ENVIRONMENTAL CORRECTION (REPEAT PASS) ENHANCED RESOLUTION POROSITY RECQ~PUTED USING PRECN~ ALPHA .ROCESSING wITH BIT SIZE HOt~ CORRECTION AND WitHOUT ENVIRONMENTAL CORRECTION (REPEAT PASS) ENHANCED RESOLUTION POROSITY RECOMPUTED USING PRECNA ~bPHA PROCESSING WITH CALIPE~ HOLE CORRECTION AND WITHOUT ENVIRONMENTA_ CORRECTION (REPE~T P~SS) ENHANCED RESOLUTION POROSITY RECOMPUTED USING PRECNA A~PHA PROCESSING WITHOUT HOL~ CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS (REPEAT P~S$) ENHANCED RESULJTION POROSITY R~COMP[}TED USING PRECNA ALPHA PROCESSING WITH ~IT SIZE HOL~ CORRECTION AND WITH ENVIrONmENTAL CORRECTIONS (REPEAT PASS) - ENHANCED RESOLUTION POROSITY RECO~PUTED USING PRECNA ALPHA PROCESSING WITH CALIPE~ MOLE CORRECTION AND WITH ENVIRONMENTAL CORRECTIONS (REPEAT PASS) Ta~e Yeriflcation Ll~tin~ lUm.'~:~ergef .~lasKa Co,~p~tfr:~ CeDter 14-DEC-1988 10146 TYPE . COg~,. 946 T~BLE TYPE i CU~V D~PT DEPTH CHANNEL NANE C~h~ PAliDer C~LI Calipe~ N~T ~eut~o~ Ratio (ND/FO) NRAT Neutron Ratio (ND/FO) N~H~ NEUTROn! POROSITY NPHI NEUTRON POROSITY NPH] NEUTRON POROSITY NPHI ~EUTRON POROSITY NPH! NEUTRON POROSITY NDHI NEUTRON POROSITY N~HI NEUTRON POROSITY NPH! NEUTRON POROSITY NPH~ NEUTRON POROSITY NPH? NEUTRON POROSITY NPH! N~U?RO~ POROSITY NFH! NEUTDON POROSITY N~H! NEUT~OM POPOSIT¥ NPH! NEUTRON POROSITY NPH! ~EUTRO~ POROSITY NPH! ~EUT~ON POROSITY NDHT ~EUTRO~, POROSITY NPH! NEUTRON PUROSITY 10146 PAGE: 6 DEFI NP ! NEUTRON PORC$IT¥ NP~! NM!~T¢ON POROSITY FORMAT SPECIFICATION RECORD ** ** SET TY'P~ - 64EB ** 1 66 g 4 65 16 66 0 66 0 ** SET TYPM - CM&N ** .~-~[--~---~-~;-~-~-~-~-~;~;~;~;~~----~---~~~--~--~-~.-~-~`~ ~ N~M SRRV M SE. VICE A I ~ LE NUMB NUMB SXZE REPR PROCESS ID RDE ~ TYPE CLASS MOD NUMB S~MP BEN COD (HEX) DKPT FT 149312 O0 000 00 0 1 I I 4 68 0000000000 CaI, T LDT IH 140312 00 280 01 0 1 !. i 4 68 0000000000 C~LI LDR IN 149312 O0 280 Ol 0 1 1 1 4 b8 0000000000 N~AT CNL 149312 00 420 01 0 1 1 I 4 68 0000000000 N~AT CN~ 149312 00 420 01 0 1 ! 1 4 68 00000 0000 NPHI CNL PI! 149312 00 890 00 O 1 I 1 4 68 O000O~ · . 0000 NPHI CN~ PU 149312 00 890 00 0 1 I ~ 4 68 0000000000 NPH! TLi. PU 140312 00 890 00 0 1 1 · 4 68 0000000000 NPH! Th2 PU 149312 O0 890 O0 0 1 1 I 4 68 0000000000 NPH7 TL3 PU ~49312 00 890 00 0 I 1 1 4 68 0000000000 NPH1 Th5 PU 149312 00 890 00 0 1 1 I 4 68 0000000000 NUN! TL6 PU 149312 00 890 00 0 ! 1 i 4 68 0000000000 NPHI TR1 PU ~40312 00 890 00 0 1 1 I 4 68 0000000000 NPH! TR2 Pt{ 149312 00 890 00 0 1 I 1 ' 4 68 0000000000 NPHI TR3 PU 149312 00 890 00 0 I 1 1 4 68 0000000000 ?ape Yerif~¢ation L Iumberoer AlasKa Co~ Center 14-DEC-1988 I0:46 N~MF SExY UMIT SERViCM APi APl APi APl MiLE NUmB NUMB SiZE REpR I0 ORD~ # bOG TYPE CHASM MOD NUmB SAMP E6E~ · CODE ** DATA DEPT D~PT, N 'C R N~HI,TR~ N~M~,TR6 NPH~,AR~ D~PT. NR.AT CNR N~HT TL2 NPH! TR1 NPH! TEL NPHI AL5 D~PT, NRAT CNR NPH! TL2 NPHT NPH! TR6 NPH! AL5 NPHT AR3 13150 000 2 943 1 143 13100 000 2~ 147 0 20,578 i,B03 13000.000 3,434 39.096 40,451 40,669 34,955 ]1,016 12900,000 ,055 ,3~3 1,792 1'2~1 1,b~8 2,087 CALI LDT PH TL3 PM AL6 AR5 CALl bDT NPHI CN6 NPHI TL3 NPHI TR2 NPHI ALI NPHI ALL NPHI AR5 CALI bDT NPHI CNL NPHI TL3 NPHI T~2 NPHI ALi NPHI AL6 NPHI A~5 10 213 34 33 054 3o iBO 166 550 83] 229 485 CALI 6DR NPH NR NPHI TR3 NPHI AL2 ~PHI,ARi NPHI, AR6 CALI.LDR NPHI CNR NPHI TLS NPHI TR3 NPHI AL2 NPHI NPHI AR6 1,2 0 22 NPH! 689 488 NPH! 288 NPHI,TR5 892 648 NPM. I,AR2 9 916 NRAT CNL 34 570 NPH! TLI 36 629 NPH! k63 32 52? NPH! ~R2 28 46 q 369 NRAT 928 NPHI 500 NPHI NPH! ,CNL ,76~ ,TR5 ,Ab) ,AR~ 3 1,0{I t:o o 2, 2'455 Verification Listing ~hlomberqer AlasKa Computln~ center D~P~ N'PH! 12800,000 CAbI.b~T 389 NPH I , C L NPHI,TR2 .441 3, g NPHI bDT AR5 NPH! ~NR AL AR3 12608,000 ,i43 AbI,~DT 'PHI, NPH!:,~53 ~pHi ~A61 .AL6 ~PHI.AR5 D~PT N A? 1250~ o ! OO 275 802 693 :~PHI PHI NNPHI PHI NPHI bDT TL3 TR2 ALi AL6 AR5 DEPT, PHITL2 PHT'?R1 NPHT,?R6 NPHI,AL5 NPH{.A~3 i240~ 20 2O 20 23 23 ,000 ,342 ,945 ,575 ,740 ,846 CAb! NPH! NPH! NPHi NPHI NPHI NPHI ,bDT ,CNL , TL 3 ,TR2 ,ALi ,AL6 .AR5 DEPT NWAT CNR NP T62 NP~I TR1 N~H! TR6 NPH! NPHT,AR3 12300 2 21 21 15 19 oo0 379 582 185 024 041 742 CAb! NPHI NPHI NPHI NPHI NPHI NPHI ,bDT .CNL ,TL3 .TR2 ,ALi ,AL6 .AR5 NPHI,TR! NPHI,?R6 NPH~,~L5 NPHI'AR3 1220 0,000 1,004 155 o,gOB 2,5g0 2,447 CALI, NPHI, NPHI NPHI NPHI NPHI NPHI 6DT C N L TL3 TR2 ALi AR5 14-DEC-1988 10146 5 9 864 NPHI: A:L2 953 NPHt 2,44 025 NPHI, 2t.4NPHI, ~45 NPHi.~ 7t4 NPHI, NPHI,AR6 , 143 , 537 NPH l 728 NPHI g i9 20 30 89 ALI,DDR PHI~CNR NPHI,TL5 NPHI;?R3 NPHI,AL2 NPHI,AR! NPHI'AR6 g 12 17 13 932 646 677 603 782 664 510 CALI.bDR NPHI,CNR NPH{.~L5 NPH . R3 NPHI,AL2 NPHI,AR1 NPHI,AR6 10 1 1 1 4 ! 1 072 123 179 452 00 CALl LDR NPHI CNR NPHi Th5 NPHi T~3 NDHI AL2 NPHI NPHI,AR6 549 NRAT,CN~ ]g'5 NPH!.; TL 279 1 · 792 18 NPH! ', I NP:HI 1~:,213 NRAT,CNb 342 ~PH! 0~4 N~H! 8'0 :203 NPH! g 846 NRAT 2i3 NPH! 788 NPH! gT1 NPHI 185 NPHI 200 NPH! 923 1~,322 NRAI 1 .213 NPH I ,2lg 1~,448 NPHI 2 .336 NPH! 16.651 CNL Th6 NL TR5 9,822 b,928 267 3.I69 1.156 NRAT,CNL NPHIeTL! NPH},T66 NPH ,TR5 NPHI,A63 NPH~eAR2 20 398 3.083 2'954 um..:~erqer ~iaSKa computlnO Center PAGEI 12100 000 1 I1 11 6 10 CALI bDT ~PHI CNb ~.~PHI TL3 TR2 AL1 D~PT l~O00~oo0 -99 CALI,LD,Y NPHI,C~:B ~PHI.TL3 ,ALi NPHI,AL6 NPHi,A~5 D 11950,000 CALI '999,~50 41;,118 -999;250 NPH~ -99g,2:50 NPH' 36,735 NPHI '909,250 NPHI END OF DATA 9 ,025 CALI LDR CAbI 6DR -999 34 5 CAbI,LDR PHX,CNR PHI;Th5 250 N~HI,~:R3 ,930 NPH:i;A52 4i7 NPH.f,,ARI 250 NPH ;AR6 041 NRAT CNL 40O :177 NPHt AR2 -999, ~50 ~R.AT.CML ,,999 NP:HI AR2 -999 -999 44 250 NRAT,CNL 250 NPH! 740 NPH! NPHI,, ~2 -999 ·~ I~ER **** TR; !]DtT .00! F~L~ NAME $~RVICE : FblC V~RSIOW : O01A02 D~T~ : 88/i2/i4 FISE TY~E : LO L~ST FILE **** TAPE TRAIbER **** $~RVICE NAm~ : EDiT DATE : 88/12/1.4 O~I~IN : r6~C TAP~ NA~E I 72946 CONTINUATION # : ! PREVIOUS TAPE COMW£~'r : Ei)~T LIS,ARCO PRUDHOE BAY/LISBURNE POOL, b]SBU~N~ LGX-8, APIN chlUmbergeral' asKa'Comput,ir~o Center PA ,~,E. 5¸!